(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE416

ASFUM1_6.PE416       Location/Qualifiers
FT   CDS_pept        join(1276031..1276083,1276146..1276570,1276649..1276824)
FT                   /codon_start=1
FT                   /gene_family="HOG000217816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265365"
FT                   /orf_name="AFUA_6G05330"
FT                   /product="37 ribosomal protein Rsm10, putative "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85506.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG056608"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="UniParc:UPI0000F51CDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDN2"
FT                   /transl_table=1
FT                   /translation="MLRSKNSAPSSGSGVKEWSERLDSVGQKARLPRSVQALYLRPLRR
FT                   KPEFGLPVCDLQLRSYSVRNLEFFADFALRAAYYLELPVSGPVPLPRIVERWTFPRSNF
FT                   VHKKSQENFERITLRRLIQIKDGHPQAVQAWLAFLRKHAFYGVGMKANVWDHESLDVAR
FT                   NMDESLPDIEKSLEPYLSHFGYRSDGSDQSAVFDLLESERFTHNKSPLTDIRKG"
     atgctcagat cgaagaattc agcgccttca tcaggttcag gtgtcaaaga atggtcagag        60
     cgcttggaca gtgttggtca gaaagcccga ctcccgcgga gcgtacaagc cttgtatctt       120
     cggccacttc ggcggaagcc tgaatttggt ctgccagtct gcgatcttca actcaggtct       180
     tatagcgttc gcaacttgga gttttttgct gactttgctc tacgagctgc atattacctg       240
     gaacttcctg tttctgggcc ggttcccctg ccacggatcg ttgagcgctg gactttcccg       300
     cgaagcaatt tcgttcacaa aaaaagtcag gagaacttcg agcggataac ccttcgccgg       360
     ttgattcaga ttaaagatgg gcatccccaa gctgtacagg catggctggc ttttttgcgt       420
     aaacatgcat tttacggagt tggtatgaaa gcaaatgtgt gggatcacga aagcctcgac       480
     gtggcccgga acatggatga atcactgccc gatatcgaga agtcgcttga accgtacctc       540
     tcacattttg gttatcggag tgacggatcg gatcagagcg cagtatttga tcttttagaa       600
     agtgagcgtt tcactcataa caagagcccc ttgacagaca ttcgcaaggg ttaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page