(data stored in ACNUC8465 zone)

HOGENOMDNA: ASFUM1_7

ID   ASFUM1_7; SV 1; linear; genomic DNA; GRV; FUN; 1833124 BP.
XX
AC   CM000176_GR;
XX
DT   28-JUL-2009 (Rel. 109, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 18)
XX
DE   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293) chromosome
DE   8, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Aspergillus fumigatus (strain FGSC A1100 / CBS 101355 / Af293)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes;
OC   Eurotiomycetidae; Eurotiales; Trichocomaceae; Neosartorya.
XX
RN   [1]
RX   PUBMED; 16372009.
RA   Nierman W.C., Pain A., Anderson M.J., Wortman J.R., Kim H.S., Arroyo J.,
RA   Berriman M., Abe K., Archer D.B., Bermejo C., Bennett J.W., Bowyer P.,
RA   Chen D., Collins M., Coulsen R., Davies R., Dyer P.S., Farman M.L.,
RA   Fedorova N., Fedorova N.D., Feldblyum T.V., Fischer R., Fosker N., Fraser
RA   A., Garcia J.L., Garcia M.J., Goble A., Goldman G.H., Gomi K., Griffith-
RA   Jones S., Gwilliam R., Haas B.J., Haas H., Harris D.E., Horiuchi H.,
RA   Huang J., Humphray S., Jimenez J., Keller N., Khouri H., Kitamoto K.,
RA   Kobayashi T., Konzack S., Kulkarni R., Kumagai T., Lafton A., Latge J.-
RA   P., Li W., Lord A., Lu C., Majoros W.H., May G.S., Miller B.L., Mohamoud
RA   Y., Molina M., Monod M., Mouyna I., Mulligan S., Murphy L.D., O'Neil S.,
RA   Paulsen I., Penalva M.A., Pertea M., Price C., Pritchard B.L., Quail M.
RA   A., Rabbinowitsch E., Rawlins N., Rajandream M.A., Reichard U., Renauld
RA   H., Robson G.D., Rodriguez de Cordoba S., Rodriguez-Pena J.M., Ronning C.
RA   M., Rutter S., Salzberg S.L., Sanchez M., Sanchez-Ferrero J.C., Saunders
RA   D., Seeger K., Squares R., Squares S., Takeuchi M., Tekaia F., Turner G.,
RA   Vazquez de Aldana C.R., Weidman J., White O., Woodward J.R., Yu J.-H.,
RA   Fraser C.M., Galagan J.E., Asai K., Machida M., Hall N., Barrell B.G.,
RA   Denning D.W.
RT   "Genomic sequence of the pathogenic and allergenic filamentous fungus
RT   Aspergillus fumigatus.";
RL   Nature 438:1151-1156(2005).
XX
CC   This Genome Reviews entry was created from entry CM000176.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1833124
FT                   /organism="Aspergillus fumigatus"
FT                   /strain="FGSC A1100 = CBS 101355 = Af293"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 8"
FT                   /db_xref="taxon:330879"
FT   CDS_pept        join(complement(4564..4875),complement(3817..4503),
FT                   complement(3451..3725),complement(2961..3375))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902311"
FT                   /orf_name="AFUA_8G00100"
FT                   /product="Aspartate-tRNA ligase, putative "
FT                   /EC_number="6.1.1.12"
FT                   /function="ATP binding"
FT                   /function="aspartate-tRNA ligase activity"
FT                   /biological_process="aspartyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85156.1"
FT                   /db_xref="GO:0004815"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006422"
FT                   /db_xref="HOGENOM:HBG057625"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI0000520474"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAV6"
FT                   /transl_table=1
FT                   /translation="MAAHDVHPAQVTLFVSRTAELRELREKPWIQLQFLTCTSHCGSFG
FT                   LVTFVLCKYMAAVRCILLFRPTLNSLNSLHNDYLFFTPWRTNSNHSLSLDRFTAMTQTV
FT                   ITPQAGGFDARVNSVLTTEPLKRVTLELRTNEGVIKANIDASSIGTSVWERLNGLCPES
FT                   LVRITNYSSPSAEAEPKKSVVNGKSHIDKATPEINVTNLTIIAEACPDLPSFNRNELDL
FT                   ARRLDNRLLDLRNAGSGAILKLHSGMCQLIVEFLGSNGFHWIHSPRIISHTVAGDKEYF
FT                   HLPYFGGDAWLAQNAQYQNQMVLSTDMERVFDIGPAFRAEVKSRTSGRHLTEFTLLGTA
FT                   MVLEENYYEVMDLMDSMIVFVLKGLQERKKYRDLIEIVQNHYPTAQDFRIGLDEQGKIP
FT                   RISFKEAKRMLRDELGFKTEDTDDLSEEEEAALGRHFRESPYLGQTDIFTIDQYPAFCR
FT                   PFNTHPSPDAPGFTNSWDTIVRGREICSGSQRIHKYEAVCKAMASRNMDPDGKEWEHYV
FT                   GAFKSGMPPHGGLGLGVNRLLQGFLGLDDVRETTLFPRDVHRTAP"
