(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE370

ASFUM1_6.PE370       Location/Qualifiers
FT   CDS_pept        join(complement(1148919..1150794),
FT                   complement(1148664..1148857),complement(1148570..1148608))
FT                   /codon_start=1
FT                   /gene_family="HOG000200771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265348"
FT                   /orf_name="AFUA_6G04880"
FT                   /product="Serine-rich protein, putative "
FT                   /protein_id="EAL85552.1"
FT                   /db_xref="HOGENOM:HBG056148"
FT                   /db_xref="HOGENOM:HBG328067"
FT                   /db_xref="UniParc:UPI000051E823"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDI6"
FT                   /transl_table=1
FT                   /translation="MRSTEPSTNSSPRRRALHERSASQTNETSPPPSSLRIVEDKDHED
FT                   EAHDVYSATPFPTKPEHILLPRPGKGQEYAHYPEFHAGEAHDQSTATLSSNASRAAESS
FT                   LLEQSVGDPWDISSTIDPGNTPSQVWEDDPKSSNSSLPEPILPGDKSAYNRSLGSSDAG
FT                   YSDEDLMVLPTATPSIKPVVSETPGPSRQPSGAQHASSSGSSPNVVTIGPPSSPSFVAL
FT                   DNSSLNFVRIGPSSNPDSATRSNSLTSLNSMGTVIRHIGAAPWTHGSSEEQSSRSQSFR
FT                   STPPYHPSVRSNSNSTRPRGRSHSRSLTSSSRSGPPSVIQAIVDSGVFIQYPTILAPSS
FT                   SGSWVDTSQSANASDRTVQEFTPDQSSDRFKSHLSTVTSRWSAELDSSFASGADEPSEL
FT                   SAAEPSRPSAALVRQRPGSSSLWLVSDSDRDEHLDHLSSLPARPTNPAVPSSLSSESRK
FT                   SSLRSNSIKRPGTSSSFVYNILPAWAKMYYGLDGQTVNSALSVIDGTRPPTARPATSNS
FT                   QALRHIPTASGRSRAPTNETIGSVRWMAPPDPRDPRNHWVKGSETDQLSDANNRLRHSW
FT                   SPHLYPDKRAVGQEGKPWTAPSMDSRTEPLLGRRNMQVWSFCLGFVFPLAWFIAAFLPL
FT                   PEKPDAVLDENGPELEMALKMRLHELGRRRYENARWWRNLNRWMTPLGLVIIAIVITLA
FT                   VVGSTVGF"
     atgcgctcga ctgaaccctc aacaaatagc tctcctcgac ggagagctct ccatgagcgc        60
     agtgcatccc aaacgaacga gacgtctcca ccgccgtcct ccttgcggat cgtcgaggat       120
     aaagaccacg aggatgaagc gcacgatgtt tactcagcca ctccgtttcc gaccaaaccg       180
     gagcatatcc tgttaccacg gcctggcaaa gggcaagaat atgctcatta cccggagttc       240
     cacgccggcg aggcacatga tcagtcgacc gctacattgt cgtccaatgc cagccgagcc       300
     gccgagagta gtttgctcga gcagtctgtc ggtgatccct gggatatatc gtccacgatt       360
     gatcccggaa atactccctc acaggtgtgg gaagatgacc ctaaatccag caattcttct       420
     cttcccgagc caattcttcc gggtgacaaa tcggcctata acaggtccct tgggagttca       480
     gatgctgggt attccgacga agacttgatg gtgctcccta cagcaactcc cagcatcaaa       540
     cccgtcgtgt cggaaacccc aggaccgtcg cgccaaccgt caggtgctca acatgcgtct       600
     tcgagcggct caagccccaa cgtcgtgacc attggaccgc cgtcaagtcc cagctttgtt       660
     gccctcgaca actccagctt aaattttgtc cgcatcggtc cttcctcaaa cccggattcg       720
     gccacgcgtt ctaactcgct gacatccttg aactctatgg ggactgttat cagacatatt       780
     ggtgccgctc cgtggactca cggatcttcc gaagagcaga gttctcgttc acaatctttc       840
     cgatctactc ctccgtacca tccatcagtg cgatcaaact ctaactccac ccgacctcgc       900
     ggccgcagtc attctcggtc ccttacttct tcatctcgca gcgggccacc ctcggttatc       960
     caggctattg tggatagtgg cgtgtttatc caatatccca caatcctggc tccctcatca      1020
     tcaggttcat gggtggatac ttcacaatcc gccaacgcat ccgatcgcac tgtccaagaa      1080
     ttcacccccg accaatcatc tgaccgcttc aagtcccatt tgtcaaccgt cacatctagg      1140
     tggtccgccg agctggactc tagctttgct tccggggccg atgagcccag cgaattgtcg      1200
     gctgcagagc cgtccaggcc ctcggctgca ctcgtgcgcc agagaccggg atcgtcctcg      1260
     ttgtggctgg taagcgactc agacagagat gagcatctgg accatctctc aagtctacca      1320
     gctcgtccca ccaatccagc tgtcccaagc agtctttcgt cggagtcgag gaagagtagc      1380
     ttgcgcagca acagtattaa gcgaccggga actagctcaa gctttgtcta caacatactt      1440
     ccggcttggg caaagatgta ctatggtctt gatggacaga ccgtgaactc tgcgctgtcg      1500
     gtgattgatg ggacccgccc gcctactgcc cgccctgcga cgtccaactc gcaagctcta      1560
     cggcatatcc caacagcatc aggccgatcg agagctccaa ccaatgaaac aattgggagt      1620
     gtgcgttgga tggccccacc ggacccccgc gaccctcgaa accattgggt caagggctca      1680
     gagaccgacc agctatcgga cgcaaacaac cggctacgac acagttggtc gccgcacttg      1740
     tatcctgaca agcgggctgt tgggcaagaa ggcaaaccat ggaccgcgcc ttctatggat      1800
     tctcggacag agcccttgct gggacgaagg aacatgcaag tatggtcctt ttgcctgggg      1860
     ttcgtttttc cacttgcctg gttcattgcc gcattccttc cattgccgga gaagccagat      1920
     gcagtgctgg acgagaacgg acccgaactg gagatggccc tcaagatgcg acttcatgaa      1980
     cttgggcgca ggcgttacga gaacgctcga tggtggagga atctcaatcg atggatgact      2040
     cctttagggt tagtgattat cgccattgtt ataacgctag ctgtcgtcgg cagtacagtt      2100
     ggcttctaa                                                              2109
//

If you have problems or comments...

PBIL Back to PBIL home page