(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE437

ASFUM1_6.PE437       Location/Qualifiers
FT   CDS_pept        1392828..1393409
FT                   /codon_start=1
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751331"
FT                   /orf_name="AFUA_6G06470"
FT                   /product="Heat shock protein Hsp30-like, putative "
FT                   /biological_process="response to stress"
FT                   /protein_id="EAL88501.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG053617"
FT                   /db_xref="HOGENOM:HBG748242"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI000051E7A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WNG3"
FT                   /transl_table=1
FT                   /translation="MAFPRFSTDLAPLFQLLDDYDTHRTYRPKNKVTPVRTFAPKFDVC
FT                   EFPDGYRLDGELPGVNQSDIEIEFSDPQTIVIKGHVERNYNNTATETGDDSSSTKSRQP
FT                   TVEDETEEGNASSAIASPAKPAEQTVTNSPTQTNYKLWVSERSIGEFQRTFAFPTRVDQ
FT                   DAVKASLRNGILSIFVPKEAAPKLKKIRVE"
     atggcattcc cacgcttttc gaccgaccta gctcccttgt tccagctgtt agatgactac        60
     gatacccatc gtacctatcg cccaaagaac aaggtcacac ctgtccggac attcgcaccc       120
     aagttcgatg tgtgtgagtt cccagatgga tatcgtcttg acggagaact tcccggtgtc       180
     aaccagagcg acatcgagat tgagttcagt gaccctcaga ctattgtgat caagggtcac       240
     gtagaacgca actacaacaa caccgctacc gagaccgggg acgacagctc atccaccaag       300
     tcccgtcaac ccacagttga agacgaaacc gaagagggca acgcctcgtc tgctatcgca       360
     tcgccggcta agccagctga gcaaactgtt acaaattcac cgacccagac aaactacaag       420
     ctctgggtct ctgagcgctc aattggcgag ttccaacgaa ccttcgcctt cccaaccaga       480
     gtcgaccaag atgctgtcaa agcaagtctg agaaatggaa tcctctcgat atttgttcca       540
     aaggaggcgg cgcccaagtt gaagaaaatc cgcgtcgagt aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page