FT   CDS_pept        join(complement(5917..6182),complement(5831..5864),
FT                   complement(5308..5775),complement(5076..5135))
FT                   /codon_start=1
FT                   /gene_family="HOG000200004" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750316"
FT                   /orf_name="AFUA_8G00110"
FT                   /product="Oxidoreductase, 2OG-Fe(II) oxygenase family,
FT                   putative"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85155.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG057624"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI0000F51ADD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAV7"
FT                   /transl_table=1
FT                   /translation="MDVQVPTKSLASLPIIDFEAIANKDVTEIQKLVQAGRTQGMFYLN
FT                   LQGPRTNGVFDDIPTLFKAGNAFFSLPADCEEKTKALRTGVERGYHPSKGFEYYEIPRD
FT                   EYAAGSWELPATLQPEQERIARTMETFHGALQIVLAELCASVGITIPELSDDSTTPSDT
FT                   ALKFVYKFPIHEPGKVINGAHTDFGLATLLWYDEETTQVPIYDENGERTEEWLTIPVVG
FT                   GSVLVNVADELAARSNGSLHSTVHRVVAPPGAKRHNSALKFRPAANHQLLWVV"
FT   CDS_pept        join(complement(8388..8732),complement(8091..8330),
FT                   complement(7152..8039))
FT                   /codon_start=1
FT                   /gene_family="HOG000187465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261215"
FT                   /orf_name="AFUA_8G00120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85154.2"
FT                   /db_xref="HOGENOM:HBG057623"
FT                   /db_xref="UniParc:UPI0000F51AE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAV8"
FT                   /transl_table=1
FT                   /translation="MKKPVSSFSSICFPESSDNLTRPWEVAPEARSALLEKYHRELEKC
FT                   SPRDTWVADAHQKSAPYPILGNEAHQRQLADLSEALVLAITDIVQRWWSDVHARFPERM
FT                   PIDPLEEKLLRWMEGLGADVLRPYRFVQGSWRPDFLLESSEDPEQIENYRICEINARFF
FT                   SNGFLFTAFGQQALINMGIEKYGLKGATDPEKVITGLNKLVNPSLPLHIAKGEEYGFDT
FT                   HMWVPYLQQNLAMDVKVIPPENLRLVPAATPGGYKLYCLSSPDSKQPQVTNEVGECLEE
FT                   IHQLGLELHQRELLAMSYEMLQQISLRCFNDLRTVFLVHDKRMLGLVLEELDSLVSRNV
FT                   ISLHQANILNRGLVHTIIPGSTKLENFIATCQSDTLFKDKHMLKPVRSGKGKGILFGDQ
FT                   ISQDEWLSILQGMRDPFLENGKTTYVVQTQIQQRRYDVLLEEGKGIGNFPLIGTFHITH
FT                   GVFLGLGLWRSGPGRICALSRGGSWLCTVIQQ"
FT   CDS_pept        join(9103..9278,9328..9564,9619..10609)
FT                   /codon_start=1
FT                   /gene_family="HOG000187476" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261216"
FT                   /orf_name="AFUA_8G00130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85153.1"
FT                   /db_xref="HOGENOM:HBG057622"
FT                   /db_xref="UniParc:UPI000051F681"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAV9"
FT                   /transl_table=1
FT                   /translation="MANGFKLSDVLRIASIHPFYSDAEYPPNREDLPNLLAKQWGPDRD
FT                   LKLSSFPLTWKGALYKKIARLTTDRDPRNGYRQQVYISTTGGGSGKGSPMVFATDSQET
FT                   RQQRAAIGALLRSCGVTGPGDWVMTMHVSGHLYRALDLMAETFEGSGASVLCAGSLMEP
FT                   DQMIEILLEYRVNAIAGDTSQIMQLSRYICTLPDDTRKQLLINKVIYTSEPMTPVQRKF
FT                   LSSVFPNVAVSSVIGSAEAGPWATSPAQLTEASKGQNYADFVYDQRLMHLEVFPFDIEE
FT                   SDGAGLASARPVPDGEKGLLVQTSLQRMRHPLIRYICGDVCSLHPLPASMKNIIPAEDA
FT                   AHYKVARLYGRDRRISFDWYGEYFEFAVIQDAMRTESWGILQYQIIRRYNGGDKNNVDI
FT                   VLELRVLRHNEPGTISTDELTRELRKLFWVFENNEELFDLRYLQSYAGFVRSSTGRKVI
FT                   NFIDETQIE"
FT   CDS_pept        join(11257..11353,11407..12444,12495..12709)
FT                   /codon_start=1
FT                   /gene_family="HOG000185710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206917"
FT                   /orf_name="AFUA_8G00140"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85152.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057621"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EF26"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW0"
