(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE44

ASFUM1_6.PE44        Location/Qualifiers
FT   CDS_pept        complement(138701..139120)
FT                   /codon_start=1
FT                   /gene_family="HOG000217784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055870"
FT                   /orf_name="AFUA_6G00555"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27169.1"
FT                   /db_xref="UniParc:UPI0000F5187C"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA94"
FT                   /transl_table=1
FT                   /translation="MAPHKVVEGSPTQQIISDHVWKRKRPETDYERWQREQDESYEPGG
FT                   RPQYGPPNEFRKDDYVADGTEELLHGQHYSVEHRAPSHGYFVSSTAPAKPITSEGSFIS
FT                   TARKALHLGDETFMGSLLFFAVLLMISFVVSKSIK"
     atggctccac ataaggttgt ggaaggctca cccacacaac agatcatatc cgaccacgtt        60
     tggaagcgca agcgacccga aaccgactat gaacgatggc agcgggagca agacgagagc       120
     tacgaacccg gcggacgacc acaatacgga ccgccaaacg aattccggaa agatgactat       180
     gtggcagacg gaactgagga gttgctccat ggacagcatt attctgtaga gcaccgggcc       240
     ccatcgcacg gttattttgt gtcctcaaca gccccggcaa aacccatcac aagcgagggt       300
     agcttcatat ctactgccag gaaggctttg catctgggcg acgagacatt tatgggcagc       360
     ttactgtttt tcgccgtctt gttgatgatc tctttcgtgg tatcaaagtc aatcaaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page