(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE40

ASFUM1_6.PE40        Location/Qualifiers
FT   CDS_pept        join(127197..128204,128259..128567)
FT                   /codon_start=1
FT                   /gene_family="HOG000194703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207158"
FT                   /orf_name="AFUA_6G00520"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84213.1"
FT                   /db_xref="HOGENOM:HBG053848"
FT                   /db_xref="HOGENOM:HBG327140"
FT                   /db_xref="UniParc:UPI000051ED59"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W906"
FT                   /transl_table=1
FT                   /translation="MPLFQSWTRPPSRRIYLILVSPVIGLLLVYLFFAFDTDAFTPKVV
FT                   VTPISPQQKQATCPQLGGIEDVLVILKTGVTEALEKVPVHFQTTLRCIPNYVLFSDFEE
FT                   EINGTRVIDVLGNVNETIKRTSPDFDLYNRIHEHGRSGLTPADLSRVPNTAFGMPDNPG
FT                   WKLDKWKFLPMIDETLRVRDDAKWYVFMEADTYYIWSNLLQWLAQLDPTKPYYLGNPTQ
FT                   IGSDIFGHGGSGFILSREAMRRASDLRAKDLDGWDRYTGEQWAGDCVLGKLLHDAGVPL
FT                   LWSWPMLQSNTPAEFDHFSEAYSKKPWCFPAVSYHHVGPEDIQELMKFDQMFMQNNSVI
FT                   LHSDVFRHLVHPQLKSPQPDWDNLSDEEHLIDAASCQEMCASEPDCLQYSYEAGKCRTS
FT                   KMAKIGVPKTGVSSGWMTDRIDAIVKELGSCTKPQWVLP"
     atgccgcttt ttcagtcttg gacccgtcct ccatcgcgac ggatttacct catcctcgtc        60
     tccccggtca ttgggcttct tctggtttac cttttcttcg cctttgacac ggacgccttc       120
     actcccaagg tcgtcgtcac cccgatctca ccacaacaaa aacaagctac ctgcccccaa       180
     ctcggaggca ttgaggatgt gctggttatc ttgaaaactg gcgtcacaga agcactagag       240
     aaagtgccgg ttcactttca aacaaccctg cgatgcatcc ccaattacgt actattctcg       300
     gactttgagg aggaaatcaa cggaacccgc gtgatcgatg tccttggcaa cgtcaacgag       360
     actattaaac gtaccagccc agactttgac ctctacaacc gcatccatga gcatggacgc       420
     agcggactca cgccggccga cctgagccgc gtccccaaca ccgcattcgg aatgcccgac       480
     aaccccggct ggaagctgga taaatggaag ttcctcccaa tgatcgacga aacacttcgg       540
     gtccgtgacg atgccaaatg gtacgtcttc atggaggcgg acacgtacta tatctggtcg       600
     aatctcctgc agtggctggc gcaactcgat ccgaccaaac cttactacct gggtaacccg       660
     acgcagattg gctctgacat cttcggtcac ggcgggtcgg gatttattct gtcgcgcgag       720
     gctatgcgta gagcgtcgga cctacgagcc aaagaccttg acgggtggga ccgatatacc       780
     ggggagcagt gggccggtga ctgcgtgctg gggaagttac tccatgacgc gggagtaccc       840
     ttgttatggt cgtggcccat gctgcagtca aatactcctg ccgagtttga tcacttttcc       900
     gaggcttatt ccaaaaagcc gtggtgtttt cctgcggtgt cgtatcacca tgtggggccg       960
     gaggatattc aagagctaat gaagtttgac cagatgttca tgcagaacaa ttctgtcata      1020
     ttgcacagcg atgtgtttcg ccatctcgtc cacccacagt tgaagtctcc acaacccgac      1080
     tgggataacc tctctgacga agagcatctc attgatgcgg ctagctgtca ggagatgtgt      1140
     gcgagcgaac ctgactgtct ccagtattcg tatgaggccg ggaagtgtcg aacttccaaa      1200
     atggccaaaa tcggagtccc gaagactgga gtttcctcgg gatggatgac tgaccggatt      1260
     gacgccattg tcaaagagct gggctcttgc acgaaaccgc aatgggttct cccgtag         1317
//

If you have problems or comments...

PBIL Back to PBIL home page