(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE53

ASFUM1_6.PE53        Location/Qualifiers
FT   CDS_pept        join(164566..164779,164886..164941,164966..165157,
FT                   165219..165857)
FT                   /codon_start=1
FT                   /gene_family="HOG000202768" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207161"
FT                   /orf_name="AFUA_6G00640"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL84202.1"
FT                   /db_xref="HOGENOM:HBG056196"
FT                   /db_xref="HOGENOM:HBG329040"
FT                   /db_xref="UniParc:UPI000051EFEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W917"
FT                   /transl_table=1
FT                   /translation="MGWVFGASPEIDAQSRYPVLLGVCISLTLLMVATVCLRLFVRIKL
FT                   GRFDASDYVMVFGMIFSIIYNALCIAPRPPHVHKGTTRPLTVDELLNYAGRPFYQLGIA
FT                   GFKAALCINYLHLLAKTSKRFYRMLVWGVILLTTLGHVAGTLVLILNCKPIERAWNQTI
FT                   PGKCLPVGPTFYGLAAFTIISDVSVIFLPIPLLLQLNVKPAQKAGVVCLFLLGLFTTIC
FT                   SILRLTQINRVVAIDGDSTMLVLWGTIEFNVGVSWTSSAKIERDLTDVQNIVTSLPFLM
FT                   PLLKVWVRDFQSRSGGEHRKNTGYTLQSYSKNRRSQLRSENSKEPVLAQRTPGEELILD
FT                   ADDSSARANAEIHVTVEYRVSHENHK"
     atgggctggg tattcggtgc ttcaccggag atcgacgccc agtcccggta tcccgtcctt        60
     ctgggagtgt gcatcagcct gactctcttg atggtcgcca cagtttgcct gcgactgttc       120
     gtgcgcatca aacttgggcg attcgacgct tccgactatg tgatggtgtt tggcatgatc       180
     ttcagcatca tttacaatgc tctttgtata gcccccagac ctccccacgt acacaaaggc       240
     acgactcgcc cgctcacagt cgatgaacta ctcaactacg ccggtcggcc attctaccaa       300
     ctcggaatcg ccggtttcaa agccgcactg tgcatcaact acctgcatct gctcgcaaag       360
     acgtccaagc gcttctaccg catgttggtc tggggggtga tcttactgac gaccttggga       420
     catgtggctg gcacactggt tctgatccta aactgcaagc cgatcgagcg agcctggaat       480
     cagaccattc ctggtaaatg tcttccggta ggcccgacct tctacggtct tgcagccttt       540
     acgatcatat ccgatgtgtc cgtcatcttc ctgccgattc cattgctgct ccagttgaac       600
     gtgaaaccgg cgcagaaggc cggagtcgtg tgcttgttcc tgctggggct gttcactacc       660
     atctgctcca ttctccgctt aactcagatc aatcgcgtgg tggccatcga tggggattcg       720
     actatgttag tcctgtgggg cacaatcgaa ttcaacgtcg gggtgagttg gacgtcaagc       780
     gcaaagattg agcgtgatct gaccgatgtc cagaatatcg ttacctctct tcccttcctc       840
     atgccccttc tcaaggtatg ggtccgcgac tttcaatccc gcagtggcgg cgagcatcgt       900
     aagaacaccg gttacacatt gcagtcatac tccaagaatc gacggtcgca attgagatcg       960
     gaaaactcca aggagccagt ccttgcgcaa cgaacgcctg gcgaggagct aatcctcgac      1020
     gccgacgatt ccagtgctcg agcgaacgcc gagatccacg tcacggtcga gtaccgcgtc      1080
     tcacacgaga accataaatg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page