(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE75

ASFUM1_6.PE75        Location/Qualifiers
FT   CDS_pept        complement(266924..267151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263224"
FT                   /orf_name="AFUA_6G01880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85851.1"
FT                   /db_xref="HOGENOM:HBG056378"
FT                   /db_xref="UniParc:UPI000051F670"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCN7"
FT                   /transl_table=1
FT                   /translation="MSAWWAYTTARAGEERDKQRERDKQSASAQMDLWTEEIAWQHSVL
FT                   MLLYVRMPKTILTGLKISVLLVFLAAALAW"
     atgtcggcat ggtgggcgta caccactgcg agggcagggg aagaaaggga taagcaacgt        60
     gaaagggata agcaaagtgc cagtgcacag atggacctct ggacggagga gatagcctgg       120
     cagcactccg tacttatgtt actgtatgtg agaatgccaa agacaatcct tactggactg       180
     aaaattagtg tgctcttagt gtttttagct gcagcactgg cctggtga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page