(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE395

ASFUM1_6.PE395       Location/Qualifiers
FT   CDS_pept        join(1221763..1221808,1221845..1222071,1222143..1222226,
FT                   1222302..1222650,1222709..1222902,1222958..1223162,
FT                   1223230..1223363)
FT                   /codon_start=1
FT                   /gene_family="HOG000233017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207955"
FT                   /orf_name="AFUA_6G05120"
FT                   /product="Glycogen synthase kinase (Skp1), putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85527.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00005206CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL1"
FT                   /transl_table=1
FT                   /translation="MSQNRPGVFSNLRMGENITQEPVELTALLSDHTEVVREKVQDGLT
FT                   GETKEISYSQCKIVGNGSFGVVFQTKMMPSGEDAAIKRVLQDKRFKNRELQIMRIVRHP
FT                   NIVELKAFYYSNGERKDEVYLNLVLEYVPETVYRASRYFNKLKTTMPMLEVKLYIYQLF
FT                   RSLAYIHSQGICHRDIKPQNLLLDPSTGILKLCDFGSAKILVENEPNVSYICSRYYRAP
FT                   ELIFGATNYTTKIDVWSTGCVMAELMLGQPLFPGESGIDQLVEIIKVLGTPTREQIRTM
FT                   NPNYMEHKFPQIKPHPFNKVFRRAPHEAIDLISALLEYTPTQRLSAIEAMCHPFFDELR
FT                   DPNTRLPDSRHPGGAARDLPNLFDFSRHELSIAPALNSRLVPPHARAALEARGLDIDNF
FT                   TPLTKEEMMARLD"
     atgtcacaaa atcgacctgg ggtgttctcg aatctgcgca tgggtgaaaa cattacccag        60
     gagcctgtgg aactaactgc tttgctttcc gaccatacag aagtcgtccg cgagaaggtc       120
     caggatggac tgacagggga aactaaggag atttcgtact cacaatgtaa aatcgtcggc       180
     aatggatcgt ttggtgtcgt ctttcagacg aaaatgatgc caagcggcga ggatgctgcc       240
     attaagaggg tccttcaaga caagcgcttc aaaaatcgag aactgcagat tatgcggatt       300
     gttcgccatc ctaacatcgt agaattgaaa gccttctatt actcgaacgg cgagaggaag       360
     gatgaagtgt acctaaacct cgttctcgaa tacgtaccag aaaccgtgta tcgggcgtcg       420
     cggtacttta ataaactcaa aacgactatg ccaatgttgg aagtcaagct gtatatctat       480
     caattgttcc gttccctggc atacatccat tcacaaggca tctgccaccg tgacatcaag       540
     ccccagaatc tcttacttga tccatccacc ggcatcctca aactctgcga ctttggttcg       600
     gccaagattc tggtagagaa tgagcccaac gtttcctata tctgttcccg ctactatcgt       660
     gcgccggaat tgatctttgg cgccactaat tacacaacaa agatcgacgt gtggtccacg       720
     ggttgtgtga tggctgaact catgcttggt cagccattgt tccctggaga gtcgggaatt       780
     gaccaactgg tggaaatcat caaggttctt ggaaccccta ctcgggagca gatccgcacc       840
     atgaacccaa actatatgga gcacaaattc cctcaaatca agccacaccc attcaacaag       900
     gttttccgga gagctcctca cgaggccatt gatctgatct cagctttgct agaatacacg       960
     ccgacacaac gtctctccgc tatcgaggcg atgtgccacc cgttcttcga cgaactcaga      1020
     gatcccaata cgcgactgcc cgactctcgg caccctggtg gcgctgctag agacctcccc      1080
     aatctctttg atttctccag acatgaactt tctattgcac ctgcattgaa cagccggctg      1140
     gttccccctc atgcacgcgc cgctctcgag gcccgggggc tagacattga caacttcact      1200
     cctctcacga aggaggagat gatggcacgt ctcgactga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page