(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE45

ASFUM1_6.PE45        Location/Qualifiers
FT   CDS_pept        join(140318..140657,140709..141079)
FT                   /codon_start=1
FT                   /gene_family="HOG000189036" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262222"
FT                   /orf_name="AFUA_6G00560"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84209.1"
FT                   /db_xref="HOGENOM:HBG056246"
FT                   /db_xref="UniParc:UPI000051F741"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W910"
FT                   /transl_table=1
FT                   /translation="MPEGYASRRNVSCNTDVELDCGKTWGAFHACCPLDTYCPPNQSST
FT                   KCWKTPTEPQEKRCANSTWNLYYASDFFCCDQKLRAFKWASNGFVGCADPSYALDDELV
FT                   QLSVVASGTVTPTSSIPSTSTPGSSMSTSASESRQTTEPTPSVKSPPSSGTNVGAIAGG
FT                   VVGGVAGVAIIAGLIWFFLLRRYRTSQNNESATPLHELHVSHQDGPKWEPYPQEIGNNS
FT                   NEHHVVELPAHPSR"
     atgcccgaag gctatgcatc tcgcaggaat gtatcctgca ataccgacgt cgaattggac        60
     tgcggtaaaa catggggagc gttccatgca tgctgcccgc tcgacactta ctgtccacca       120
     aaccagtcgt caactaagtg ttggaaaaca ccgacggagc cccaggagaa aagatgcgca       180
     aatagcactt ggaatctcta ctatgcgtcc gactttttct gctgcgacca aaaactaaga       240
     gccttcaagt gggcatcaaa tgggtttgtc ggctgtgcag acccaagcta tgcattggac       300
     gacgagttgg ttcaactttc tgttgttgcg tctggaacag tgactccgac atcctcaata       360
     ccttcgactt ccactccagg atcttcaatg tcgacatcgg catcggaaag caggcagaca       420
     accgaaccaa ctccctcagt caagtcgcca ccatcgtcgg gaacaaatgt cggggccatt       480
     gcaggcggtg ttgttggagg cgtcgcagga gtggccatca ttgctggatt gatttggttc       540
     tttctgttgc ggcgctaccg aacgtcacag aacaatgaat cggcaacgcc cctgcacgag       600
     cttcacgtct ctcaccaaga tggccccaaa tgggagcctt acccccagga gattggaaat       660
     aactcgaacg aacaccatgt cgtggaactg ccagcacatc catcacgttg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page