FT                   /transl_table=1
FT                   /translation="MGKVNFKSEQMGRSWRSSQWFILVTIAIALFSETFIYGFLVPLFP
FT                   YMLRERLHLDPARIQELTSLVLAVHGIVSVVSGPIIGHFADQCSNRKLPLLFSLFACIF
FT                   GTGMVAGATSLPVLFTGRVMQGIAGSSVWIIGLATVADTVGGDNMGKVEGIMMSFLYGG
FT                   LIGGPCIAGWLLAYVGYWPTWLLPLVLLLLDFIARLVMVENCAVPTSSSGPETSSKADG
FT                   STKPLLSPCEDTPTNYPSENFWRIILTDVRAVVAICVAISANTVGTSFHATLPLHVQET
FT                   FGWGSGRSGSLFACLIMPTVVLSPVAGWLRDCFGVRYPASAAAVFQAVMFGILGLAGTD
FT                   LLPWTSAQSGGGALYTGCILAIGAARPFTANVGPVELSSIVREYQEKSPGIFGPEGGMS
FT                   RVFSLDDVAASLGTVLGPIIGGFLTQYKGYDFMCFTWSKLSRRLPGHGSL"
FT   CDS_pept        14197..16545
FT                   /codon_start=1
FT                   /gene_family="HOG000166247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206918"
FT                   /orf_name="AFUA_8G00150"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85151.1"
FT                   /db_xref="HOGENOM:HBG057620"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniParc:UPI000051E840"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW1"
FT                   /transl_table=1
FT                   /translation="MGLLVHSLGHLMANEYVLIALAMLFFLVTLSSRSHSRERSSTSAS
FT                   PSLNSTRKECKAPNTPSWGRRTPRPIQWYQDMYFQIHNLEQYPTVLEPARDELLAMIAD
FT                   GVSLALEAPEKGILRVESYDAERLRSFINGEHEKTMNEWARYHDRRKLGLGPTLFGNIA
FT                   EAKKWLTQRAPAKLVDGAWLSHIHKITTPFALRGVTKDAWQILSEELGDGDVNRNHVFI
FT                   YNQLLKEIGCPLPDPQSRDFIESPSLEVMDDQRFWKGAVAQLLISLFPNEFLPEILGFN
FT                   MHYELISLEALMAAHELKELGVNSSYFLLHICIDNADSGHTAMALQNVIDYLELIKASE
FT                   LPSVLEEHWRRVQAGYILSQSLAVSPCDGRAVSGSSSPSNSRRVRQIVPTDSLTRQIIE
FT                   IFKGKSTVSPKYHCQSKVKIGNRTLAEWLDSTLWMHDDEQKHIELLGALAKSKRWVQPG
FT                   MGSASKLVQELSWGGRMFGAFTNEELDALIAWIDLLDPENSSWLYYRFTLRAPVASRDV
FT                   VGGLQDPTCHHLTLPARNADETIDGAFMEKLPDCRLDTECPDQKTPLNTPSKTQLPDIV
FT                   ALWFAHIGLLENIINVPARTATSLYSGILLALRAQAGFAAEAHVPAGMAEVRRQPACSL
FT                   VDIGLEIISRAQWTRDGNPSCLKDVFVLARKQGQSAESIKLSDNMLRWANRPNENFGIL
FT                   VGLALAFLGLKEAIAGSHELLSEESQAALKAIIKREQKGLFSCLQEIKSTGDGRYKDIE
FT                   KGYCLGRSALEKLLGKTAGVENTFLMRTA"
FT   CDS_pept        join(complement(16869..17346),complement(16627..16808))
FT                   /codon_start=1
FT                   /gene_family="HOG000048602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902312"
FT                   /orf_name="AFUA_8G00160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85150.1"
FT                   /db_xref="HOGENOM:HBG057618"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="UniParc:UPI000051F426"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW2"
FT                   /transl_table=1
FT                   /translation="MALDGRSPSPSISDLESACLYFAYGSNMNLTQMAQRCPESVIFAK
FT                   GALCNYKWQTNSRGGGNVIQGNTEDVVHGIVFIISSSEVEALRRYEGVDKQFFVEKKLV
FT                   IELEAISDPRFSRQKTADVVKVLATKDSDYGKHTISATKRPTSSDEICQVETRLSGSHE
FT                   ALVYISTPMYRSPGAITNEYSRRMQQAIADARLLGLSEDYLTYTLGPLISRKETDA"
FT   CDS_pept        complement(20854..27489)
FT                   /codon_start=1
FT                   /gene_family="HOG000217313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261217"
FT                   /orf_name="AFUA_8G00170"
FT                   /product="Nonribosomal brevianamide peptide synthase FtmA "
FT                   /EC_number="6.3.2.-"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /protein_id="EAL85149.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG057617"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000520944"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW3"
FT                   /transl_table=1
FT                   /translation="MAMALAVGAPSEQRGNLPYNTLKDGPTVDSMKATTDGKNGQGESA
FT                   FWDTCVHTVFREHCQRAPNSPAVNAWDGSFTYAELDSLSDAIASVLILSGVGPESIIPI
FT                   YMQKSRWTTVAILGVLKSGGAFTLLDPSHPRSRVEEISKEIQARFILTSEKLSKQCLEM
FT                   FSVLVVEHLSRACLPSPGQAGHTRSRPENAAYIAFTSGSTGKPKGIVIEHRSYCSGARS
