(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE385

ASFUM1_6.PE385       Location/Qualifiers
FT   CDS_pept        join(1195846..1195951,1196011..1196588,1196666..1196769,
FT                   1196827..1196956)
FT                   /codon_start=1
FT                   /gene_family="HOG000251649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903384"
FT                   /orf_name="AFUA_6G05030"
FT                   /product="Polysaccharide deacetylase family protein "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85537.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG048398"
FT                   /db_xref="HOGENOM:HBG508050"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniParc:UPI000051FDAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK1"
FT                   /transl_table=1
FT                   /translation="MGKKRVLVAYGVDIDAVAGWLGSYGGEDSSNDISRGLWAGHVGTP
FT                   RLLKLFDKYNIKATWFIPGHSLETFPEECAQVRDAGHEIGLHGYSHENPSDMTPEQQKD
FT                   VLDKTYRMLTDFCGRPPRGIVAPWWETSKEMADLLLAYGIEYDHSMSHHDCQMYWLRTG
FT                   DTWTKIDYSQKAETWMKPLVRGQDTGLVEIPGNWYIDDLPPMMFIKNAPNSHGWVNPRD
FT                   IEDIWKDHFDYFYREYDSFVFPMTIHPDVSGRPHVLLMHERIIEHINKHEGVEWVTFEQ
FT                   MCDEFKKNNKPPEGAKMPVTPVLE"
     atgggcaaga aacgtgtatt ggtcgcctat ggagtggata tcgatgctgt tgcggggtgg        60
     ctggggtcct acggtggtga ggatagctcg aacgatatca gtcgaggact ctgggctggt       120
     catgtgggaa cgccacgtct cttgaagctc ttcgataaat ataacatcaa agccacatgg       180
     ttcatccccg gccactccct ggagaccttc ccagaagaat gcgcccaagt gagagatgca       240
     ggtcacgaga tcgggttaca cggctacagc catgaaaatc ccagcgacat gactcccgag       300
     cagcaaaagg acgttctgga caagacgtac cgcatgttga cagacttctg cggcagaccg       360
     cctcggggca tcgtggcgcc ctggtgggaa acgagtaagg agatggcgga tctcctgctt       420
     gcgtacggaa tcgaatacga ccactccatg tcccatcatg actgccagat gtactggctt       480
     cggacagggg acacttggac caagatagac tatagccaga aagcggagac ctggatgaag       540
     ccgctggtcc gcggccagga tactggactt gtagagatcc ccgggaattg gtacattgat       600
     gacttgccgc caatgatgtt catcaagaat gcgcctaata gtcatggatg ggtgaatcca       660
     agggacatcg aggatatttg gaaggaccat tttgactact tctaccgaga gtatgacagc       720
     tttgtctttc cgatgacaat tcatcccgat gtttcaggcc ggccccatgt ccttctcatg       780
     catgaaagga tcatcgagca tatcaacaaa catgagggtg tggaatgggt aacatttgag       840
     caaatgtgcg atgagtttaa aaagaacaac aagcctccag agggtgccaa aatgccggtt       900
     actccggttt tggagtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page