(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE81

ASFUM1_6.PE81        Location/Qualifiers
FT   CDS_pept        join(282872..282999,283061..283159,283219..283289,
FT                   283348..283395,283470..284077)
FT                   /codon_start=1
FT                   /gene_family="HOG000171458" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056120"
FT                   /orf_name="AFUA_6G01940"
FT                   /product="Dienelactone hydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85845.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056373"
FT                   /db_xref="HOGENOM:HBG525846"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI000051EA69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP3"
FT                   /transl_table=1
FT                   /translation="METQQPRSSSSLLTILLPLYLIIGHGAQLLSSIANRSKRYLCASL
FT                   LGSVKPRSIYAFRPLHCSSVNMSGISKACCSIPPIVAQGYQGKGEYKTINGMKTYVTGP
FT                   DSASKAIFIVYDIFGFFPQTIQGADILATSSEQKYRVFMPDFFEGKPADITWFPPQTEE
FT                   HKQKLGNFFQTKAAPPANLPKIPSFVDEANKLAPNGKAFESWSILGYCWGGKIACLSSA
FT                   KDTKFKAAVQCHPAMVDPNDAKNVTIPMAMLASKDENPKDVEAFGANLKVDHYVETFST
FT                   QIHGWMAARSNLEDEEVRKEYERGYKTALSFLQKHA"
     atggaaacac agcaacccag atcgtcatcc tctctcctga ccatccttct acctctctat        60
     ctgatcattg gacacggtgc tcagctgctt tcatcaattg cgaaccgttc caagcgatat       120
     ctttgtgcgt ctctcctcgg atctgtgaaa cctcgctcca tttacgcatt cagaccgctc       180
     cattgttcat cggtcaacat gtccggcatt agcaaggctt gctgctcgat ccctcccatt       240
     gtcgcccaag gctaccaggg aaagggtgaa tacaagacaa tcaatggaat gaagacatac       300
     gttactggcc ctgactctgc ctccaaggcc atcttcatcg tctacgacat cttcggcttt       360
     ttccctcaga caatccaagg cgctgatatc ctcgctacct cgagcgagca gaaatatcgt       420
     gtcttcatgc ctgacttctt cgagggcaaa cccgcggaca tcacctggtt ccctcctcag       480
     accgaagaac acaagcaaaa gctgggcaat ttcttccaaa ccaaggctgc tcctcctgca       540
     aatctgccca agattccatc cttcgtcgac gaagcgaaca agctcgcccc caacggcaag       600
     gccttcgagt cctggtctat cctcggatac tgctggggtg gaaagatcgc gtgcttgtcc       660
     tctgccaagg acactaagtt caaggccgcg gtgcaatgcc atcctgccat ggttgatccc       720
     aatgatgcta agaatgtcac tattcccatg gccatgttgg cttccaagga cgagaatccc       780
     aaggacgtcg aggccttcgg tgccaaccta aaggttgatc attatgtgga gaccttctcg       840
     acccagattc atggctggat ggcggctcgg tccaaccttg aggatgagga agtccgcaag       900
     gagtatgaga gaggttacaa gactgctttg agcttccttc agaagcatgc ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page