(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE375

ASFUM1_6.PE375       Location/Qualifiers
FT   CDS_pept        join(complement(1164861..1164887),
FT                   complement(1164387..1164800))
FT                   /codon_start=1
FT                   /gene_family="HOG000200726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903382"
FT                   /orf_name="AFUA_6G04930"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85547.1"
FT                   /db_xref="HOGENOM:HBG056107"
FT                   /db_xref="HOGENOM:HBG328043"
FT                   /db_xref="UniParc:UPI000051FB5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDJ1"
FT                   /transl_table=1
FT                   /translation="MGSMSSLAKTLLIPAVISLALYLLLSFLIVPFFRRYHQRYSQYLP
FT                   LQAISAHTLSLRDRIADAVMRFFLPSAWRRQTDAQHDNISIFDEEGEIMVGMDMDPSRR
FT                   EALERRRDTADASSRLSRDLEQGFMDDSDDDEDDQGHSRVGR"
     atgggctcca tgtcaagtct ggctaagacc cttcttatac ccgccgtaat ctccctggcg        60
     ctgtatctcc tcctctcatt cctcattgtc ccattcttcc gtcgctatca tcaacgctac       120
     tcacaatatc ttccgctgca agccatttct gcgcatactt tgtcattgcg agatcgtata       180
     gccgatgctg tcatgcgctt cttcctgcca tcggcgtggc ggcggcagac cgacgcacag       240
     cacgataaca ttagcatatt tgacgaggag ggggaaatca tggtcgggat ggatatggat       300
     ccttctcgga gggaagcgct tgaacgacgg cgcgatacgg cagacgcaag tagccgactc       360
     agccgagacc tcgagcaggg gttcatggac gatagcgatg atgacgagga tgatcagggc       420
     cattcaaggg tcggccgatg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page