(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE98

ASFUM1_6.PE98        Location/Qualifiers
FT   CDS_pept        join(complement(358038..358283),complement(357720..357854),
FT                   complement(357383..357661))
FT                   /codon_start=1
FT                   /gene_family="HOG000202474" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750823"
FT                   /orf_name="AFUA_6G02110"
FT                   /product="MADS box transcription factor Mcm1 "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85828.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG056359"
FT                   /db_xref="HOGENOM:HBG327033"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI000051E82F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCR0"
FT                   /transl_table=1
FT                   /translation="MADITAVGEENPSPTQDDLQQAAGNGAADNRGPKRSRMSAEDDDD
FT                   DDDKPGRERRKIEIKFIQDKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGL
FT                   VYTFTTPKLQPLVTKAEGKNLIQACLNAPDPATNENGVEAPEVPAETPEDVNHANVNPQ
FT                   QSNIPRPAGMHPGYMTNEQQQQMAYYQGLQQQQQAGGQYPGMPVGNRMPPQHQPTA"
     atggccgaca tcaccgcggt cggtgaggag aacccttctc ctacccagga cgacctgcag        60
     caggccgccg gcaatggcgc cgctgacaac cgcggtccca agcgctcgag aatgagcgca       120
     gaagacgatg acgatgatga tgacaagccc ggtcgcgagc gcagaaagat tgagatcaag       180
     ttcattcaag ataagtcgcg tcgccacatc accttctcca agcggaaggc gggtatcatg       240
     aagaaggcct atgagctctc tgtcctcaca ggtactcaag tattgttgct cgtcgtgtcc       300
     gagaccggtc tcgtctacac ttttaccact cccaagcttc aaccactggt gacgaaggct       360
     gagggcaaga atctcatcca ggcttgcctc aatgctcccg atcctgccac caacgaaaat       420
     ggcgttgaag ctccggaggt gccagcagag acacctgagg atgttaacca cgccaacgtc       480
     aaccctcaac agtcaaatat tccccgtcct gcgggcatgc accctggcta catgacgaac       540
     gaacagcagc agcagatggc ctattatcag ggtttgcagc agcaacaaca ggctggtggg       600
     cagtaccccg gcatgcctgt gggcaatcga atgccccctc agcaccaacc cactgcgtag       660
//

If you have problems or comments...

PBIL Back to PBIL home page