(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE73

ASFUM1_6.PE73        Location/Qualifiers
FT   CDS_pept        join(262424..262564,262621..262834,262890..263239,
FT                   263311..263533,263628..264364)
FT                   /codon_start=1
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207405"
FT                   /orf_name="AFUA_6G01860"
FT                   /product="MFS lactose permease, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85853.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG190581"
FT                   /db_xref="HOGENOM:HBG327082"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E5C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN5"
FT                   /transl_table=1
FT                   /translation="MERLNSYDSPQGLYYPDDAHIRGISNAALAMATFQQKPRLWSKNM
FT                   FKLYWAIAVATLNSCINGYDGSLMGSINSYRQYREYFGFDPEAGTPSTGIVYAIYTIGN
FT                   IVGSFCAGPFTDFRGRRVGMALGAAFIILGTIVQATCTNLAGFMAGRFLLGFGVATSAT
FT                   AGPAYVSEIAHPSWRGSLTGLYNVLWFAGGIPGTFIPWRTSQIEGTMSWRIPIWVQMVF
FT                   AGLVLVLCWTIPESPRWLVSRDKHEEAIRVLATYHGDGDRNAPLVQLEYREMVEDISNT
FT                   GADKRWWDYRELFNSRETRYRSMLVILMAFFGQWSGNGPVSYYYPQMLAGAGITSNTTR
FT                   LLLQGLQNVCQFVGAIFGALLTDRIGRRAQLLTSTALMVLLFSIITALNATNVDPPDDE
FT                   TGGVVVVAKSAVVARAQIAMIFIFGFVFSAGWTPNQAMYPVECLRYESRAKGMGMNNFF
FT                   INVANFYNTFVTGIAFTRAGWRYYLLFIFWDVLELAVIWFLFVETSRRTLEELTAIFQS
FT                   RNPVKASLARDEVLIPQVEQEVEMRRKDYDRRKVDLT"
     atggagcgac tcaatagcta cgactcaccg cagggcttgt actacccgga tgatgcccac        60
     atccggggaa ttagcaacgc cgccctggcc atggcaacct tccagcagaa gccgagacta       120
     tggagcaaga acatgttcaa gttatactgg gccattgcgg tggccacgct caactcgtgc       180
     atcaacgggt atgacgggtc gctcatgggc tccatcaaca gctaccgaca ataccgggag       240
     tactttggct ttgatccaga agccggcacg ccgtcgacgg ggatcgtcta cgccatctac       300
     accatcggga acatcgtggg gtcgttctgc gccgggccat tcaccgattt ccggggacga       360
     cgagtgggca tggcgctcgg cgccgccttc atcatcctcg gcaccatcgt ccaagcaacc       420
     tgcaccaatc tcgccggctt catggccggc cgcttcctcc tcggcttcgg ggtcgcgacc       480
     tccgccaccg cgggcccagc ctacgtctcg gagatcgcgc acccttcctg gcgcggctcg       540
     ttgacgggat tgtacaacgt gctgtggttc gccggcggca tcccggggac gtttatcccc       600
     tggcgcacga gtcagatcga ggggacgatg agctggcgga ttccgatctg ggtgcagatg       660
     gtgtttgcgg ggttggtgct ggtcttatgc tggacgattc cggagagccc ccggtggctg       720
     gtgtcccgcg acaagcacga ggaggccatc cgcgtgctgg ccacgtacca cggcgacggc       780
     gaccgcaacg ccccgctcgt gcagctcgag taccgcgaga tggtcgagga tatctccaac       840
     acgggggctg acaagcgctg gtgggattac cgcgagctgt tcaactcgcg cgagacgcgc       900
     taccgctcga tgctggtgat actcatggcc ttcttcggac aatggtccgg caacggcccc       960
     gtctcctact actacccgca gatgctggcc ggcgccggca tcacctccaa caccacccgg      1020
     ctcctcctgc aaggcctgca gaacgtctgc cagttcgtcg gcgccatctt cggcgcgctc      1080
     ctgaccgacc ggatcggacg gcgcgcgcag ctcctcacct ccacggcgct gatggtcctc      1140
     ctcttcagca tcatcacggc gctgaacgcc accaacgtcg acccgcccga cgacgagacc      1200
     ggcggcgtcg tcgtcgtcgc caagagcgcc gtcgtggcgc gcgcgcaaat cgccatgatc      1260
     ttcatctttg gcttcgtgtt ctcggccggc tggacgccca accaggccat gtaccccgtc      1320
     gagtgtctgc ggtacgagtc gcgcgccaaa ggcatgggga tgaacaattt cttcatcaac      1380
     gtggccaact tctacaatac gtttgtgacg ggcatcgcct tcacccgcgc cggctggcgg      1440
     tactacctgc tgtttatctt ctgggatgtg ctggagctgg cggtgatctg gtttttgttt      1500
     gtggagacgt cgcgacgcac gctcgaggag ctgactgcca tcttccagtc gaggaatccc      1560
     gtcaaggcgt cgttggcgcg cgacgaggtg ttgatcccgc aggtggagca ggaggtcgag      1620
     atgaggcgga aggattatga ccggaggaaa gttgatttga cttga                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page