(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE389

ASFUM1_6.PE389       Location/Qualifiers
FT   CDS_pept        join(1201673..1201747,1201804..1202046,1202114..1202145,
FT                   1202198..1202234,1202355..1202448,1202503..1202673,
FT                   1202756..1203055,1203119..1203264)
FT                   /codon_start=1
FT                   /gene_family="HOG000200647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265354"
FT                   /gene_name="rai1"
FT                   /orf_name="AFUA_6G05060"
FT                   /product="Protein rai1"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription termination, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85533.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006353"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG056022"
FT                   /db_xref="HOGENOM:HBG395893"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="UniParc:UPI0000520459"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDK5"
FT                   /transl_table=1
FT                   /translation="MDGGTFDIQPIGRFYGSNTTIRRPREITCFSYDAEHKFHLGDSSL
FT                   RYYYTPRLPADLNRGFDTFQKLDDTADEHLDALLETIMALEKETGKRCEADIITWRGMM
FT                   TKILTAPFDNLNGFEMNATCFQVGGENNLYKIQQKQIQENQRMPPGMASQDLMAYWGYK
FT                   FETLCLLQQPWDPTPRAEIESREDLVVNNNAQYCSVVRTGIGSTRLIIGGEVDAVWDCK
FT                   PDRKEDPINWVELKTSAEIRNDRDMIKYERKLLKFWAQSFLLGVPKIIVGFRDNHGIVH
FT                   RLEELETASIPNKVKKLGRGTWDGNICINFAAAFLEWLKSTIKEGGTWRIRKLEKSSLI
FT                   QVFKIEETGTGDIISRSFLDWRSRS"
     atggatggag gtacatttga catccagcca attggccgct tctatggctc aaataccaca        60
     atccgacgtc caagggagat cacttgcttc tcatatgatg ctgagcataa gtttcacctc       120
     ggggattcgt ccctgcggta ctattatacg ccgcgcctcc ccgcggattt gaatcgaggc       180
     ttcgacactt tccagaagct agatgatacc gccgacgagc atctagacgc tttgctagag       240
     accattatgg ctctggaaaa agagacagga aagcgatgcg aggccgatat catcacatgg       300
     agaggcatga tgacgaaaat tttgactgct ccttttgaca atctcaacgg tttcgaaatg       360
     aatgcgactt gtttccaggt aggcggtgag aacaacctct ataaaattca gcaaaaacaa       420
     atccaggaga atcaaagaat gcccccggga atggcctccc aggatctgat ggcatactgg       480
     ggctacaaat ttgaaacctt gtgtttgcta caacagccat gggatccgac ccctcgggcc       540
     gagatcgaaa gtcgcgaaga tctcgtggtc aacaacaatg cacaatactg ctctgttgtt       600
     cgaacaggca tagggagtac tcgtttgatt attggtggtg aagttgatgc tgtgtgggac       660
     tgcaaacccg accgcaagga agaccccatc aattgggtag agctgaagac ttcggcagag       720
     atcaggaacg accgggacat gatcaagtat gaacgaaagc tcctaaagtt ctgggcgcag       780
     tcgttcctcc ttggcgttcc caagattatt gttggttttc gcgacaatca tgggatagtc       840
     catcgtttgg aagagcttga aacggccagt atacccaata aggtaaagaa gcttggacgg       900
     ggtacgtggg atggcaacat ttgcatcaac ttcgcggctg cattcctcga atggctcaaa       960
     tcaacaatca aggagggagg aacgtggcga atccgtaagc tggagaagtc gtcgcttatt      1020
     caggtgttca agattgagga gactggaaca ggcgatatta tctccaggtc gtttctggat      1080
     tggcgatcac gctcatga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page