FT                   HLKVFGIDSTSRVLQFASYAFDVSIMETLSTLMAGGCLCVMSESERSDPNLFVVSYKNL
FT                   RISHCFMTPSFARTVPWTECCNPPPTLIVGGELMRPSDARAYKEMGIRCMNAYGPAECS
FT                   VNVSVQSRVEAAVDPRNIGYTTGATAWIISPENPEELMPTGTVGELLVEGPIVGRGYLN
FT                   DPKATRQAFIDTPAWLRRHRKGTSYQHRVYRTGDLASLDSITGALLLHGRKDAQVKIRG
FT                   QRVELPDIEHHLQLTLPNDNAEVIVEKVTFSDDGSEKLIAFVLVRPSNTDSVIGNTGDR
FT                   LFLAPQSQIMEQFAISKKHLQTHLPSYMVPDIFIPISTLPQTASGKTDRKALRTRAAAL
FT                   SRRDVQCFLLSPAGGKRPPSTPKEATIRSLYSNVLNLPIDLIGMDDTFLRLGGDSLQAI
FT                   RLVAAARAAGLILQAKDILSSQSTLAEQSKRAGLIQTIDRTWESSPPFALLHGPTRHAI
FT                   VDLAQKQCRVPSNLIEDIYPCTALQEGMFITSLKHPGMYTGQIIFDIPDRMELPRLRAA
FT                   WLSVVSENAALRTRIIETHEGLMQAVIVDDFVWEEETDEMLLSSDGEALEITKIGVPLV
FT                   RFRYRPRHRQLMMTIHHSIWDGWSLRLVHEQLHRAYIGRDLLPSTSYRSFIQYTQELQG
FT                   ADEFWASELAGVNAPIFPTLPSGNYRPRVNASHRHVVRNLASTGKEEHTAATYIHLAWS
FT                   LLVAHYTDADETVYGVTVNGRSADVPGVENIVGPTIATVPTRIRVNEEDTVEMALDHVQ
FT                   DALARMIPYEQAGLQRISRCSRDASEACRFQTLLIIEAPTDSDVDCEKNEAGNFSIIGG
FT                   TTQTGMDYTAFSSYAMMLVFRTSANKSAISFDITYDAQVIGHDEVERMAHQFEHVLRHI
FT                   YTLATGRIGDISFIGPRDIEQVQQWNSSMPPADNRFLQELIFAQCSRRPQASAIISWDG
FT                   SWTYRELWAHSSFFARQLQRYGVTRGTPVAVCLDRSRWSIAVILGVLLARGTCVLIDLL
FT                   APRQRVRDILQIAGTGILVHSHATATLTSGLCPTVVNVSFLAAQSDSSQPEFPFTLETW
FT                   GGTPEDLAFIIFTSGSTGHPKGIEMPHRTLSTSISHHSAGMRVTSSSRVLHFSSYAFDV
FT                   SIYEIFTTLAAGGTICVPSEFDRMNNLAGFIQDTQVNWAFLTPSTARSLNPADVPLLTT
FT                   LVLGGEAVTHESVEVWAKGRSLINGYGPAEATICGVGNIPEAGWKSGVVGRIIGGLGWV
FT                   TVPSDPNRLAAVGAVGELLLEGPFLARGYLNLPEVTKAAFIDPPSWRTRIPAPSPYSFL
FT                   YRTGDLVRYQPDGSIQYVGRKDSRVKLRGQLVDLGAVEASVMRVYPAAGQVVADVLVSE
FT                   NTARLIAMVKLGPSVTENHDGPMFAAPDLVFNEAAASIQARLRAIVPAYMVPSMFIPLR
FT                   HIPRTLTGKTDRRRLRDKILSLSHSDLQRYMMSSSTKTPMSDDNERRLQEIWAEVLQLP
FT                   CEAIGREDSFLSLGGESLATMKMVALARRVGFMFAVTDVMNNTSLSTLARSRHLITEQA
FT                   ILTSSPSLSLPTIEGESLQEILRPLLNAGHIQGGNDIAAIHPVTAAQAFLVQRYPWSHF
FT                   QFDLSGAVSPSKLQTACTALMARFTILRTVFVEHAGCLLQLVLREVPNRVHEITTNEPL
FT                   DDFCNSVCQQQQDVCVVNSTTLPTLFTLVSNRQLNRHRLLLRLAHAQYDLTTIPLIVQS
FT                   LADEYNRTLRSGFSADFGYYLSHHKRQNNDDRSHNFWKRYLSGSSMMSTNQTADPTTVQ
FT                   ERVFHVTGSCIIIPTSHPPDITIATAVKAAVCLVLAARTGCTDIVIGQTVDARCSSADS
FT                   TLDQIVGPCTNYIPYRLSVCCSKTALEYLRSAQAQHTTCLRYSSLDFDQIVAKCTSWPS
FT                   STQFGYIVQHQDTGAELALTLGGDTTSLPMTSYGRVFPQGEVWIGSTPCSTGLRIDVIA
FT                   LSAVLSQKDAQTMAEEVGAALEKLLGCGYRRLSHLIGNTFAT"
FT   CDS_pept        join(complement(30019..30987),complement(29834..29955),
FT                   complement(29463..29761),complement(29290..29391),
FT                   complement(29033..29220))
FT                   /codon_start=1
FT                   /gene_family="HOG000159084" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055619"
FT                   /gene_name="ftmC"
FT                   /orf_name="AFUA_8G00190"
FT                   /product="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85147.2"
FT                   /db_xref="EMBL:BAH23996.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057615"
FT                   /db_xref="HOGENOM:HBG324816"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000F51AD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW5"
FT                   /transl_table=1
FT                   /translation="MKPSHSDTPLMMPSVMKCGYLATAGLIGICTHLSYFRYGEHHLYP
FT                   WRYVRFHLCLTMGVAALLYAKKPPQYTLCSMDLVKDVSLLMATYLVGLFASLLLYRTLF
FT                   HPLRQIRGPWAAKISSFWLSFRLRRGPSFRILHELHEEYGPVVRVGPSEVSIIHPEAVR
FT                   MIYGPNSRCSKNTFYDNGHPMMSLHSYRDRIAHDQRRRVWSAGFGDRALRGYEQRMRVY
FT                   RQKLFQRLEARAVAESAINISQWFNFYSYDTMGDLAFARSFDMLDASRNHWAVDMLMHG
FT                   MIGYRYLFPSWFFRLLATMPSLSSDWHKFIGFATDTMLRRVGEQVDVPDIFASLLAPLN
