(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE400

ASFUM1_6.PE400       Location/Qualifiers
FT   CDS_pept        join(complement(1244202..1244319),
FT                   complement(1243874..1244116),complement(1243225..1243790))
FT                   /codon_start=1
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265357"
FT                   /orf_name="AFUA_6G05170"
FT                   /product="Mitochondrial folate carrier protein Flx1,
FT                   putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="EAL85522.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0000F51CD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL6"
FT                   /transl_table=1
FT                   /translation="MTIKDGLSSSFVETIAGFTAGIVSTLCLHPLDLLKTRLQVDRSSP
FT                   SQLGGSLRVIREISRREGGITAFYRGLTPNIIGNSTSWALYFLCYGKTKDLMRRLRGSR
FT                   VLELTSADYFVASGLAGLATSFLTNPIWVIKTRMLSTGSNAPGAYASFTTGVTQIYRSE
FT                   GISGFYRGLLPALFGVSHGALQFMAYEKLKAYRTRMSSASRTSGDSIGLGATPARQLGN
FT                   IDFFLTSSLSKIFAGCVTYPYQVLRSRLQTYDAHLVYRGVRDAMAQIWAQEGFGGFYKG
FT                   LGPNLLRVLPSTWVTFLVYENTKSCLT"
     atgactatta aggatggcct gtcgtcatcc tttgtggaga ccatagcagg atttacagcg        60
     ggaatagtct ctacgctctg cctccatccg ctagatttat taaagacaag gctacaggtt       120
     gaccgatcct cgccttctca acttggtgga tcacttcgtg tcatccgtga aatttcacgc       180
     cgtgagggcg gtatcaccgc attctaccga gggttaacac ccaacatcat cgggaattct       240
     accagctggg cgctgtactt tctttgctat gggaagacga aagatctgat gcggaggctc       300
     cgcggctccc gagtgctgga gctcacctcg gctgactact ttgttgcatc aggactggca       360
     ggacttgcca catcgttttt gacgaatcct atatgggtga tcaaaacccg catgttatcc       420
     accggttcca acgcccccgg agcctatgcg tctttcacca ctggtgtaac acagatctat       480
     cgctcagagg gtatttctgg cttctacagg ggccttttgc ccgctttatt cggagtcagt       540
     catggtgctc ttcaattcat ggcgtatgag aagttgaaag cgtatcgtac aaggatgagt       600
     tcggcttcgc gtaccagtgg cgatagcata ggtttggggg cgacaccggc acgacaattg       660
     gggaatatcg atttctttct cacctcaagc ctttcaaaga tcttcgcagg ctgtgtcacc       720
     tatccatacc aagtgctgag atctcgtctg cagacatacg atgctcacct cgtgtatcgt       780
     ggtgttcgtg atgcaatggc gcagatctgg gctcaagaag ggtttggtgg tttctacaag       840
     ggcttgggtc caaacctcct ccgcgtgcta ccaagcacat gggtaacttt tctggtatat       900
     gaaaatacca agtcttgcct aacttaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page