(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE424

ASFUM1_6.PE424       Location/Qualifiers
FT   CDS_pept        join(1347719..1347843,1347936..1348344)
FT                   /codon_start=1
FT                   /gene_family="HOG000229253" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207964"
FT                   /orf_name="AFUA_6G06345"
FT                   /product="DMRL synthase family protein "
FT                   /function="riboflavin synthase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /cellular_component="riboflavin synthase complex "
FT                   /protein_id="EAL88488.1"
FT                   /db_xref="GO:0004746"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0009349"
FT                   /db_xref="HOGENOM:HBG311126"
FT                   /db_xref="HOGENOM:HBG408416"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniParc:UPI00005208A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNH6"
FT                   /transl_table=1
FT                   /translation="MAIIQPLVEGAKKSLLAAGVLEEDITLETVPGSYELPFAAQRIYT
FT                   ASQLQAAKGSSSAGGISATDLLSSSTADLSKTSPTSTAAKPFDAIIAIGVLIKGETMHF
FT                   EYIADAVSHGLMRVQLDTGVPVIFGVLTVLTEEQGLERAGLGKKGMHNHGEDWGKAAVE
FT                   LGLKRRDWVEGKIV"
     atggcaataa tccagcctct cgtggaaggg gcaaagaaaa gccttttggc ggccggagta        60
     cttgaagagg atatcaccct tgagacagtg cccggcagtt acgaattacc ctttgctgct       120
     cagcggatat acacggcctc gcagctccaa gctgccaaag gatcatcatc cgcaggaggg       180
     atcagtgcga cggatttatt atcgtcctct actgcagacc tgagtaagac atcgccaact       240
     tcgactgcag ctaagccttt tgacgccatc attgctatcg gtgttctcat caagggagag       300
     acaatgcatt ttgagtacat tgcggatgcg gtgtctcatg gtttgatgcg tgttcaactt       360
     gatactggcg tgccagtaat tttcggagtg ctcactgttc tgacggaaga acaaggcctg       420
     gaaagagctg gtcttggcaa gaagggaatg cacaatcatg gtgaggattg gggtaaagcc       480
     gccgtggaac ttggtttgaa gagaagagac tgggtagaag gaaaaattgt ttag             534
//

If you have problems or comments...

PBIL Back to PBIL home page