(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE41

ASFUM1_6.PE41        Location/Qualifiers
FT   CDS_pept        join(complement(133495..133762),complement(133238..133324),
FT                   complement(130789..131499),complement(130400..130711),
FT                   complement(130204..130349))
FT                   /codon_start=1
FT                   /gene_family="HOG000048656" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262220"
FT                   /orf_name="AFUA_6G00530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84212.1"
FT                   /db_xref="HOGENOM:HBG056260"
FT                   /db_xref="UniParc:UPI0000520531"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W907"
FT                   /transl_table=1
FT                   /translation="MIQLSDEPLPTRTECDDDLANRITYLLGRVINRCLLCDAVPLDQC
FT                   EWNGLRDQLEDWRTSLPSSFDPILTPDLLPNSAFPGMWTTSGWHGHHATIVCALALSSR
FT                   SAPVWVNSFGPIAFSHTSINRQYYKNPVFQHYFLARDIHPTTSTTPTTTTTTTTTTTTT
FT                   NNMTIRHVSFNDMTLEDMLINDLLNSNIILRNKIADDLTSLDIAIEDTAINDFADSSID
FT                   VKSIVIDELSTMNMILTELASTIRPLKKWSGMTSSAATSSTATSTSPAWSLITPTETPP
FT                   SENDEEDPDWPFVARKGTLPPSPPLRQRVPTPDEVTEEFLSHTLYPLFGLSRHPNPRGV
FT                   WTLEQNEKAPIPISLDKKDPQLLDHETSCKRIRAILNHCYVEELGYRKQNPAKRSSAVL
FT                   SIPRCGGFEQEVESLGVRFPIEGKLDFVVNNATEPGNGIGVVICVNLCPSANLWQCISF
FT                   MALCHNVRKIENKRLTSVYGVATNGKEFYFLEIDDNDMVRHRFPAHQHE"
     atgattcagc tttcggatga gcctctgcct acgaggactg aatgcgacga cgatctcgcc        60
     aatcgcatta cttatctcct aggaagagtc atcaatagat gtcttctttg tgatgctgtc       120
     cctctggacc aatgcgagtg gaacggtctg agagatcagc tcgaggactg gaggacatcg       180
     cttccttcgt ctttcgaccc catccttaca ccagaccttc tccccaatag cgcctttccg       240
     ggtatgtgga cgacgtcggg ctggcacggg caccacgcca ccattgtttg cgctttggcg       300
     ctgtcgagta ggtctgcgcc tgtttgggtg aattcctttg ggcctatagc tttctcgcat       360
     accagcatca acaggcagta ctataagaac cccgtcttcc agcactactt tcttgctcga       420
     gacattcatc cgacaacatc gacaacaccg acaacgacaa cgacaacgac tacaactacg       480
     actacaacta ataacatgac gatcagacac gtttccttta acgacatgac cctcgaagac       540
     atgttgatca acgaccttct caacagcaat atcatcctca gaaataagat cgctgacgac       600
     ctcaccagct tggacatagc aattgaagac acggccatca acgattttgc cgacagcagc       660
     atcgacgtta aaagcatagt catcgacgaa ctgtccacta tgaacatgat cctcacagag       720
     ctcgccagca caattagacc cttgaaaaaa tggtcaggaa tgacctcgtc agcagcaaca       780
     tcatcaacag caacttcaac ttcaccagcg tggtcattga ttactcctac ggagacaccg       840
     ccctcagaga acgacgaaga ggaccccgac tggccctttg tcgcacgaaa gggtaccctc       900
     cctccttcgc ctcctttacg acagagggtt ccaactccgg atgaggtcac cgaagagttc       960
     ctctctcata cactctatcc attgtttggc ctatctcgtc atccaaatcc acgtggggtg      1020
     tggaccctcg aacagaacga aaaggccccc atccccatca gcctcgacaa gaaagacccg      1080
     caactcctcg accacgaaac ctcctgcaaa cgaatccgag caatcctaaa tcactgctat      1140
     gtggaggagc tcggctatcg caaacagaat cccgccaaac ggtcctcagc agttctttct      1200
     attcctcggt gtggaggctt tgaacaagaa gttgagtcat tgggtgtcag attcccgatc      1260
     gaagggaagc ttgattttgt tgtaaacaac gccacggagc ctggaaacgg cattggtgtt      1320
     gtcatttgtg tcaatctgtg cccgtcagcc aacctctggc agtgcatctc attcatggca      1380
     ctctgccata acgttcgaaa gattgaaaac aaacgactca cctcggtgta tggcgtggcg      1440
     accaacggaa aagaattcta cttcctcgag atcgacgaca acgatatggt acggcaccga      1500
     tttcccgcgc atcagcatga atag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page