(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE392

ASFUM1_6.PE392       Location/Qualifiers
FT   CDS_pept        join(complement(1209813..1209941),
FT                   complement(1207427..1209745))
FT                   /codon_start=1
FT                   /gene_family="HOG000200623" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207954"
FT                   /orf_name="AFUA_6G05090"
FT                   /product="RNA polymerase II Elongator subunit, putative "
FT                   /protein_id="EAL85530.1"
FT                   /db_xref="HOGENOM:HBG118786"
FT                   /db_xref="HOGENOM:HBG327889"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000051FDAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDK8"
FT                   /transl_table=1
FT                   /translation="MASITTEYISVGGNRHPAAADWDVQLGVLAFGADNNVALWNPSDA
FT                   SQRGVYALLVGHTDKVSAVRFYTCPATGTKLLLTGSIDQTIRIWRADTVDPTKFAHAHT
FT                   LTGHTGSVNTIAVADGVAIIASGAADGTVKIWKIDTQETVIRADLFQSLTMKPRFFPLA
FT                   LSLKPLSTPLSTELKDKPVVLAVAGTMNNVQVYVSEDTLAGANFRLSATLSGHEAWVRS
FT                   LSFTEDKQSKSGDLLLASASQDKYIRLWRLQRGEATKSALSDDADPMLGGLETTLSNKA
FT                   HQFEAAGSKYSVTFEALLFGNEDWIYTACWNPSTERQQLLSASADNTLTIWEQDPVSGV
FT                   WLSVERMGEISVQKGSTTATGSTGGFWIGLWSPNGRQVVSLGRTGSWRAWRYDADRDMW
FT                   LQALGITGHVRSVNGVQWEPTGGYLLSTSADQTTRLHAEWLREGLKSWHEFSRPQIHGY
FT                   DLNCIDILGPARFVSGADEKLLRVFNEPKPIAQLLEKLAGFKPGTDEELPDTAQIPVLG
FT                   LSNQAVGDDIPMEVDEESAAGARQVQANQAMISNLWHPPLEDQLARYTLWPEHEKLYGH
FT                   GYEISAVAVNHDRTLVATACKASSIDHAVIRLYDTSDWREIRPSLKAHSLTITSLCFSS
FT                   DDRYLLSVGRDRQWAVFLRSGQDPSSFSLLTSNPKGHSRMILDAAWAPQVAKPVFATAG
FT                   RDKSIKLWEKVQDSFTCKTTISLENSVTAVSILPSILDASFFLAAGEESGKLSIYQVTV
FT                   DGLEARHIATVDRSVSPSRAITQLSWRPSHRTDVRDTQSRFELAVASEDSSVRVYAISN
FT                   MLS"
     atggcgtcaa tcacgacaga atacatcagt gttgggggaa acaggcatcc ggccgccgca        60
     gactgggatg tgcagttagg cgtgctcgcc tttggcgcag ataacaatgt ggccttgtgg       120
     aatccaagtg atgcctctca gcgcggggtc tatgccctcc tcgttggcca tactgacaaa       180
     gtcagtgcgg tcagattcta cacatgtcct gccacgggta cgaagctact tcttaccggc       240
     tccattgacc aaacaattcg gatatggcgg gctgatacag tcgaccccac caaatttgcc       300
     catgcacata ctcttacggg tcatacaggc tcagtaaata cgattgccgt tgccgatggc       360
     gtcgctatca tcgcatctgg agccgcagat ggtaccgtca agatctggaa gattgacacg       420
     caggaaacag taataagggc cgatctattt cagagtctta cgatgaaacc tcgcttcttc       480
     ccgttggcat tatcattgaa gccgctgtca acaccgctgt caacagaatt gaaagacaaa       540
     cctgtggtat tggcagtcgc cggcacgatg aataatgttc aggtctatgt ttctgaggac       600
     acacttgccg gggcaaactt tagactatct gcgactcttt caggccacga ggcatgggta       660
     cgttctctct ccttcacgga ggataaacaa agcaagtccg gggacctatt gctcgcctca       720
     gccagtcaag ataaatatat ccggttgtgg aggcttcaac gaggagaggc caccaagtct       780
     gcactatcag atgatgcaga tcctatgctt ggaggacttg aaaccacctt atccaataaa       840
     gctcatcagt tcgaagcagc tgggtccaaa tattcggtca ctttcgaagc tcttctgttt       900
     ggaaatgagg attggattta caccgcctgt tggaacccaa gcacggaacg ccaacagctg       960
     ctttctgctt ctgcagacaa tactttgacg atctgggagc aggacccagt gtccggagta      1020
     tggctctccg tagagaggat gggagagatt agcgtccaaa agggatctac cacagctaca      1080
     ggaagcactg gtggtttctg gattggtctt tggtcgccga acggaaggca agtcgtgagt      1140
     ctgggccgaa caggtagctg gagggcatgg aggtatgatg ccgatcgcga tatgtggctg      1200
     caggcactgg ggattacggg tcatgtgcgc tctgtgaatg gtgtgcagtg ggaaccaacg      1260
     ggagggtatt tactttccac cagcgcagac cagactactc gcctgcatgc agagtggttg      1320
     cgtgagggac tgaagtcttg gcatgagttt tccagaccac aaattcatgg ttacgatctg      1380
     aactgcattg atatcttggg acccgctcgc tttgtatcag gcgccgacga aaagctttta      1440
     cgggtgttta acgagccgaa acccatcgca caactactgg agaagctggc gggattcaaa      1500
     ccaggaacgg acgaagagct tccagatact gcccagattc cagttctcgg cctgtctaac      1560
     caggccgtgg gcgatgacat cccaatggag gtagacgaag agagtgctgc aggggcgcgg      1620
     caggtccaag caaaccaggc aatgatatca aacctgtggc atccaccact ggaagaccag      1680
     ttggctcgct atacactatg gcccgagcat gagaaactct atggccacgg ttatgagata      1740
     tcagccgttg ccgtgaacca tgatcgcacc ctggttgcga ctgcttgtaa agcaagctca      1800
     atagaccatg cggtgatacg gctgtacgac acttctgact ggcgtgagat tcgaccttcc      1860
     ctgaaagcgc attctttgac tattacaagt ctttgttttt cgagtgatga ccgatacctt      1920
     ctcagtgttg ggcgagaccg gcagtgggct gtcttcctac gaagtgggca ggacccttct      1980
     tcattctcgc ttctgacatc gaatcccaaa ggccattcta gaatgatttt agatgcggca      2040
     tgggcccccc aagtggcaaa acctgtcttc gcgacggctg gccgagacaa atcaataaaa      2100
     ctatgggaga aggtccagga ctcgttcact tgcaagacga ctatctctct agaaaactcg      2160
     gtcacggctg tttcaattct tccaagtata cttgacgctt ccttcttcct tgcagcgggg      2220
     gaagaaagcg gaaaattatc gatctaccag gtgacagttg acggtctcga agcgagacac      2280
     attgctactg ttgataggtc ggtatccccc tctagagcga tcacccaatt atcgtggcgg      2340
     ccgtcccacc ggacggatgt tagagatact cagagcagat ttgagcttgc tgtggcaagt      2400
     gaggattcct cggtgcgtgt atatgctatt tctaacatgc tttcgtga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page