(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE404

ASFUM1_6.PE404       Location/Qualifiers
FT   CDS_pept        join(1248660..1248715,1248841..1248931,1248998..1249021,
FT                   1249093..1249217,1249308..1249485)
FT                   /codon_start=1
FT                   /gene_family="HOG000200513" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903386"
FT                   /orf_name="AFUA_6G05200"
FT                   /product="60S ribosomal protein L28 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85519.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG349501"
FT                   /db_xref="HOGENOM:HBG621898"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="UniParc:UPI000051FDA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDL9"
FT                   /transl_table=1
FT                   /translation="MAAERTNVSSDLVWQITRNQNAFLVKRRTGGGSQFSRDPLNLQNK
FT                   QSFKYAGYANTKAVGVQATENGGVVVITKKPGNPQQPAKNLVSVSWGPNAATRKIYKAV
FT                   ASKTAKNGYRADLREDAVARVSAIRRSQKPKKDAAPKKLRGAQARKAAEQKSE"
     atggccgccg aaagaacaaa cgtttccagc gaccttgtct ggcagatcac tcgtaaccag        60
     aatgcttttc tggtcaagcg gaggaccggt ggtggctccc aattctcccg cgatcccctg       120
     aacctgcaaa acaagcagtc ttttaagtat gctggctatg ccaacaccaa ggctgtcggt       180
     gtgcaggcta ctgagaacgg cggtgtcgtt gtcatcacca agaagcctgg caaccctcag       240
     cagcccgcga agaacctggt cagcgtcagc tggggcccta acgctgccac ccgcaagatc       300
     tacaaggctg tagcaagcaa gaccgccaag aacggctacc gcgccgacct ccgtgaagac       360
     gccgttgctc gtgtgagcgc catccgtcgc tcccagaagc ccaagaagga cgctgcccct       420
     aagaagctca gaggcgctca agccagaaag gctgcggagc agaagtcgga gtaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page