(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE414

ASFUM1_6.PE414       Location/Qualifiers
FT   CDS_pept        join(1272227..1272405,1272464..1272635,1272847..1273221)
FT                   /codon_start=1
FT                   /gene_family="HOG000200415" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903390"
FT                   /orf_name="AFUA_6G05310"
FT                   /product="Nucleolus protein required for cell viability,
FT                   putative"
FT                   /protein_id="EAL85508.1"
FT                   /db_xref="HOGENOM:HBG059610"
FT                   /db_xref="InterPro:IPR014810"
FT                   /db_xref="UniParc:UPI000051F66A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN0"
FT                   /transl_table=1
FT                   /translation="MQVEACGKVALHSIEEGALNDHDIEQLLYEAESRLQTCKVQPIST
FT                   SQDQAIGHSGKPFLNIPKLATDSSLQSYIAQRDDVALADTKRIIDPLQMNLSNKRLATV
FT                   KIQQASVNSSTQKEKPTAGADWFHLPKTELTTELKRDLQLIRMRSVLDPKRHYKKESGK
FT                   AQPPKYSQLGTIIEGPTEFFSGRIAKKDRKKTFVEDVLALERETKRFASKYREIQISKQ
FT                   SGKRSFYSNLRAKRNRQKK"
     atgcaagtag aagcatgtgg caaagttgca ctgcattcta ttgaagaagg tgccttgaat        60
     gatcacgata tcgagcagct gctttatgag gctgagtctc gattgcaaac atgtaaagtt       120
     cagccgataa gcacttcaca ggaccaagcc attggccact cgggaaaacc cttcttgaac       180
     attccgaagc tcgcaacgga ctcctcatta caatcttata ttgcgcagcg agatgatgtt       240
     gccttggctg atacgaaacg catcatcgat cccctgcaaa tgaatttatc taataagagg       300
     ttggccactg ttaaaatcca gcaggcttcc gtcaactcct caacacaaaa ggagaagcca       360
     actgccggtg ccgactggtt ccatcttcca aagacagaat tgacaacaga gctcaaaaga       420
     gatcttcaac tcatcaggat gcgttctgta ttagatccca agaggcatta caagaaagaa       480
     agcggcaagg cacagcctcc aaagtattct cagttgggaa caatcattga gggtccaacg       540
     gaattcttca gtggtcgcat cgcaaagaaa gaccgcaaga agaccttcgt tgaagatgtc       600
     ttggctttgg agcgggaaac caaacgcttt gcttccaaat acagggagat tcaaatatcg       660
     aagcaaagcg gcaaaaggtc attctacagt aaccttcgtg cgaaaagaaa ccgtcaaaaa       720
     aaatga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page