(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE94

ASFUM1_6.PE94        Location/Qualifiers
FT   CDS_pept        join(complement(345509..345961),complement(342486..345437),
FT                   complement(342202..342431),complement(341260..342151))
FT                   /codon_start=1
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263235"
FT                   /orf_name="AFUA_6G02070"
FT                   /product="Phospholipid-translocating P-type ATPase domain-
FT                   containing protein"
FT                   /EC_number="3.6.3.1"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of ions, phosphorylative mechanism"
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85832.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0015662"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG176466"
FT                   /db_xref="HOGENOM:HBG745019"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000520215"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCQ6"
FT                   /transl_table=1
FT                   /translation="MASDFLSPDSIDPGNGVREVSSNVSKPTKRQRWATQRVAGAGGVR
FT                   KRVSIMDRLHKRSEAKSEKRGSMLPPTDDSNTESDQDAQGGSNRRVYFNIPIPESERDE
FT                   DGQIKTSYPRNKIRTAKYTPLTFIPKNIWFQFHNIANIYFLFIIILGFFSIFGVDNPAL
FT                   NTVPLIVIVVATAIKDAIEDWRRTVLDNELNNSPVYRLVEWNNVNSTEDKVSLWRRFKK
FT                   ACTRATISTYRWIRRLMKKNKDVPQMFQDERRASILTTVTPRASVYSQRGDHGMEEDAI
FT                   QMTPVPSPSAEARADWPLPAGDSDQFLHPDKRNRDSLQAVTLPVTPPRKGGSVVDPSKQ
FT                   TIGKARFKRDYWKNIQVGDFVRLYNGDPIPADIVVLSTSDPDGACYVETKNLDGETNLK
FT                   VRQALNCGRQVRHARDCEKAEFLIDSEAPHPNLYAYNGALRWEQRDPDYPDAPRREMVE
FT                   PITISNMLLRGCSLRNTEWALGVVIFTGDETKVMLNSGVTPSKRAKLAKALNWNVIYNF
FT                   ILLFAMCFVSAVVNGVAWGSDDRSLNYFDFGSYGSTPVVTAIITFWVALILFQNLVPIS
FT                   LYISLEIVRTCQAIFIHSDVFMYYEKLGISCVPKSWNISDDVGQIEYIFSDKTGTLTQN
FT                   VMDFKKCTINGVSYGEAFTEAQVGMIRREGGDADTVAAEAREKIAADTTKMLQMLRRIH
FT                   DNPYLRDENLTFIAPDYVADLEGQSGEAQKQATEHFMLALALCHTVITEQTPGDPPQIE
FT                   FKAQSPDEAALVSTARDCGFTLLGRSGDDLILNVMGEERTYTVLNTLEFNSTRKRMSAI
FT                   IRMPDGTIRLFCKGADSIIYSRLARGKQQELRKKTAEHLEEFAREGLRTLCVAERVLSE
FT                   EEYRTWSKEHDIAAAALTDREQKLEQVSSEIEQELMLIGGTAIEDKLQDGVPDTISLLA
FT                   DAGIKLWVLTGDKVETAINIGFSCNLLTNDMELLVFNIPEDQPQRASQELDEQLQKFGL
FT                   TGSDEELIAAREDHRPPPATHAVVIDGDTLKLMLSDELKQRFLLLCKQCKSVLCCRVSP
FT                   AQKAAVVRLVKNGLNIMALSIGDGANDVAMIQEADVGVGIVGEEGRQAAMSSDYAIGQF
FT                   RFLQRLILVHGRWSYRRMGETIANFFYKNMVWTIALFWYSLYNDFDGSYLFDYTYIVLV
FT                   NVAFTSLPVILMGIFDQDVDDKVSLAVPQLYMRGIERKEWSQTKFWLYMLDGFYQSIIC
FT                   FYMPYLLFSPATFVHSNGLNINDRTRMGVLVASCAVIASNTYILMNTYRWDWLTVLINV
FT                   ISSLLIFFWTGIYSSTTASAQFYKAAAEVYGALSFWVVLLMTVIICLLPRFTVKAVQKV
FT                   FFPRDVDIIREQVTQGKFKYLDQYEAFVPPKAAATSGGLSNGSAASSDLGKPIQSSMKQ
FT                   DPFSDDQQIYPPSVAPTIHTHNPRSQNGSNGTNYSFDTTQHPRPQSVQSAQRTRHSFDR
FT                   ARPSYDVNSDFNSGAMLSRVDSATGIPVPQSPHSPLKSPHDPPSYQV"