FT                   GREPTEDERNMLMGDAMLIITAGSDTTATSLTSIVYELARHLDEVDKLRAELDPIEADS
FT                   DGEYQHDTLAKLPHLNGFINETLRLHPPIPGVIPRKTPPEGIHVKDVFIPGNMTVFSPQ
FT                   WSMGRSEAAYIDPEIFNPERWYKHMDLVKDPSAFAPFSIGPYSCIGKPLALMNIRTTVA
FT                   RLIMSFDVRFPEGEDGIRWMDAADEHFAMGIHQMPVVLTRRH"
FT   CDS_pept        join(31738..32265,32351..32851)
FT                   /codon_start=1
FT                   /gene_family="HOG000217316" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261218"
FT                   /orf_name="AFUA_8G00200"
FT                   /product="O-methyltransferase, putative "
FT                   /EC_number="2.1.1.-"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="EAL85146.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG057614"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="UniParc:UPI000051F1AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW6"
FT                   /transl_table=1
FT                   /translation="MTQAVDIGTIQTLIRLEVPDQVPLTGSIPYDALVKKLKTPVDPEL
FT                   LQRLIRFTRLVGFLDEDAEGAVKHSPMSAIFVNDPDTAGQARFMADFGIRPCSFIYESI
FT                   KLDPSGEAARQGPLALMAREPGAREGPTFFEVLEKDPVNRKRWHDGMAVHNDSMVRHVA
FT                   GAYDWGTVQSLVDIGGSEGHVAAVIVNAFPHIQITVQDLPEIIEKARQRGDRHPNIIFE
FT                   EHDFFTPQPRIADAYFLRLILHDWNDADCTRIVRQISSALRPGARLLIMDAVLPEPGEG
FT                   SLQSERRLRRSDIGMYTLFSAKERSLAQMRRLVEDCDSRLRFEKLYTPPGSHASMLSWI
FT                   CE"
FT   CDS_pept        join(33251..33288,33405..34832,34902..35034)
FT                   /codon_start=1
FT                   /gene_family="HOG000200278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261219"
FT                   /orf_name="AFUA_8G00210"
FT                   /product="Dimethylallyl tryptophan synthase FtmPT1 "
FT                   /EC_number="2.5.1.-"
FT                   /function="tryptophan dimethylallyltransferase activity "
FT                   /biological_process="alkaloid metabolic process "
FT                   /protein_id="EAL85145.1"
FT                   /db_xref="GO:0009820"
FT                   /db_xref="GO:0050364"
FT                   /db_xref="HOGENOM:HBG057613"
FT                   /db_xref="InterPro:IPR017795"
FT                   /db_xref="UniParc:UPI000051E5CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW7"
FT                   /transl_table=1
FT                   /translation="MFVTSMLCLKMRLEDVGVLHAPRDRRLWRLLACPRRLDKIPSHLK
FT                   YPTERQDSHYNLQSLFLIPQHARMPPAPPDQKPCHQLQPAPYRALSESILFGSVDEERW
FT                   WHSTAPILSRLLISSNYDVDVQYKYLSLYRHLVLPALGPYPQRDPETGIIATQWRSGMV
FT                   LTGLPIEFSNNVARALIRIGVDPVTADSGTAQDPFNTTRPKVYLETAARLLPGVDLTRF
FT                   YEFETELVITKAEEAVLQANPDLFRSPWKSQILTAMDLQKSGTVLVKAYFYPQPKSAVT
FT                   GRSTEDLLVNAIRKVDREGRFETQLANLQRYIERRRRGLHVPGVTADKPPATAADKAFD
FT                   ACSFFPHFLSTDLVEPGKSRVKFYASERHVNLQMVEDIWTFGGLRRDPDALRGLELLRH
FT                   FWADIQMREGYYTMPRGFCELGKSSAGFEAPMMFHFHLDGSQSPFPDPQMYVCVFGMNS
FT                   RKLVEGLTTFYRRVGWEEMASHYQGNFLANYPDEDFEKAAHLCAYVSFAYKNGGAYVTL
FT                   YNHSFNPVGDVSFPN"
FT   CDS_pept        complement(35215..36795)
FT                   /codon_start=1
FT                   /gene_family="HOG000217317" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902313"
FT                   /gene_name="ftmE"
FT                   /orf_name="AFUA_8G00220"
FT                   /product="Cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85144.1"
FT                   /db_xref="EMBL:BAH23999.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057612"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI000052094A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW8"
FT                   /transl_table=1
FT                   /translation="MERLPLSPAVLFLIIVLPILYLWIRYTAPARPHGKHLSLPPGPPR
FT                   LPKIGNLHQVPRQIPWKKYKEWSDTYGPIMSVQLADTIAVVFSSWDLIKNHIERRNTIY
FT                   SSRPSVPFFLHATGGLNASILPYGPEWKLQRAIRSSVLKPSMTVKYRDVQHVETTQLLH
FT                   ELLSTNDFPVCLRRCIASVFLTVAYGERCVDHAGLEAIDRLEELNRAIALHAEALFSGA
