(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE78

ASFUM1_6.PE78        Location/Qualifiers
FT   CDS_pept        join(complement(271104..272258),complement(270945..271049))
FT                   /codon_start=1
FT                   /gene_family="HOG000202632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056119"
FT                   /orf_name="AFUA_6G01910"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85848.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG056375"
FT                   /db_xref="HOGENOM:HBG327074"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051FFEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP0"
FT                   /transl_table=1
FT                   /translation="MGTALGDLNAPPPLNARRPAAPTLPSFELPPPNFQINVGTPKYPL
FT                   QSNTHPPAHPSVSSLLTPPASTQAGEVTAPSTAAPATTVSATSDVTPSYGTAYWQGHSG
FT                   YGSTPGPRQPWTAGSNQSYPTRDSFSPSTLNPLSRNQPTSPPVTEGMAQPYDMHHLPPF
FT                   QQSLSVPPSGLPTGTAPHPAMTHAMLASPTGLPNPGPSPHLLPSNDPYGPKSQPAPVYG
FT                   GAQQIPSPHQTSFPPYGQPGLGIHPPGRVSSTPTLSATGPPPHLNYSRQPWPSYSLPAM
FT                   NGPVMTNIHSPNSQMSLLGSMQPGILPGFNSGHVASMQQMYGGHPPHPIHQPGPTNDRP
FT                   FKCDQCPQSFNRNHDLKRHKRIHLSVKPFPCTHCDKSFSRKDALKRHILVKGCGKDGPK
FT                   TSTASVKEEDKEGVDTNGHS"
     atggggacgg cgttggggga cttgaatgcc ccaccgccgt tgaacgcacg gcggccggcg        60
     gcgcccacgc ttcccagctt tgagctgccc ccgccgaact ttcagatcaa cgtcgggacc       120
     cccaagtatc cgctgcagtc gaatacgcac cctccagctc atcccagtgt gagcagtctg       180
     ttgacaccgc cggcctcgac gcaggccggc gaggtgaccg ctcccagcac ggccgcgccg       240
     gcgaccaccg tgtctgcaac ctcggacgtg acgccctcgt atgggacggc gtattggcag       300
     ggacacagcg gctacggaag tacgcccggg ccgcggcaac cgtggactgc gggcagcaac       360
     cagtcatatc ccacgcggga ctcgttctcg ccatcgacat taaacccatt gagccgaaat       420
     caaccgacat cgccccccgt gaccgaaggc atggcgcaac cctacgacat gcaccacctc       480
     cctccgttcc agcaatcgct ttccgtcccc ccgtcaggtc tcccgaccgg aaccgcaccg       540
     catcccgcca tgacgcacgc catgttggcc agtcccacgg gactaccgaa ccccgggccc       600
     tctccgcacc tcctcccatc gaatgacccc tacggaccca aatcgcagcc ggcacccgtc       660
     tacgggggag cacagcagat ccccagcccg caccagacca gtttcccacc gtacggacag       720
     ccggggctcg gcatccatcc gccgggccgc gtttcgtcca ctccgaccct ctcggccaca       780
     gggccaccac ctcacctgaa ctattcacgc cagccgtggc cgtcgtactc gctgccggcg       840
     atgaacgggc cggtgatgac gaacatacac agtccaaaca gccaaatgtc gttgctcggt       900
     agcatgcaac caggcatcct ccccggtttc aacagtggcc acgtggccag catgcagcaa       960
     atgtacggcg ggcacccgcc gcaccctatc caccagccgg ggccgaccaa cgaccggccg      1020
     ttcaagtgtg atcagtgccc gcaaagcttc aaccggaatc acgacctgaa acgacataag      1080
     cgcatacatt tgtcggtgaa gccgtttcca tgtacgcatt gcgataaaag tttttcccgc      1140
     aaggatgcat tgaagcgaca tattctggtc aaaggatgcg gcaaggacgg gccgaagacg      1200
     agcaccgcca gtgtcaagga ggaggacaag gagggcgttg ataccaatgg gcacagctga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page