(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE443

ASFUM1_6.PE443       Location/Qualifiers
FT   CDS_pept        join(complement(1410833..1411165),
FT                   complement(1410345..1410761))
FT                   /codon_start=1
FT                   /gene_family="HOG000253031" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16266367"
FT                   /orf_name="AFUA_6G06530"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27350.1"
FT                   /db_xref="UniParc:UPI0000F51A13"
FT                   /db_xref="UniProtKB/TrEMBL:A4D9Q1"
FT                   /transl_table=1
FT                   /translation="MENPNLLPGHGAFQQSVHIQSYRSVFLEDGDSLIALRLYHNTFKL
FT                   AARLGFLAVESRRINLPFPCSHHDQRQREVCEWREALWLLWNSPEAQFLARAQESLPLF
FT                   LQEILWQTSLLYHTSLIFSYTSLWPGQCLGPGAAPQEEVRHHAAAIFSIAESVMAQSKE
FT                   NCWRSVTFPVFLAGSVTSSSDLKVIALDMLSRLEVREIGRNATSIRYLFQVVYERQMQQ
FT                   SQGVGHPGSADWMEILAEHGLSLVASA"
     atggagaatc caaatctgct ccctgggcat ggtgctttcc agcagtctgt gcatattcaa        60
     agctatcgca gtgtctttct tgaagacggt gattccttga ttgcattacg attgtaccat       120
     aatactttca agctcgctgc gagactcgga ttccttgcag tggagtcacg tagaatcaac       180
     ctgccctttc catgttctca tcatgaccaa cgtcaaaggg aagtttgcga gtggcgcgaa       240
     gcgttgtggc tgttatggaa ctcgccagaa gcccagtttc tcgcccgggc acaggagagc       300
     ttaccactat ttttgcaaga aatcctctgg cagacctctc tgctatacca tacctcgctc       360
     atcttctcct acaccagtct gtggcccggc cagtgtctcg gacccggagc tgcgcctcaa       420
     gaagaagttc gccaccatgc tgcagctatc ttcagcatcg cagaatctgt aatggcgcaa       480
     agcaaagaga attgctggcg ctccgtgacc tttcctgttt ttctcgcggg atccgtcacc       540
     tcttccagcg atctcaaagt gatagccctg gacatgcttt ccagattaga ggtgcgagag       600
     atcggtcgca atgcaacaag tatccgatac ctgtttcagg tggtctatga gcgacagatg       660
     cagcaatccc agggcgtcgg ccatccggga agcgctgact ggatggagat acttgcggaa       720
     cacggcctgt ctctggtggc ttccgcgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page