(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE421

ASFUM1_6.PE421       Location/Qualifiers
FT   CDS_pept        join(1336683..1336868,1336922..1337152)
FT                   /codon_start=1
FT                   /gene_family="HOG000181652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207962"
FT                   /orf_name="AFUA_6G06330"
FT                   /product="AdoMet-dependent tRNA methyltransferase (MTase)
FT                   complex subunit Trm112, putative"
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL88485.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG011422"
FT                   /db_xref="HOGENOM:HBG526194"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniParc:UPI0000520183"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH9"
FT                   /transl_table=1
FT                   /translation="MKLVTANFLTCAVKGCKTSSASFPLHFQDAELELEELDFQPEFIR
FT                   NIIPRVDWDGLRVTANELGFSNLPEKKPEGEALNDEQTLKDLHRLLLETHVIEGKLVCG
FT                   NCGHEYLIKEGIANFLLPSHLGLGLPDRIYIVAC"
     atgaagttag tgacagcgaa ttttctaact tgcgccgtca aggggtgtaa gacatcatca        60
     gcgtcatttc ctctccactt tcaagacgct gagcttgaac tcgaggagct tgacttccaa       120
     ccggaattca tacgcaatat tattcctcgc gttgactggg atggactgcg ggtgactgcg       180
     aatgagcttg gattctccaa tcttcctgag aagaagcccg aaggggaagc cctcaatgac       240
     gagcagacat tgaaggatct gcatcggttg ctactcgaga cgcatgttat tgagggaaag       300
     ttggtgtgcg ggaattgcgg tcatgaatat ttgatcaaag agggaattgc gaatttcctt       360
     ctgccaagtc acttgggttt gggattacct gaccgcatct atatagtcgc ttgctaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page