     atggcgtcag atttcttgag tccggactcc attgaccccg ggaatggggt tcgcgaagtt        60
     agcagcaatg tctcgaagcc gacgaaacgc cagagatggg caacacaaag agtcgccggt       120
     gccggaggtg tacggaaacg tgtttcgatc atggatcgct tgcataagcg ttctgaagcg       180
     aagagtgaga agcgaggcag catgctgcct cccacagacg attcgaatac cgagagcgac       240
     caagatgctc aaggcggtag taatcgaagg gtttacttca acataccaat acccgaatcc       300
     gaaagagatg aagacggtca aatcaaaacg tcgtatccta gaaacaagat tcgaactgcg       360
     aaatatacac cattgacttt cattccgaaa aatatttggt ttcaatttca caacatagcc       420
     aacatctatt ttcttttcat cattatcctc ggtttctttt ccatcttcgg tgtagataac       480
     cccgcgctca acacagtacc cttgatcgtc atcgtggtcg cgacagctat caaagacgcc       540
     atcgaagatt ggcgccgtac cgtcctagac aacgagttga ataattctcc cgtttatcgc       600
     ctagtagagt ggaacaatgt gaactcgact gaggacaaag tttctctctg gcgtcgattc       660
     aagaaagcgt gtacccgtgc cactatctcc acataccgat ggattcggcg tctgatgaag       720
     aaaaacaagg atgtaccgca aatgtttcaa gatgaacggc gcgcctcaat tttgacgact       780
     gtaaccccgc gagcgtctgt gtattcgcaa cgtggtgacc atggtatgga agaggacgcg       840
     attcagatga ctcctgttcc atctccctcc gcggaggctc gcgcagattg gccactacct       900
     gctggtgatt cggatcaatt ccttcatccg gacaagcgaa atagagacag tttacaagcg       960
     gttacattac cagtgacacc accgcgaaaa ggtggtagtg tggtggatcc ctcgaagcag      1020
     acaatcggca aggctagatt caagcgcgat tattggaaaa atatccaggt tggggatttt      1080
     gttcgactat acaacggaga ccctattcct gccgatattg ttgttctctc gacttcagat      1140
     cccgatggtg cttgttacgt ggagaccaaa aatctagatg gcgagacaaa tctcaaggtt      1200
     cgtcaagctc tgaattgtgg tcgccaggtc aggcatgcta gggattgcga aaaggccgag      1260
     ttcctgatcg acagcgaggc tccgcacccg aacctgtacg cctataatgg tgcacttcgc      1320
     tgggaacaac gcgatcccga ctatccagat gcacctcgaa gagagatggt agagcctatc      1380
     accatcagca atatgcttct tcgtgggtgt tcgcttcgca acactgaatg ggcgcttggt      1440
     gtagtcattt tcactggtga cgagaccaag gttatgctca attccggtgt gacgccgtca      1500
     aagagagcta agctcgccaa agcgctcaac tggaatgtca tctacaattt tatcctactg      1560
     tttgccatgt gtttcgtctc cgcagttgtc aacggcgttg catggggctc tgatgacagg      1620
     tctctcaact actttgattt tggctcctac ggaagcactc cggtagtcac tgccatcatc      1680
     acattctggg tggctttgat cctgtttcag aacttggtac ccatctcgct ctacatctcc      1740
     ctcgagatag tccgcacgtg tcaggctatt ttcattcaca gcgatgtctt catgtattac      1800
     gagaaactgg gaatctcctg cgtgcctaaa tcctggaaca tctcggatga tgttggacag      1860
     atcgaataca tcttctccga caagactggc actttaacgc agaatgtgat ggacttcaag      1920
     aagtgcacta tcaatggagt ttcctatggc gaggccttta cagaagccca ggtaggtatg      1980
     atcagacgtg aaggaggcga tgccgacact gtggccgcgg aagcacgaga aaaaatcgct      2040
     gccgatacta ccaagatgct tcaaatgctc cgccgaatac acgacaaccc atatctgcgt      2100
     gacgagaatt tgacgttcat cgcgccagat tacgtcgcag acttggaagg gcaatctggt      2160
     gaagctcaga agcaagcaac ggaacatttc atgcttgctc ttgctttatg ccatacagta      2220
     atcacagagc agacgcctgg tgatcccccc caaatcgagt tcaaagcgca gtccccggat      2280
