(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE436

ASFUM1_6.PE436       Location/Qualifiers
FT   CDS_pept        join(complement(1391307..1391321),
FT                   complement(1390406..1391170))
FT                   /codon_start=1
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056668"
FT                   /orf_name="AFUA_6G06460"
FT                   /product="Fumarylacetoacetate hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL88500.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG419601"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI000051F5AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG4"
FT                   /transl_table=1
FT                   /translation="MSTFSLFKCLSISSLSGQRLIRFLAKDGQVYYGDAILPVGVSDLA
FT                   KVTKAKVIQGDIFGQHYVTDQVSEVQMLLAPLARKDIRTVRCLGLNYEQHARESNLPIP
FT                   KYPVLFYKPVTSIAGPRDDIPISTMAQEGEGLDYECELVIVIGKEAKDVPESRALDYVL
FT                   GYAVGNDVSHRDWQIKRGGGQWGLGKGFDGWAPFGPGIVSSRLIRHPNALHISTRLNGQ
FT                   VVQSSSTRDMIFSVAKVVAFLSQGTTLLPGDLIFTGT"
     atgtccacgt tctctctgtt caaatgctta tccatatcat cattgtccgg acagcgactc        60
     attcgattct tggccaaaga cggccaggtt tactacggtg atgccattct cccggtgggc       120
     gtcagcgacc ttgccaaagt gaccaaggca aaggtgatcc agggtgacat cttcggacag       180
     cactatgtca cagaccaggt ctccgaagtt cagatgcttc ttgcgcctct ggccaggaaa       240
     gacatcagga cggtccgctg cctgggtctg aactatgagc aacatgcaag agagtccaac       300
     ctcccaatcc caaaatatcc cgttctattc tacaaaccag tcacgtctat cgcgggcccc       360
     agagatgaca ttccgatatc caccatggcg caagaaggtg aaggtctcga ttatgaatgc       420
     gaactcgtta ttgtcatcgg caaggaagcc aaagatgtcc ctgagagccg ggctctagac       480
     tacgtgctgg gctacgccgt gggtaacgat gtctctcacc gggattggca gatcaagcga       540
     gggggcggtc aatggggtct tgggaaaggg tttgatggtt gggcgccgtt tggaccaggc       600
     atcgtgtcct cgcggttgat ccgtcatccc aacgcactcc atatctcgac gaggctcaat       660
     ggccaagtcg ttcagtcttc ctctactagg gacatgattt tcagcgttgc aaaggttgtg       720
     gcatttctgt ctcaaggcac caccctgtta ccgggggacc taatctttac tggaacgtga       780
//

If you have problems or comments...

PBIL Back to PBIL home page