(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE8

ASFUM1_6.PE8         Location/Qualifiers
FT   CDS_pept        join(complement(60771..60842),complement(60424..60659),
FT                   complement(59907..60156))
FT                   /codon_start=1
FT                   /gene_family="HOG000048663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902572"
FT                   /orf_name="AFUA_6G00193"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="metal ion binding"
FT                   /protein_id="EAL84247.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG056513"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniParc:UPI00005202D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8X2"
FT                   /transl_table=1
FT                   /translation="MIYACTFPNCWGRCTLRSSFTATCQTISTSEYCRTRITSIIVWDT
FT                   LSLSALSQIVSKEPRCYFFSQIAEEPCCNTLRTKEQLGYIANSAVVVYVMAGTWRILLP
FT                   CTLTNSIDQISTVYHDVEHIEPFTKKDIHEFPNQDIHPTSPVAQSCLYILLHGHLLELL
FT                   EETELQLKKILTLQCWMKIKTD"
     atgatatacg cttgtacttt cccgaactgc tggggaagat gcacattgag atcctcattc        60
     acagcaactt gtcaaactat ctctacaagc gaatactgca gaacacggat aacgtcaatc       120
     attgtctggg atacattatc tctgtctgct ctgtctcaaa tcgttagcaa agagccaaga       180
     tgctactttt tttcccagat tgccgaagaa ccgtgttgta acacgctgcg cacaaaggag       240
     cagctgggat atattgccaa ctcagctgta gtcgtctatg tgatggccgg cacatggcgc       300
     atcctccttc cctgtacatt gactaactcg atcgaccaaa tctcaacagt ctatcacgac       360
     gtcgaacaca ttgaaccatt tacgaagaaa gatatacacg agtttcccaa ccaggacatc       420
     catcccactt ctccagtcgc gcagagttgt ctatacatct tattgcacgg acatctactg       480
     gaacttctag aggagactga gctgcagctg aagaaaatcc tgacacttca gtgctggatg       540
     aaaatcaaga cggactag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page