FT                   AGILTQLVLPKALVDRLPVRWKKDADMLHNRLTADLVARTRAALVRPGWNWVKEFSMKD
FT                   GIGSGDGDGEQGSKVELKRLAYMVGSLYEASMAASQALRVIILAGLLHPDATRRMHDEL
FT                   DAVVGTGRLPDFHDAAQLPYTQAFIKEAMRWRSLTPMGSPRATSDEDECRGYHIPCGAT
FT                   VLVNVWAINHDEAIFLDPFAFQPERWIENPDLPQLMYGMGQRACPGRHMGQDSLFLATA
FT                   RLFWAFDMALPDGADPIDQERFLDSGTTLAAFLPDFEVRFTPRSEKYQEVIENSMAVLP
FT                   DVLSISATP"
FT   CDS_pept        complement(37672..38547)
FT                   /codon_start=1
FT                   /gene_family="HOG000169385" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206919"
FT                   /orf_name="AFUA_8G00230"
FT                   /product="Phytanoyl-CoA dioxygenase family protein "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL85143.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG057611"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI000051FB66"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAW9"
FT                   /transl_table=1
FT                   /translation="MTVDSKPQLQRLAADADVDRMCRLLEEDGAFILKGLLPFDVVESF
FT                   NRELDVQMAIPPPKGERLLADKYPPHFKYVPNVATTCPTFRNTVLINPVIHAICEAYFQ
FT                   RTGDYWLSAAFLREIESGMPAQPFHRDDATHPLMHYQPLEAPPVSLSVIFPLTEFTEEN
FT                   GATEVILGSHRWTEVGTPERDQAVLATMDPGDVLIVRQRVVHAGGGNRTTAGKPRRVVL
FT                   AYFNSVQLTPFETYRTMPREMVESMTVLGQRMLGWRTMKPSDPNIVGINLIDDKRLENV
FT                   LQLKAADSPA"
FT   CDS_pept        join(complement(41248..41454),complement(41066..41182),
FT                   complement(40905..41004),complement(40783..40851),
FT                   complement(40142..40732),complement(39731..40072),
FT                   complement(39661..39707))
FT                   /codon_start=1
FT                   /gene_family="HOG000171616" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16261220"
FT                   /orf_name="AFUA_8G00240"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85142.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057610"
FT                   /db_xref="HOGENOM:HBG325095"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051FFF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX0"
FT                   /transl_table=1
FT                   /translation="METLDAIQLPYLGVVGASLIVILGIILLFPLGSDPFITINQHPRD
FT                   LFQTKAKQQFEYNAAALLNEGLQTGHSAFRLVTNMVTYLILKDQYAEEIKNDSRFGAHE
FT                   AVDPVLLVDLPGLESMFQGSLHNQVPPMAVRALNKELVHLTPSLSEEAMNCLQTRWTDS
FT                   TEWHGVSIPETVLALIAQMTTRALLGPELCRNPEWLDIAKSFTTNRAIAVAAVQSWPSF
FT                   LQPVIHWFLPPCRALRRQIQCARNIILPALERERRAYCSDQPTKREFSNLVFIDQYAKG
FT                   ARYDATMAQLRIIAVAFQTTSDLVEKVIARLCKHPELIEPLREEVVSVVGNHGLHRHSL
FT                   RKLTLMESVMKETQRLEPAVIIGMFRLAKEKVTLKDGTVVPKGTNIAFANDLRFDPEMY
FT                   LEPETFDGYRFQRMREDPAKIDLAPFTKTRMSHLAFGHGKHACPGRFLACDEAKLILCH
FT                   ILLNYDIRAVEGSPPELPGSWGNDVGEKTAGD"
FT   CDS_pept        join(42182..43362,43428..43530)
FT                   /codon_start=1
FT                   /gene_family="HOG000200278" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI16261221"
FT                   /gene_name="ftmPT2"
FT                   /orf_name="AFUA_8G00250"
FT                   /product="12,13-dihydroxyfumitremorgin C N-
FT                   prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /function="tryptophan dimethylallyltransferase activity "
FT                   /biological_process="alkaloid metabolic process "
FT                   /protein_id="EAL85141.1"
FT                   /db_xref="EMBL:ACF22981.1"
FT                   /db_xref="GO:0009820"
FT                   /db_xref="GO:0050364"
FT                   /db_xref="HOGENOM:HBG057609"
FT                   /db_xref="HOGENOM:HBG325644"
FT                   /db_xref="InterPro:IPR012148"
FT                   /db_xref="InterPro:IPR017795"
FT                   /db_xref="UniParc:UPI000051FFEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX1"
FT                   /transl_table=1
