(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE55

ASFUM1_6.PE55        Location/Qualifiers
FT   CDS_pept        join(170160..170531,170578..170863,170910..171220)
FT                   /codon_start=1
FT                   /gene_family="HOG000202779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262227"
FT                   /orf_name="AFUA_6G00660"
FT                   /product="FAD binding domain protein "
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84200.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056187"
FT                   /db_xref="HOGENOM:HBG329041"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI000051F252"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W919"
FT                   /transl_table=1
FT                   /translation="MPNLPILIVGAGISGLTLAQYLQKSGVPFLIFERDSSIDIRSGGW
FT                   GLTLHWGLPILRDMLPDHIVARLPECSVNKEASENGDVGRFPFFDLSSGSALFEVPAAE
FT                   RVRVNRGRLRELLASGIDVKWSKTVVDVTSTEENVTAHFEDGTSYTGSLLVACDGANSR
FT                   IRKMTYPDSYQMNPLPVQLLGVTVRYSPEQAACFRAMDPYILQGAHPESNVFLFFSFLD
FT                   TPNNFDDSTDAYLCQIIVSWSDSKNIPLPSDNAGRIALMKELTANWVEPFRSLVHNLPD
FT                   DSEARSIRIQDWIFTPGERPHPRVVMMGDSAHTMTMCKMAH"
     atgcccaatc tccccatact catcgtcggt gcagggatca gcggtctgac cctcgcccag        60
     tatctgcaaa aatcaggggt cccattcctg attttcgagc gggattcctc gattgatatc       120
     cgaagcgggg gatggggtct gacgctgcat tggggactgc cgatcctgcg ggacatgctg       180
     cccgaccata tcgtcgcacg gttgcccgaa tgctctgtga acaaggaagc ttccgagaat       240
     ggcgacgtcg gtcggttccc gttctttgac ctgagttccg gatcggcgct gttcgaggtc       300
     cccgctgcgg aaagggtgcg ggtgaacagg ggcagattga gggagttgtt ggcgtcgggg       360
     attgacgtca agtggtcgaa aacagtggtg gatgtcacat cgacggagga gaacgtcaca       420
     gcgcactttg aagatggcac ttcctacact gggagtctcc tcgttgcctg tgatggcgcc       480
     aattctcgca tccgtaaaat gacatacccc gactcgtatc agatgaatcc actgcccgtc       540
     cagcttctcg gagtgacagt ccgctattcg cccgagcagg ccgcctgttt ccgggcgatg       600
     gacccgtata tcctccaagg agcccatccc gaatcgaacg tcttcttatt cttcagcttc       660
     ctcgacaccc cgaacaactt tgacgacagc acagatgcgt acctctgtca gatcatcgtc       720
     tcatggtccg acagtaaaaa cattccgctc ccgtccgata atgctggccg gattgcattg       780
     atgaaagagc tgacagccaa ctgggtcgag ccgttccgat cgctcgtcca caacctccct       840
     gatgattcag aggcacgctc aatccgcatc caggactgga tctttacccc tggagagagg       900
     cctcatcccc gcgtggtgat gatgggcgat tccgcgcata ctatgaccat gtgtaagatg       960
     gcccattaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page