(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE435

ASFUM1_6.PE435       Location/Qualifiers
FT   CDS_pept        join(1389089..1389118,1389178..1389325,1389390..1389994)
FT                   /codon_start=1
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265372"
FT                   /orf_name="AFUA_6G06450"
FT                   /product="Proteasome component Pre4, putative "
FT                   /EC_number="3.4.25.1"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="EAL88499.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG028814"
FT                   /db_xref="HOGENOM:HBG629728"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="UniParc:UPI000051FCF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG5"
FT                   /transl_table=1
FT                   /translation="MNHFPEAWGRPRNDVYGPYNPSYLQTSGPKSHTQSPAVTGTSVVA
FT                   VKFGGGVAIAADNLASYGSLARFSDVKRLRVFGESAVIGFSGDVSDMQHIDRLLESIDI
FT                   RENYSTHGNTLNAKNLHTYLSKVFYKRRSEFNPLWNQVLVAGFDGNNQPFLSSADLLGT
FT                   TFSAPHLATGFGAHLAIPILRRLFPEEKPVEEITKEEAVNALKECLKVLWYRDARSLDK
FT                   FSLAVITKEGVEMHEDQKIEKQSWAFAESIRGYGAQVN"
     atgaatcatt ttcctgaagc ctggggccga ccaaggaacg atgtatatgg gccttacaat        60
     ccgtcgtacc ttcagacttc tggccccaag tcacatactc agtctccggc tgtgacgggc       120
     acgtcggtag tagcggtcaa attcggtgga ggagttgcaa tcgccgctga taacttggca       180
     tcatatggct ctcttgctcg attctcggac gtcaagcgtc tacgtgtatt cggtgaatct       240
     gccgtcattg gattcagtgg tgacgtgtct gatatgcagc atatcgatcg ccttctggag       300
     tcgattgata tccgagagaa ctactcaacc catggaaaca cgctgaatgc gaaaaatctc       360
     catacctatt tgtccaaggt tttttacaag cgacgttcgg agttcaatcc actgtggaat       420
     caagtccttg ttgccgggtt cgacggtaac aaccagcctt tcttgagctc tgcagatttg       480
     ctcggaacaa cattttcagc gccacacctt gcaactggat tcggtgctca tctcgctatt       540
     ccgatcctgc gtcgactgtt tcccgaggaa aagcctgttg aagaaattac caaggaagag       600
     gcggtgaatg cgttgaaaga gtgtctcaaa gttttgtggt acagagatgc acggagtctc       660
     gacaagttct cgttggcagt gattaccaag gaaggggtgg agatgcatga ggaccagaag       720
     attgagaagc agagctgggc attcgctgag tccatcaggg gatacggagc tcaggttaac       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page