(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE413

ASFUM1_6.PE413       Location/Qualifiers
FT   CDS_pept        join(complement(1271163..1271244),
FT                   complement(1271074..1271087),complement(1270949..1271005),
FT                   complement(1270239..1270901))
FT                   /codon_start=1
FT                   /gene_family="HOG000200436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903389"
FT                   /orf_name="AFUA_6G05300"
FT                   /product="CCAAT-binding factor complex subunit HapE "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85509.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748837"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0000520210"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDM9"
FT                   /transl_table=1
FT                   /translation="MEQSSQSTAQQQGRQQPVYDTRNGGHYGASAALSAQGYAPVAELY
FT                   TGTWANVNQGLQGTARDILTTYWQHIINHLESDNHDYKIHQLPLARIKKVMKADPEVKM
FT                   ISAEAPILFAKGCDIFITELTMRAWIHAEDNKRRTLQRSDIAAALSKSDMFDFLIDIVP
FT                   REEATSHAKRSSQTTAGAAGSSAATGAQLPPSQHGVQHPPHHMGPPDYGSLGQHGMGQD
FT                   QEYRQPTMYGGAVQSDPTAAYGQPQSQIFEGMYNPYPHLPPQQVCQNSS"
     atggaacagt cttcgcagag caccgcacag cagcaaggta gacagcagcc agtgtatgac        60
     accaggaacg gcggacatta tggtgccagt gctgcgcttt cagcgcaggg gtatgccccc       120
     gtcgctgagc tttatacggg gacctgggca aatgtcaatc aagggctaca aggcacagcc       180
     cgcgacatac taacgaccta ttggcaacac attatcaacc atctcgaatc ggacaatcat       240
     gactacaaaa ttcaccaatt gccactggcc cgtataaaaa aggtcatgaa ggcagatccc       300
     gaggtgaaga tgatatccgc ggaagcgcct atattatttg cgaaaggctg cgatatcttc       360
     attacagaac tcactatgcg ggcttggata catgctgaag ataacaagcg acgcacgttg       420
     caaagatcag atatcgcagc ggccttatcg aaatctgata tgtttgattt cctgattgac       480
     atagtgcctc gtgaagaagc aacatcgcat gcgaaacggt cgagccagac aaccgcaggt       540
     gctgcaggtt cctctgctgc gacaggtgcc caactgccgc cttctcaaca tggtgttcaa       600
     catcctccgc accatatggg tcccccagat tacggttctc tgggacagca tggcatggga       660
     caagaccaag aatatcgaca gccaacgatg tacgggggag ccgttcagtc ggatccgacg       720
     gccgcatatg gacagccgca atcccaaatt tttgaaggaa tgtacaatcc ttatccacat       780
     cttccgccac agcaggtatg ccaaaactct tcttaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page