(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE47

ASFUM1_6.PE47        Location/Qualifiers
FT   CDS_pept        146623..147741
FT                   /codon_start=1
FT                   /gene_family="HOG000162927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055871"
FT                   /orf_name="AFUA_6G00580"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL84207.1"
FT                   /db_xref="HOGENOM:HBG056232"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051F73F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W912"
FT                   /transl_table=1
FT                   /translation="MEAYSFCALPLELIVMVADYLGPLDLLNLIQGLPHIAPLLNSWHI
FT                   QAHDENGHTILHHIVEQRLEYLIKPLAKWIPRSSIADNEGWTPLFQAVRNSDESMTKAL
FT                   VYAGADVSAKDHTGKTALHLACYEDAVGIVQILLDHGANPSAADCNGRTPLHDAFGRNT
FT                   VILQKLIKAGADLNPRRMPRGLAPLYLEAWLGREDAVRILLEAGADPSIQTETGETILQ
FT                   KAIEGSHTKVVQLLLDAGVDINVREFHHGVNAILTAAYWGADDCIRLLQRAGADVFSVD
FT                   YRGCNALHRAALGGRLSTVKLLLKEGVDSSAEDNRGYTPQRYAVEGVYTHGGSSDIDWE
FT                   ELIRILEDVHTKSPFLRFLNWMRAKCYFTKKS"
     atggaggcct atagtttttg cgcccttcct ttggaactca ttgtgatggt cgcggactat        60
     ctgggacctt tggatctcct aaatttgatt caaggccttc cccacattgc cccccttctc       120
     aattcttggc atatccaggc ccacgatgag aatgggcaca ccatcctgca tcatattgtg       180
     gaacaaaggc ttgaatatct catcaaacct ctcgcgaaat ggatcccgcg gagctcaatt       240
     gccgacaacg aaggctggac gccccttttt caggcagtca ggaacagtga tgaatcgatg       300
     acaaaagcac tggtttatgc tggtgcagat gtatcagcca aggaccatac aggaaaaact       360
     gctcttcatc ttgcctgcta tgaggatgca gttggaattg tccagattct cctggaccac       420
     ggtgcaaacc cctccgcggc ggattgcaac ggacgcacgc ccttgcatga cgcatttgga       480
     cgaaacacag ttatcctaca gaagctgatc aaagctggcg cggaccttaa cccccgacgg       540
     atgccacgag gcctggctcc cctttatctt gaagcttggc ttggccgaga ggatgctgtt       600
     agaattctcc ttgaggctgg agcagatccc tccattcaaa cagagaccgg ggaaaccata       660
     ttacagaaag caattgaagg gtcccacact aaagtcgtgc agctcttact tgatgctggg       720
     gttgatatca atgtgcgaga attccaccat ggcgtcaatg cgatactgac ggctgcgtat       780
     tggggagcag atgactgtat tcgactgctc cagagggctg gggcagatgt tttctcagtg       840
     gattaccgtg gatgtaacgc actgcatcgg gcggctctgg ggggcaggct gtcgactgtc       900
     aagcttcttc tgaaagaagg agttgacagc tctgcagaag acaaccgggg ttacactcca       960
     caacgatatg cagttgaagg ggtttataca catggagggt caagtgatat tgactgggaa      1020
     gaactgattc gaatcctaga agatgtgcat actaaaagtc catttttgag gtttttgaat      1080
     tggatgcgag ccaaatgcta ctttacaaaa aagagctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page