(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE402

ASFUM1_6.PE402       Location/Qualifiers
FT   CDS_pept        join(1245683..1245702,1245782..1246157,1246228..1246890)
FT                   /codon_start=1
FT                   /gene_family="HOG000200535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751328"
FT                   /orf_name="AFUA_6G05180"
FT                   /product="Splicing factor 3b subunit 4 "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL85521.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051E81E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL7"
FT                   /transl_table=1
FT                   /translation="MSGARHWEQDKEATVYIGNLDERVTDSLVWELMLQAGRIVNVHLP
FT                   KDRVTQSHQGYGFVEFISEEDAEYASRIMNGIRLYGKPIRVNKASADKQKAVEIGAELF
FT                   VGNLDPLVTEQVLYDTFSRFGTLVNIPKVARDDNNLSKGYGFVSFADFESSDAAIANMN
FT                   GQYLMNKQVSVQYAYKKDGKGERHGDQAERMLAAQARKHNVRPPTQPLPPQFTNPGTPM
FT                   AAAGVANGDGTQALNAAPPELATGRGIPPPNLGFQNIPSPQPNRQLPPTAPLANPPPGL
FT                   PARPPPSQAGYGGPQTFLPSGFNSAGQQPPFPQQAAPPPGFAPPGFGPPSGTANPPPLP
FT                   PGFQQPGYGGGR"
     atgtccggcg cgaggcattg ggagcaagat aaagaggcca ccgtttacat cggtaatctc        60
     gatgaacggg ttaccgatag cctggtatgg gagctgatgc tgcaggctgg gcgcatcgtc       120
     aatgttcacc ttcccaaaga tcgagtaacg cagtcacacc agggttacgg ctttgtggag       180
     ttcataagcg aggaggatgc tgaatatgct tcgcgaataa tgaacgggat tcgcctttat       240
     gggaaaccta tacgagtgaa caaggcatct gccgataaac aaaaagctgt ggaaatcgga       300
     gcagagctct tcgttggaaa ccttgatcct ttggtcacgg agcaggtcct atatgatacg       360
     ttcagtcgct tcgggacgct cgtcaatatt ccaaaggttg cacgcgatga taacaacctt       420
     tccaagggct atggattcgt atcttttgcc gacttcgagt cctcagatgc tgctattgcc       480
     aacatgaacg ggcaatatct catgaacaaa caagtttccg tgcagtacgc ctataaaaaa       540
     gatggcaaag gcgaaagaca cggtgatcag gcagaacgaa tgctggctgc gcaggctcgc       600
     aagcataatg tccgtccacc aactcagccg cttcctccgc aattcaccaa cccgggaact       660
     cctatggcag ccgctggggt tgctaatgga gacggcacac aagcgttgaa cgccgctccg       720
     ccggaattag cgacgggaag gggcataccg ccgcctaact tgggcttcca gaacatacct       780
     tcaccacaac ctaatcgaca actccctcct acggctccct tggcaaaccc acctcccggt       840
     ttgccagcaa gacctccgcc ctcgcaagcc ggttacggtg gccctcagac atttctcccc       900
     tctggtttca attctgctgg tcaacagcca cccttcccac agcaagcggc accgccgccg       960
     gggttcgcac caccgggttt cggtccccca tcgggaaccg ctaaccctcc accattacca      1020
     cctggcttcc agcaacctgg ttatggtggc ggccgctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page