(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE410

ASFUM1_6.PE410       Location/Qualifiers
FT   CDS_pept        join(complement(1261801..1262015),
FT                   complement(1261342..1261714))
FT                   /codon_start=1
FT                   /gene_family="HOG000217815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265362"
FT                   /orf_name="AFUA_6G05270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85512.1"
FT                   /db_xref="HOGENOM:HBG056654"
FT                   /db_xref="UniParc:UPI000051FDB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM6"
FT                   /transl_table=1
FT                   /translation="MDVKEIIALHSLLHLVFHRNKNQHGNTKWWKWLSILKRITLKLAK
FT                   SLETDAFHTVRLYKEHLALHVIPNCYLAFSRVIADGQFSTIGIVLIAALARLTKATGID
FT                   KEMNSLRGKKMAFRPSTCLKNLQQEDVGEVVSRLSESFIPLPSFQSGKQAGSEEPNSHQ
FT                   REAKETATVAVKPSGQKKRKKNAIDDLFNGVL"
     atggatgtca aagaaatcat agctttacat tcactgcttc atttagtttt ccaccgaaat        60
     aagaatcagc acggaaacac gaaatggtgg aaatggttgt ctatcctgaa acgcatcact       120
     ctgaaactcg ccaagtcatt ggagaccgat gccttccata cggttcgcct atataaagag       180
     cacctggctt tgcatgtcat tccaaattgt tacctagcat tctcgagagt catagccgat       240
     ggccagtttt ctacaatagg catagtgctg atagctgcac ttgctcgttt aactaaagcg       300
     acaggaatag acaaggagat gaactccctg cgtggaaaga aaatggcatt tcggccgtcg       360
     acttgcctta agaatttgca acaggaggat gtgggagaag ttgtttctcg gttgagcgag       420
     tcttttatcc ctcttccaag ctttcaatct ggcaagcaag ctggttcaga agaaccaaat       480
     agccaccaaa gggaagcaaa agaaaccgct actgtagctg tcaaaccttc gggccagaag       540
     aagaggaaga agaatgccat cgatgatctt ttcaatgggg tcctatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page