(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE82

ASFUM1_6.PE82        Location/Qualifiers
FT   CDS_pept        join(284815..285057,285123..287996)
FT                   /codon_start=1
FT                   /gene_family="HOG000202621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263227"
FT                   /orf_name="AFUA_6G01950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85844.1"
FT                   /db_xref="HOGENOM:HBG056372"
FT                   /db_xref="HOGENOM:HBG327069"
FT                   /db_xref="UniParc:UPI000051FFDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCP4"
FT                   /transl_table=1
FT                   /translation="MPVLSGRRRSASTAAPSNTGASKASASSPRRASFSLENSRDYSAS
FT                   GRNPLRNFFQKHGAAPVTEDVSATDVPHASIEEHSNAESTTTPNAQSVKNPDRKGHCLG
FT                   SSWTRHIHHSGEHGGGQDASKSTADTLARSHNADVHDKPSSETHLSRDDIHAIFSGAPY
FT                   FLLEKGKHGLWYPHVIFPWDDHDPTIQHLWDRKLLPHPSYTLCTLHAHLPVPEGFLEGD
FT                   PPLLLDSWKRTGAPKRATFDIGIFEVPNMLAMSGIEPGTVGFRYFLELPVADSVRFVHT
FT                   GTSHPHTNLLHIHSLPAVQADELLEHYHEPYSQCLDGTIHDRKKLLGDGPTAWKRIGLR
FT                   DINFKAVVDRLETLRNLRHKLLYETTQKTILDVETAQDLYSDLFSKFLHSPPRSILKDL
FT                   DSTHGLKAEIKALTMVLATPGAWFDFSLVDWRFRIGQLLWEAPPHVDGDFFDPSILHKP
FT                   WAHPGLEQKWFLIQMLLAAELLLRLDAIVKVGLLESSKDVSVSAQDVNHFDKLRNPKVD
FT                   WDLVVVRRFFDSFKISWVDCQSAAVSNAPSQPPTQEKSPQKARRFSFFDSITRRHSVAS
FT                   SPHSDDQGMFRLTPTHIEQQVEGLLVFAENIGWPRVDSLREIFASKLQHGDSNLDIKEI
FT                   FNRPARGASVEGHTEETTKDDTFRKLATRRLVVLSGPSSDDTKSAMGGWITRCWLSGFV
FT                   VPGQAISHLLMATVLENDQEAIARLGLIANLYGGFALNGKSWWSQECIVGRVLSALNET
FT                   KACMGWISSTNIPKEYQTQEPLDDAWFEVIVSEPPTGLGKPRIKQGNKISVESTPLGLG
FT                   SLVSGEFTLPVDDVPDAKSPVDVKFNALTFSTMEERRNSNQHAIVARKATMSFSLRTGT
FT                   STATADVSFPLTYNVNFVTSHACRLPPGLASYQHNASPDGDGKGDRSRSLSPAEAFSLK
FT                   YGRLPGHPLPSSYRYKYLALDDLPAPEGSSIAKVFEHAGFDLTVDEVFVVDARQSAEKE
FT                   ALARSWCASVGYDAIIGRTGRTCLGCCIREARALAVKVVIRVGDQEITG"
     atgcctgtat tatctggcag gcgtcgttca gcttcgactg ccgcgccttc caataccggc        60
     gcgagcaaag catcagcgag ctcgcctagg agagcttcct tctcgctgga aaatagtcgc       120
     gattacagcg catctggaag gaatccgttg cgtaactttt tccagaaaca tggcgctgcg       180
     ccagtaacag aagatgtgtc cgcaacagat gtacctcacg cgtcaattga ggagcacagt       240
     aatgctgaat ctaccacgac tccgaatgcg cagtcggtaa agaatcccga ccgaaaaggt       300
     cactgcctgg gctcttcttg gacaagacat atacatcatt caggcgagca cggcggaggg       360
     caggatgcgt cgaaatctac cgccgacact cttgctagat ctcacaacgc agatgttcac       420
     gacaaaccgt cgtctgagac ccatctcagc agggatgata ttcatgccat attttccgga       480
     gcaccatact ttctcctaga aaaaggcaag catggactct ggtatccaca cgtgatcttc       540
     ccatgggatg accacgaccc tacaattcag catctatggg acagaaaact ccttcctcat       600
     ccttcatata ccctgtgtac ccttcatgcc catcttcccg ttcccgaagg cttccttgaa       660
     ggtgaccctc ccctcctctt ggacagctgg aaaagaaccg gcgcgccaaa gagagctact       720
     ttcgatattg gcatattcga agtcccaaat atgcttgcta tgagcgggat agagccgggg       780
