(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE74

ASFUM1_6.PE74        Location/Qualifiers
FT   CDS_pept        join(complement(265716..265856),complement(265215..265657),
FT                   complement(265075..265169),complement(264914..265014),
FT                   complement(264445..264864))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750821"
FT                   /orf_name="AFUA_6G01870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85852.1"
FT                   /db_xref="HOGENOM:HBG056379"
FT                   /db_xref="UniParc:UPI000051F419"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN6"
FT                   /transl_table=1
FT                   /translation="MGDSFTNEAFTLLSLAIVVIILRIVARIMTVGLHNFQLDDYLMPL
FT                   AGVVYGLETGAAYCVGAWWKGLANNHMTDDQRAALSPDSEEFRLRVGGSKTQVLGWSLY
FT                   TTLLWLLKACMAIFYSRLTYVSPRLEVVTDTDTDADTDADADGQGRSDQHAYPRACGLR
FT                   GHRGDLSDCDSVDPVWLPSDAQELADLSKSWPTLPTRHRAARCLHDRHAECRDGYLSHY
FT                   HSHTARLPWREKLELFILFSGGIFVMAAGILRCVLIVTAGANGASQAGSWACRETFVAV
FT                   VIGNAPMIYPLFRRAARRAGWYISSRGHSQSYPAYPLSEGERGENSTHHSKKRRFRHPL
FT                   SIPDTHWHTINDEAMILPTSRQQPPTCTASPPRDWDALSQPSADGIKVVHEMIIERNER
FT                   "
     atgggcgaca gcttcaccaa cgaggccttt acgctccttt ccctcgccat cgtggtcatt        60
     atccttcgca tcgtcgctcg catcatgacc gtgggactcc acaatttcca actcgatgac       120
     tacctgatgc ctctggccgg ggtggtctac gggctcgaaa cgggtgcggc ctactgcgtc       180
     ggggcctggt ggaaaggact ggccaacaac cacatgacgg atgaccagcg cgccgccctc       240
     tcgcccgact cggaggaatt ccgactgcga gtgggcggat ccaagacgca ggtgctgggg       300
     tggtcgttgt acacgaccct gctgtggttg ttgaaggcgt gcatggccat cttctactcc       360
     cgcttaacgt atgtctcgcc tcgtttggag gtcgtcactg acaccgacac tgacgccgat       420
     accgacgctg acgctgacgg gcagggccgg tctgatcaac atgcatatcc gcgtgcgtgt       480
     ggcctacggg gccatcgggg tgacctatct gattgtgatt ctgtcgatcc tgtttggctg       540
     ccatccgatg cacaagaact ggcagatcta tccaaatcct ggcctacgct gccaacccgc       600
     catcgcgccg ctcgatgtct acatgaccgt cacgctgaat gtcgcgacgg atatctatct       660
     cattaccatt cccacaccgc gcgacttccc tggcgcgaga aactcgaact cttcatcctc       720
     ttctctggtg gaatcttcgt catggctgcc gggatcctcc gctgcgtttt gatcgtcaca       780
     gccggcgcaa acggtgcgtc ccaagccggc agctgggcct gtcgcgagac gttcgtcgcc       840
     gtggtcatcg gcaacgcccc aatgatctac cccttgttcc gcagggctgc gcgccgcgcc       900
     ggctggtaca tcagttcccg cggccactcc cagagctacc cggcataccc gctgtccgag       960
     ggcgagcgcg gcgagaactc gacgcaccac agcaagaagc gccgcttccg gcacccgctc      1020
     agcatccccg acacgcattg gcataccatc aacgacgagg cgatgatcct gccgacgtcg      1080
     cggcagcagc cgccgacctg tacggccagc ccgccccggg actgggacgc gttgagccag      1140
     cccagcgcgg atgggatcaa ggtggtgcat gagatgatta ttgaacggaa tgaacggtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page