FT                   /translation="MTIPTEISCPEEDAFQLLDKFSWFPSDDQRRWWEYTGPYLLKLLR
FT                   DAKYPQKDQVPCLYLLQQLLVPYLGTFPVVGQAPLPWWSNVTTYGVPFELSWNLLHNIV
FT                   RIGFEPLSHLAESGVDAFNKTAPEECVSRLACLDNTIDLARFRHFQHHLLVTPEEETWL
FT                   LKEKAPLAKSGRGQQTLAVEFQNGGISAKAYFFPGMKSLATGLSPGKLILDSIERLALP
FT                   GLKEPVHHLRSTLGLQDDGHPTDTAIAPFLLGVDLCTPERSRLKFYVTDQVVSWDRVAD
FT                   MWTLRGKRLEDPQCADGLALLRKLWDLLAIPEGYRSNIRPDFAFGTPPPEDYRPVMMAN
FT                   WTLSPKKKFPDPQIYLLTVGMNDAVVMDALVAFYEVLGWTDLASTYKDKVASYFPGPDF
FT                   TKTNYIHSGVSFSYRHSKPYLSVYYSPF"
FT   CDS_pept        complement(43835..45877)
FT                   /codon_start=1
FT                   /gene_family="HOG000217318" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261222"
FT                   /orf_name="AFUA_8G00260"
FT                   /product="F-box domain and ankyrin repeat protein "
FT                   /protein_id="EAL85140.1"
FT                   /db_xref="HOGENOM:HBG057607"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051EF21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX2"
FT                   /transl_table=1
FT                   /translation="MGRWWGLPLPPEIILELFEYLRPPDVVALAQAAEGFAQLALSVYS
FT                   SSLREKGQTILFSAVTCGHVSIVRHYLEQGADPCAADDEGYTPLHWAAAYGHYNVVSLL
FT                   IDVGADINARQNSGFSPLDYAIITGHDRVVEVLLKHGATITDVTIGPSQRTTLHAAAIK
FT                   GYSKIAKMLLSHGAPTDVKDAHGHTPLHLAVSKGHLEIVQALLCAGATVDIQDKVGDSP
FT                   LHLAAGNGYFAIVQELLNKGADPSLQGRKTATPLHQASLMGFVDVVQLLLESGANVSAQ
FT                   RSDGQTPLLQASGAGQVATVRLLLGAGSSPSIPDEDGNTPLHFAVLSEKATIAEMLIEA
FT                   GAHVDSANDKNQTPLHWAAKGHEEMVPTLLKHKADTHARSHTGWTPLHWAANEGHVGIT
FT                   TALLDAGARDQIQNEHGESALHLAVQKGHQAVVQLLIQRGSKPHLTDNKLRTVLHCAAD
FT                   VGHEDVVRILLSVQARSDVKDINGRTPLYYAALQGHVVIAKLLLEFGTALDESVKEAFL
FT                   EAAEAGHELMVQLLITHGIDLSFKDTSGSTALHRAVLGGQIEVVELLLDTEADTSARDN
FT                   SGKTALHLAAQEGEDEIAKVLLRHSEIRDLQDCDGWTALHWAVNNEHENTVQSLLDAGV
FT                   DPGIASFDACTPLDLAEVGALETIEQMLREALAATDRPTIGDAPP"
FT   CDS_pept        join(complement(48093..48171),complement(47533..47650),
FT                   complement(47420..47479),complement(47131..47313),
FT                   complement(46974..47092),complement(46667..46932))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261223"
FT                   /orf_name="AFUA_8G00270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85139.2"
FT                   /db_xref="HOGENOM:HBG057606"
FT                   /db_xref="UniParc:UPI0000F51AE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX3"
FT                   /transl_table=1
FT                   /translation="MAADSLSPTKIRPDAMTNTGESGPLLQWSLDLVSPEDELAREQAQ
FT                   PRFTWDMRDPPWARSMNGPIFCSLTGPTMTRSIHPSTFPTIFDIDNRSVLVEGIRTPLQ
FT                   EKDCRWVILAHDFSPSSQEVWRRLPAHSVFVLNETLLDSAPDPEKTLHTATVSDALQLA
FT                   LDLVQKYPGLTKSVASVHDISAFVGVVTYRYHDSRLRVSSILLISAEDFELDGPSVASY
FT                   GLDSIIGAEMKNWSFKEVGLEFSFQNLLSPSLTFGGLAEVVSMHLGVIPATD"
FT   CDS_pept        join(48259..48798,48821..49049,49108..49221,49268..49410)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261224"
FT                   /orf_name="AFUA_8G00280"
FT                   /product="Short-chain dehydrogenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85138.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057605"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051EF1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX4"
FT                   /transl_table=1
FT                   /translation="MPAPYSTRTTTDELVADYAPLIKGKVILTTGVSSGSLGGFFVQSI
FT                   AKAKPEWLILAARNADKLAQMAAEIAKAQPDVKVRTLKVDLGSLESVRDAAAHVNSWDD
FT                   VPVIDVLVNNAGIMAVDYQLSPDGFESHLATNHLGPFLFTNLIMKKIVAAKEPRIVVVS
FT                   SDGHRLNPFRFDDYNFDTYLRKPGTLTVTTQDGKTYNRWYAYGQSKTANMLFAISLAQK
FT                   LGVKYNLQAFSLHPGIIWTNLGNHLDWNIEFGELRNADKSLGNREGWKDFDAKPLERGA
FT                   ATHIYAAFDPSLKANNGAYLLDCHVADPVVDTVKSWATSSFEAERLWRLSEKLVEQEFP