     gaggcggctc tagtgagcac tgctcgtgat tgcggcttca ctctcctcgg aagatcaggt      2340
     gacgacctta ttttgaatgt catgggcgag gagcgaacct atactgtact caatacactc      2400
     gagttcaatt ccacgaggaa acgaatgagt gcaatcatcc gtatgccgga tggcaccatt      2460
     cgtcttttct gtaagggcgc ggatagcatc atatactcgc gactggctcg tggcaagcaa      2520
     caagagcttc gaaagaagac agctgagcat ctagaggaat ttgcgcgtga aggattgcga      2580
     accttgtgcg tggcagagcg agtcctcagc gaggaggagt atcggacatg gagcaaagaa      2640
     cacgacattg ctgcagctgc acttacagat cgtgaacaaa agctggagca agtttcaagt      2700
     gagattgagc aggagctcat gcttatcggt ggaacagcca tcgaggataa gcttcaggat      2760
     ggggttcccg ataccatttc tttgttagcc gatgctggga tcaagctgtg ggttctgact      2820
     ggtgataaag ttgaaactgc catcaatatc ggtttctcgt gtaaccttct gaccaacgat      2880
     atggaacttc ttgttttcaa catccccgag gatcaaccgc agcgagcctc tcaagagctt      2940
     gatgagcagt tgcagaaatt tggattaacc ggttctgacg aggaactcat tgctgctcga      3000
     gaggatcaca ggccaccgcc tgcaacgcac gcggtagtta tcgatggcga tacactcaag      3060
     ctcatgctct ctgatgagct gaagcaaaga ttccttctgc tctgcaaaca gtgcaagtct      3120
     gtgctatgtt gtcgagtcag tcccgcccag aaagcggcgg ttgtccgctt agtcaagaat      3180
     ggcctgaata tcatggctct ctcgattgga gatggggcca acgatgtcgc catgattcaa      3240
     gaagccgacg tcggggttgg tatcgttggt gaagaaggta gacaggcggc tatgtcctcc      3300
     gactatgcta taggccagtt caggttcctc caacgcctga tccttgtgca tggtcggtgg      3360
     tcctaccgcc gcatgggtga gactatagca aactttttct acaagaatat ggtctggact      3420
     attgctctct tctggtactc gctctacaat gatttcgacg gctcgtacct cttcgactat      3480
     acatatattg tattggtcaa cgttgctttc acatctttac ctgtcatttt gatgggaatt      3540
     ttcgatcagg acgttgacga caaggtgtca cttgccgtcc ctcagctgta tatgaggggc      3600
     atcgagcgaa aagaatggtc gcagaccaaa ttctggctgt atatgctcga tggcttttac      3660
     cagtcgatca tatgtttcta tatgccatac ctcctcttta gccccgcgac tttcgtccat      3720
     tcaaacgggt tgaatatcaa cgaccgaacc cgaatgggtg tccttgtggc ttcgtgtgcc      3780
     gtcattgcta gcaacaccta catcctcatg aatacctacc gttgggactg gctgacggtt      3840
     ttgatcaatg tcatcagctc tctcttaata ttcttttgga ccgggatcta ctcttcgaca      3900
     accgcgtcgg ctcaattcta caaagctgct gcagaggttt atggagcttt gtcattctgg      3960
     gttgttctcc ttatgacggt gataatatgc cttcttcctc gctttaccgt caaagccgtg      4020
     caaaaggttt tctttcctcg ggatgtggac atcattcgtg agcaggtcac gcaaggtaaa      4080
     ttcaagtatt tggaccaata cgaggcattt gttcccccga aggccgctgc aacttctggt      4140
     ggcctgagca atggatcagc cgcctcctca gatttgggta aaccaatcca gtccagtatg      4200
     aaacaggatc ccttctcaga cgatcagcag atctacccgc cgtcggtcgc tcccacaatt      4260
     cacacccaca atccgcggag ccagaacggt agcaatggga ccaattacag ctttgacact      4320
     acacaacatc ctcgccctca gtcagtgcag tctgcgcaac gcacccgtca ttcatttgat      4380
     agagctcggc cgagttacga tgtcaattcc gacttcaatt cgggcgcgat gctgagccgt      4440
     gtcgattctg cgacgggcat accggtgccg cagagtcccc atagcccgct caaaagtcct      4500
     catgacccac catcatatca ggtataa                                          4527
//

If you have problems or comments...

PBIL Back to PBIL home page