(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE66

ASFUM1_6.PE66        Location/Qualifiers
FT   CDS_pept        join(244292..244792,244860..245249,245300..245407)
FT                   /codon_start=1
FT                   /gene_family="HOG000202723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262230"
FT                   /orf_name="AFUA_6G01790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85860.1"
FT                   /db_xref="HOGENOM:HBG056383"
FT                   /db_xref="HOGENOM:HBG510404"
FT                   /db_xref="UniParc:UPI000051EA6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM8"
FT                   /transl_table=1
FT                   /translation="MPLTEEQKQHWLEHGFIKIPQCFTKQDADNWTASIWARLGISPTD
FT                   KSTWNTERVNMPGHTVVDVKDFAPKAWDAICELVGGEERVTDWCKGWRDSWIINLGKPE
FT                   YKPDDPLDFRTLDNWHNDGDFFTHFLDSGEQALLVIPLFSDIRSKGGGTVLCTDGIGLV
FT                   AKHLYNHPEGTWPSLASRSGPNPPPPEGGKQWRDWVRDPQLTRAESFHEATGQAGDVYL
FT                   LHPFMLHSASRNLLREVRIITNPPVSLKEPFNYNRPDGKYSLVEQKTLKELGRPEGLPE
FT                   WRITGEREMLTPARVQIQEDMRQKELERLKEVGAPVTKLGTAKPLQSQYPA"
     atgcctctca ctgaagagca aaagcagcac tggctggaac acggcttcat caaaatccct        60
     cagtgtttca ccaagcaaga tgccgacaac tggacagcct ccatctgggc tcgcctgggc       120
     atctcaccga cggacaagtc cacttggaat actgaaagag tcaacatgcc cggccataca       180
     gttgtcgacg tgaaggactt tgcacccaag gcatgggatg cgatctgtga gctcgtcggc       240
     ggggaagagc gcgtaacgga ttggtgcaag ggctggcgag actcgtggat catcaacctc       300
     gggaaacccg aatacaagcc cgatgatccg ttggacttcc gcaccttaga caactggcat       360
     aatgatggag actttttcac gcatttcctg gatagcggcg agcaagcgct tctagtgatc       420
     cccttattca gcgatatcag atccaaggga ggtggaactg ttctatgcac tgatggaatc       480
     ggccttgtcg ctaagcatct gtacaaccac cccgaaggca catggccatc gctcgcatcc       540
     cgctcgggtc caaaccctcc acctccagag ggaggcaagc agtggagaga ctgggtgcga       600
     gatcctcaac tcacacgggc tgagtccttc cacgaagcca ccggacaagc aggcgacgtc       660
     tacctcctgc acccgttcat gttgcattct gcctcgcgca atctcctgcg tgaagtccgt       720
     atcattacca acccacccgt gtcgctgaag gagcccttca actataaccg acccgacggc       780
     aaatacagtc ttgtcgaaca gaagactctg aaggagctcg ggcggcccga aggcttgccg       840
     gagtggagga tcaccgggga gagggagatg cttactcccg cacgggtgca gatacaggaa       900
     gacatgcgcc agaaggagtt ggaacgattg aaagaggtgg gagctcctgt cacgaagctg       960
     ggaactgcca agcctctcca gtcgcagtat ccagcatga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page