(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE56

ASFUM1_6.PE56        Location/Qualifiers
FT   CDS_pept        join(172246..172587,172630..172665,172720..172788,
FT                   172834..173376)
FT                   /codon_start=1
FT                   /gene_family="HOG000202790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055872"
FT                   /orf_name="AFUA_6G00670"
FT                   /product="Extracellular serine-rich protein "
FT                   /protein_id="EAL84199.2"
FT                   /db_xref="HOGENOM:HBG056180"
FT                   /db_xref="HOGENOM:HBG325025"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniParc:UPI0000F5187D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W920"
FT                   /transl_table=1
FT                   /translation="MLKLSIMSMTVLLFFQSRTTHATGAVPTAMTPSSTAPHATHTVKV
FT                   GPKENPHQYSPHNITAAVGDVIVFEFYPRNHSVVKADFMAPCVPAAGEIFYSGQFNTFK
FT                   ENNHGQLEGEPPTWSLVVNDTEPTFFYCTAVDSCLFNGMVGVINPNETMTWEAQYAQAQ
FT                   QYPYMLVPGQSPPAEGTGYLSSGSNAHKKSSFGGGAIAGTVVGGVAFVAILVVVAITLC
FT                   RNRERQGSSSQVGRMERTAHWARFGGHGEEKSEQGFAASSSVGGHGTLSLSSGASPPAV
FT                   SPPLQNVGSSNWESAMKQQPPQEIRQPSELEATNVVGGTPGGMYYGWR"
     atgctgaagt tatcgatcat gtccatgacc gtgctactgt tcttccagtc cagaacgaca        60
     cacgcaacag gcgcggttcc tacagccatg actccatcct cgacggcccc tcacgctacg       120
     cataccgtca aagtaggtcc aaaagaaaac cctcatcaat actcgccgca caacatcacc       180
     gccgccgtcg gcgatgtcat cgtcttcgag ttctacccgc gcaaccactc cgtcgtcaag       240
     gcggacttta tggcaccgtg tgtgcctgct gcaggagaaa tcttctattc cggacagttc       300
     aataccttta aggaaaataa ccatgggcaa ctggaaggag agccccccac ctggtcccta       360
     gttgtgaacg ataccgagcc cacgttcttc tactgcacag ctgtcgactc ctgtctcttc       420
     aatggaatgg tcggagtgat caacccgaac gaaacaatga cctgggaagc acaatacgcc       480
     caagcacaac aatacccata catgctcgtc ccgggacaat cgcctccagc cgaaggaaca       540
     ggttacttgt cctcgggttc caatgcccac aagaagagct ctttcggcgg tggcgccata       600
     gccggtactg tggttggcgg ggttgccttt gttgccatcc tcgttgttgt tgcaatcacg       660
     ctgtgtcgga atagggagag acagggatca tcctcgcagg tcggacggat ggagcggacg       720
     gctcactggg ctcgctttgg tggtcatggt gaggaaaaga gtgagcaggg attcgctgca       780
     tcgtcgtcgg tcggaggtca tggcacatta tcgttgagct caggcgcctc tccgcctgct       840
     gtctcgcctc ctctgcagaa tgttggatct tcgaactggg aatctgcaat gaagcagcag       900
     ccgccgcaag agatccgtca accaagtgaa ttggaggcta cgaatgttgt tggtgggaca       960
     ccaggaggga tgtactacgg atggaggtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page