(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE433

ASFUM1_6.PE433       Location/Qualifiers
FT   CDS_pept        join(1385399..1385477,1385551..1386173,1386228..1386284)
FT                   /codon_start=1
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265370"
FT                   /gene_name="pno1"
FT                   /orf_name="AFUA_6G06430"
FT                   /product="Pre-rRNA-processing protein pno1 "
FT                   /function="RNA binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL88497.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG014182"
FT                   /db_xref="HOGENOM:HBG380350"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI0000520184"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WNG7"
FT                   /transl_table=1
FT                   /translation="MPAPTALLRKSDEPLSAEEPSLTFSSDAQASGQGEAPSPIPTESA
FT                   QHSDMRIDEESRPVFTPITDAGTVLRVETRKVPVPPHRMTPLKANWPKIYPPLVEHLKL
FT                   QVRMNIKNRAVELRTSKFTTDTGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIRSFE
FT                   IRDVKASLNGEHLSRAIGRIAGKDGKTKFAIENASRTRVVLQGTKVTILGRFRDLGIAQ
FT                   EAIVSLILGSPPGKVYGNLRKVASRMKERF"
     atgccagcac cgacagcgct tcttcgaaag tctgatgagc cactctcggc cgaagagccg        60
     tctttgactt tttcttcaga tgctcaagca tccggccagg gagaagcacc atctccgatt       120
     cccacggaat ccgcccagca cagcgacatg cgcattgatg aagagagccg gccagtgttt       180
     acaccaataa cggatgccgg gaccgtactg cgagttgaaa cgcgaaaggt gccagttcct       240
     cctcaccgta tgacaccctt aaaggcaaat tggcctaaga tctacccgcc cctggttgag       300
     catctcaaac tacaagtgcg aatgaacatc aagaaccgag cggtcgaact gcgtacctct       360
     aaattcacca ccgacacagg agcgttacag aaaggcgaag attttgtaaa ggcattcaca       420
     cttggattcg atgtcgacga tgccattgcc ttattgaggc ttgatgacct gtatattcgc       480
     tcatttgaga tccgtgatgt caaggcttcg ttgaacggag aacatcttag tcgcgctatt       540
     gggcgaattg cgggcaagga tggaaagacc aagtttgcca tcgaaaacgc aagccgaaca       600
     cgggtcgtgc ttcagggcac aaaggttacc attttgggca gattcagaga tttgggaatc       660
     gcccaagaag ccattgtttc tctgatcttg ggcagtcctc cgggtaaggt gtatggaaac       720
     ctgcgtaaag tggcgtctcg tatgaaggag cgattttga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page