(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE388

ASFUM1_6.PE388       Location/Qualifiers
FT   CDS_pept        join(complement(1201126..1201169),
FT                   complement(1200771..1201027),complement(1200465..1200617),
FT                   complement(1199826..1200412))
FT                   /codon_start=1
FT                   /gene_family="HOG000200648" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265353"
FT                   /orf_name="AFUA_6G05050"
FT                   /product="DUF410 domain protein"
FT                   /protein_id="EAL85534.1"
FT                   /db_xref="HOGENOM:HBG060032"
FT                   /db_xref="HOGENOM:HBG397316"
FT                   /db_xref="InterPro:IPR007317"
FT                   /db_xref="UniParc:UPI000051FFD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK4"
FT                   /transl_table=1
FT                   /translation="MTSRIDKTIARQREKIASGAYYEAHQQLRVIAARYIKQSNYEAAA
FT                   EILAGGATALLRAGSQQGASASGGDLAIMLVDEVYTKAGWGITGGDDDAEGRARKKRLI
FT                   ELLREFPSEEPTRKRFIQEMIGWSGRFGPVERGDAELHHAAGSVYAEDNEPYDAEKHLV
FT                   LGTSESAETLAKLEYEWYTNDEPHTAAIYASRAVFPYLLVGNLRNANKAFLVFTSRLSS
FT                   SNTSLGVQEVSSASSDVRVFPSLPLLNFISMLLLTIQRGSADLFKQLTAHYASQIREVG
FT                   IWDDALSQIGEQYFAIKVPRQGNPLLDMMGSMLFGGQNQGGSRRTPQGRSQSKTVEAPP
FT                   ASMELD"
     atgacctcac gcatcgacaa gacgattgct cggcagcgcg agaaaatcgc ctccggtgct        60
     tactacgaag ctcaccaaca actccgtgtc atcgctgcgc gatacatcaa acaatccaat       120
     tatgaggccg ctgctgaaat attggctggc ggtgcgaccg ctcttctgag agctggatct       180
     caacagggcg cttccgcaag tggaggtgac ttggctatta tgttggtaga tgaggtgtac       240
     actaaggcgg ggtgggggat tactggagga gacgatgatg cggagggtcg agcccgaaag       300
     aagcgcttaa tcgagcttct tcgtgaattc ccttcggaag agcccacgag gaagagattc       360
     attcaggaga tgatcggctg gagcggacgg ttcggtcctg tggagagagg agatgcggag       420
     ctgcaccatg cggctggttc ggtatatgct gaagacaatg agccatatga cgccgagaag       480
     catctcgtcc ttggaacctc cgaatctgct gaaacactcg cgaagctcga gtacgagtgg       540
     tacacgaacg acgaacccca tacggcagct atatacgcct ctcgtgcagt ctttccttac       600
     ttgttagttg gtaacctccg gaacgctaat aaagccttcc ttgtcttcac ctcacggctc       660
     tcttcctcaa atacatccct cggcgtacaa gaagtcagca gcgccagctc cgacgttcga       720
     gttttcccgt ctctgccttt gctgaacttc ataagcatgc tgcttctcac tattcagcga       780
     ggcagcgcag accttttcaa gcagttgact gcccattatg catcgcagat ccgagaagta       840
     gggatctggg atgatgcttt gtcacagata ggcgagcaat acttcgcgat caaggttccg       900
     agacaaggta acccacttct ggacatgatg ggcagtatgc tgttcggagg tcagaaccag       960
     ggcggaagta ggagaacacc ccagggacgg agtcagtcga agaccgtgga ggcgccgccg      1020
     gccagcatgg agctcgatta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page