(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE7

ASFUM1_6.PE7         Location/Qualifiers
FT   CDS_pept        complement(57953..58330)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055868"
FT                   /orf_name="AFUA_6G00190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84248.1"
FT                   /db_xref="HOGENOM:HBG056521"
FT                   /db_xref="UniParc:UPI0000520791"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X1"
FT                   /transl_table=1
FT                   /translation="MTYTDTSLVYTSLFVCPEVWSTSSYYYEHGNNSTTSCQNKNLAQA
FT                   IKDLSHNFTYSLLSLNGGNTTVDMTDLTCRNYYSYGSTALLGVYLSALAVMIACVVVGF
FT                   LALRRNGVSYNNSFSGVLLTT"
     atgacataca ctgatacgtc acttgtttac accagcctct ttgtctgccc agaagtatgg        60
     agcaccagca gctattatta tgaacatggc aacaattcca ctacttcgtg ccagaacaaa       120
     aacttggccc aggccatcaa ggacctcagc cacaatttca cctacagcct gctcagcctc       180
     aatggcggaa acaccaccgt cgacatgacg gacttgacct gccgcaacta ctattcctac       240
     ggcagtacgg ccctgctcgg ggtttacttg agtgcgctgg ccgtcatgat tgcgtgcgtc       300
     gtcgtaggct tcctcgccct gcgacgaaac ggcgtttcgt acaacaactc gttctcaggt       360
     gtcttgttga cgacttag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page