     actgtgggct ttcgctattt tctagagctt ccagtggctg attccgttcg attcgttcat       840
     actggaacgt ctcacccaca tactaatcta ctgcacattc atagcctacc ggccgttcag       900
     gctgacgaac ttctggagca ttaccatgag ccctactcgc agtgtctcga cggcactata       960
     catgatcgaa aaaaacttct tggtgatggt ccgaccgcct ggaaaagaat tggtctgcga      1020
     gatatcaatt ttaaagccgt ggtcgaccgc cttgagacct tgagaaacct gcgtcacaag      1080
     ttactatatg aaaccacgca gaaaacgata ctcgacgtag aaactgcgca ggacctctat      1140
     agcgatctat tttccaagtt tctccattcc ccgccccgat ccatactcaa ggatctcgat      1200
     agcacgcacg gtctcaaggc cgagatcaaa gcgttaacaa tggtgttagc gacaccagga      1260
     gcatggttcg acttcagtct cgtcgactgg cgtttccgca taggacagct tctctgggaa      1320
     gctcctcccc atgtggacgg cgatttcttt gatccaagta tccttcacaa accctgggcc      1380
     catccggggt tagaacagaa atggtttctg atccagatgc tgctagctgc agagttactt      1440
     cttcgcctag atgccattgt caaagttggg ctgcttgaga gctcgaagga cgtcagtgtc      1500
     tcggctcaag acgtcaacca tttcgataag ctacgcaatc ctaaagttga ctgggacttg      1560
     gtggtggtgc gtcgattctt cgacagtttc aagatctcct gggtcgactg ccaatccgct      1620
     gcagtgtcga atgctccgtc gcagccgcca acccaggaga agtcacctca aaaggctcgt      1680
     cgcttttcat tctttgacag cataacacgc aggcattctg tagcctcttc tcctcactct      1740
     gatgatcagg ggatgttcag acttacaccc actcatatcg aacagcaagt cgaaggactt      1800
     ttggtatttg cggaaaacat cggttggcca cgtgttgact cgctcagaga aattttcgca      1860
     tcgaaattac aacacggcga ttcaaaccta gatatcaagg agatatttaa ccgccctgca      1920
     cgtggtgctt cagtagaggg ccatacggag gaaaccacca aagacgacac attcagaaaa      1980
     ctcgctacac gccggctggt agtcctcagc ggtccttcca gcgatgatac taagtcggcg      2040
     atgggtggtt ggatcacgag atgctggctt tctggctttg tggttcctgg ccaagcgatc      2100
     agccacttgc tcatggctac agtactagag aatgatcagg aagccattgc aagacttgga      2160
     ttgatagcca atctatatgg gggattcgct ctcaatggga agagctggtg gagtcaagaa      2220
     tgcattgttg gccgagtcct ttccgctctg aacgaaacca aggcttgcat gggttggatc      2280
     agcagcacga acattcccaa ggaatatcaa acccaagagc cccttgacga tgcctggttt      2340
     gaggtgatcg tcagtgagcc gccgaccggc ctggggaaac cccgtatcaa gcaagggaac      2400
     aagatctccg tggagtcgac accgctaggg ctgggatcgt tggtcagtgg cgagtttacc      2460
     ttgccggtgg acgatgtacc tgatgcaaag tcaccagtgg atgtcaagtt caatgctttg      2520
     actttttcta caatggaaga gcggcgaaat tcaaaccagc atgcaattgt ggcccgcaag      2580
     gcaaccatga gtttctcgct gaggacgggg acaagcacgg ccacagccga cgtttccttc      2640
     ccactgacat ataacgtcaa ttttgtgacg tcgcatgcgt gccggttacc tccagggtta      2700
     gcgtcatacc agcacaatgc gtcgcctgat ggagacggca agggcgatag atcgcggtca      2760
     ctgtctcccg ccgaagcctt ttctctcaag tacggacggc ttccaggcca tccattgcct      2820
     agctcataca gatacaaata tcttgcacta gatgacttgc cagctcctga gggatcatcc      2880
     atagcgaagg tttttgaaca tgccggcttt gatctgacag ttgacgaagt attcgttgtc      2940
     gatgctcgac aatctgccga gaaagaagca ttggcgagat catggtgtgc ttctgttggc      3000
     tacgatgcca tcattggtag aactgggcgg acatgcctag ggtgctgtat tagagaggct      3060
     cgggctcttg cggtcaaggt ggtcattcgc gtgggtgatc aggaaattac cggctag         3117
//

If you have problems or comments...

PBIL Back to PBIL home page