(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE434

ASFUM1_6.PE434       Location/Qualifiers
FT   CDS_pept        join(complement(1387267..1387364),
FT                   complement(1386523..1387210))
FT                   /codon_start=1
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265371"
FT                   /orf_name="AFUA_6G06440"
FT                   /product="Proteasome component Prs3, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="EAL88498.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG318170"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI0000520890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG6"
FT                   /transl_table=1
FT                   /translation="MASVIAHDPQSEAIGYSFAQQSSTAVREHSFYPYTDNGGSTLGIT
FT                   GSDFAILAGDTRSVAGYNINSRYVPKVFKIGGDAETGEGAHILLSVVGFAADGQALKER
FT                   LDAVVRMYKYQHGKPMSVRACAQRLSTILYQKRFFPYYVHAILAGLDEEGKGALYSYDP
FT                   VGSYEREQCRAAGSAASLIMPFLDNQVNFKNQYIPGSGEGHALEPKKAEPLPRATVEQL
FT                   VRDAFTSAVERHIEVGDGLQMMVITQRGIEEIYTPLKKD"
     atggcctcgg tcatcgctca cgaccctcaa agtgaggcta tcggatattc ctttgctcag        60
     caaagcagca ccgcagtcag agaacactca ttctaccctt ataccgacaa tggcggctct       120
     accctaggaa tcacaggatc cgattttgcg attctagcgg gtgatacccg ttctgttgcc       180
     ggttacaaca ttaattctcg ctacgttccc aaggttttca agattggagg tgatgccgag       240
     acaggggagg gtgcccacat tctgctctcg gtcgtgggtt tcgctgcaga tggtcaagca       300
     ctcaaggagc ggctagatgc ggtggtaagg atgtacaagt accagcatgg aaagcccatg       360
     tctgtacgag cttgtgctca acgcctatcg actattctat accagaagcg cttcttccct       420
     tactacgtcc atgcaatcct tgcgggcttg gatgaagaag gcaaaggggc gttgtacagc       480
     tacgatccag tcggctcgta cgaaagggag caatgccgag cagcagggtc ggcagcgagc       540
     ttgattatgc cttttttgga caatcaagtt aatttcaaga atcagtacat cccaggcagc       600
     ggggaaggac atgcccttga acccaagaag gcagagccat taccaagggc gacagtcgaa       660
     caactagttc gggacgcatt cactagtgct gttgagagac atatcgaagt cggagatggt       720
     ttacagatga tggtgatcac ccagagaggg atagaggaga tttatacacc tttgaagaaa       780
     gactag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page