(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE48

ASFUM1_6.PE48        Location/Qualifiers
FT   CDS_pept        149233..149496
FT                   /codon_start=1
FT                   /gene_family="HOG000217785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262224"
FT                   /orf_name="AFUA_6G00590"
FT                   /product="Secreted peptide, putative "
FT                   /protein_id="EBA27168.1"
FT                   /db_xref="UniParc:UPI0000F51880"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA93"
FT                   /transl_table=1
FT                   /translation="MKFSIIALTFIGSALAAPGASIPTPSTPAAPSCAASSSHIASSTA
FT                   SPSASPIFQPGCDIEHVGNNGKHLGWCKKARHYGMYNNGTSI"
     atgaagttta gcatcattgc tctcactttc atcggctctg ccttggccgc ccctggtgcc        60
     tctattccca ctccttctac tccggcggct ccttcttgtg cggcatcttc cagccatata       120
     gcctcatcca ctgccagtcc ttcggcttct cccatctttc agccaggctg cgacattgag       180
     cacgtaggca acaacggcaa gcatctcgga tggtgcaaga aggccaggca ctacggcatg       240
     tacaacaacg gaacaagcat ctag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page