(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE62

ASFUM1_6.PE62        Location/Qualifiers
FT   CDS_pept        184025..184768
FT                   /codon_start=1
FT                   /gene_family="HOG000202823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055874"
FT                   /orf_name="AFUA_6G00740"
FT                   /product="Putative uncharacterized protein "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="EAL84192.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056504"
FT                   /db_xref="HOGENOM:HBG350046"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000051F9AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W927"
FT                   /transl_table=1
FT                   /translation="MPHLKVRDVDRKPYRQMLPRVLFNQCFILLPSMMLVQAMGYCFVG
FT                   PTHLHPLRFLLSLLAMAVGHDVVQYVTHRYLLHNPNLRLMRLLQHSLHHSTGASRGISA
FT                   CYMSAPDFFLEIVLPYLVPLALVGGGGADLLFHSLVAGSGALGGVYEHSGYDFSALFSP
FT                   ENCMGGKGPWPSWTAKVAALIRGFVANRAHGEHHSRANVSFSDGFGSPGICDTYFGTRW
FT                   DLVAARRAAAEKEWQAQRSSHMNAK"
     atgccccatc tgaaggtccg cgatgtcgat cgcaagccat acagacagat gctcccgcgt        60
     gtgctgttca atcagtgttt cattctgctg ccaagcatga tgctcgtcca agcaatgggc       120
     tactgttttg tgggaccaac gcacctgcac cccctacgct tcctcctgtc acttctggct       180
     atggccgtcg gtcatgacgt ggtgcaatac gtcacgcatc ggtatctgct ccataatccg       240
     aacctgcgac ttatgcgcct gctgcagcac tcgttgcatc attcgacagg agccagtcgg       300
     ggaatcagcg catgttacat gtccgctcca gacttcttcc tcgagatcgt tctgccgtat       360
     ctcgtccctc ttgcgctggt gggaggcggc ggcgcagatc tcctcttcca ttcgcttgtt       420
     gccgggtctg gggctctagg gggcgtttat gagcactcgg ggtacgattt ctccgcactt       480
     ttctcaccag agaactgtat gggagggaaa ggaccgtggc cgagctggac tgcaaaggtt       540
     gccgccttga tccggggctt tgtcgctaac cgcgctcatg gagagcatca ttctcgtgcg       600
     aatgtctcat tctccgatgg gtttggcagc ccgggaattt gcgacaccta ttttggcacg       660
     cgctgggatc tggtggctgc gcgtcgggcg gcagcagaga aggagtggca ggctcaacgg       720
     agtagccata tgaacgcaaa atga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page