FT                   Y"
FT   CDS_pept        complement(49560..51611)
FT                   /codon_start=1
FT                   /gene_family="HOG000048601" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261225"
FT                   /orf_name="AFUA_8G00290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85137.1"
FT                   /db_xref="HOGENOM:HBG057604"
FT                   /db_xref="UniParc:UPI000051F420"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX5"
FT                   /transl_table=1
FT                   /translation="MRLLHMEGQVIDHSIQIDSNQALRAISLCFLCRDWDRGSYLLETI
FT                   SQNVPGYLDLDEMRDHSTDWMLATWVGAIYEHNGQYDTAFEWYLWANEVMETQREGTSD
FT                   DEARRGSQSSIHGGELFAGLIRVCLRYASLSTTNPQPKAPIDWGLPAPNWTGQALVFLE
FT                   RTFARTLLEFLIGRSKTDPEIIEAWAASTYINRQITDLTLLLPNKSEDEGKKSRVEIEL
FT                   DRLRAESEKRPMPDAQISQVTRSLLSATRFQIDPESICRVIPEDAVVVEMNLSRGGLIL
FT                   FCLTTAGVVSIHQSERTILDLRRQVLRYVKRLENDQCSRDELSSLIMGISREIIHPFEE
FT                   VIWQKDHVIFVPTQEFNFFPFSALTFNDKPLFLEKAVSQVPSLATLEQIVKRPHPGMLP
FT                   ELSTIVNTHEPDASGPKHAGEPVPMVGVGAAVVSHIFSVPPTDARYLEEAGFKNIFENS
FT                   EIVYIGTHGAKHELSPWQSCINLKDEFRVMEVAKFSSKASLIIFGACMSGLGRVTVGND
FT                   VLGFSHAVLQSGAGAYMGALWNVDVSITMMLIVVFSRKVAQRTQRTTLAKCWQEAQKTL
FT                   YNLTTDAAVSMLQGILDEWETAKQKWHLEHLAKGGIRLLKRLMEDLETVDFKHPYYWAP
FT                   FTLVGHAGRSLDPTISTLCRAMTEQLQGDSIRLNSLHEASLSPIAGIK"
FT   CDS_pept        join(complement(52913..53639),complement(51728..52830))
FT                   /codon_start=1
FT                   /gene_family="HOG000200003" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902314"
FT                   /orf_name="AFUA_8G00300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85136.1"
FT                   /db_xref="HOGENOM:HBG057603"
FT                   /db_xref="UniParc:UPI000051F8E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAX6"
FT                   /transl_table=1
FT                   /translation="MNFEKITSLMGGTLSSEEYRGNFAHIRFTIAALEQSPGFRTSSEL
FT                   RARVLLLKAVLSMLSGNFSESLSALSALNDDAADLGERWAFRIKSYERLCAYLQLVPPL
FT                   LRFQSQYGSSAGTIREAELRESIAQLSAWHSEVEDLDQFEAALPTYLYQSNLYLWAVQG
FT                   QHDQYANQPLAAKGAEILSQLDTTFLHRLKESATELHLSQTAASLGRIEYECEVARGSE
FT                   SSDTLFNQLYNHHEDNIDIVVQGGLNGWANEKWDNEEPKFSLRYNMEAQSHYSKALAMV
FT                   DTTSAPRCRAAILLRMGCISHMEGIVARQQNRISASKRLFEAADTQLQEAKRWFELDES
FT                   NCQLVECHQILLDISRDRLSGINTRASAIGEWGKTARHETLSQFLGLLMMRFGRRQYLD
FT                   GLDANRGLLCLSCAGSCFRALGDDVFVLQALMAEADTQYHTGNGGLARIRIDEAREQLQ
FT                   VSLDHMRDLAFRHPSRASALRGILLNMLLGFHPVASKIYALSVNPRDCEKWSEYYRTAM
FT                   ADIKAHGYFQKIMALPSRPAGSSDSNQPPIMLNMTAIFQEQREAESLARNYHEKSNMAY
FT                   SELEKGNIDGYEAHLQEFLDDSSSSGAPPLKIW"
FT   mobile_element  56502..60041
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   mobile_element  62753..65611
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(66246..67715)
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   CDS_pept        join(72095..72231,72258..72467,72529..73114)
FT                   /codon_start=1
FT                   /gene_family="HOG000253044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261226"
FT                   /orf_name="AFUA_8G00342"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27221.1"
FT                   /db_xref="UniParc:UPI0000F51AF0"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA53"
FT                   /transl_table=1
FT                   /translation="MRVEQRHTYYLYEMGHSPDRVTLGHLVHGNYAMPTKSLHYSAPRM
FT                   RTLRRLITLSREELESWAEIRDVRGEYGQTDKTNYGIEVNVFGAGNFGVGFVTESGKAI
FT                   IAEKGRRIELLEFFETKILTDEKAMEKLRTWLSVRRSKYILKKAGGLRKPEIWCLTGFY
FT                   ELENAKSCVVHKKSPSIRVGIDSAAVAAICGAPVGCSVDVGASSTITSVSEHPGKFIWA
FT                   AQFQLLTARYTCTRNCKPTTISPREIQLYPDTSYSIGVLLGDEDETDVAGLEMQTVSKS
FT                   GPPQDDLDEAYWEAYDKAEQRIMEDMEDH"
FT   CDS_pept        join(74124..74255,74314..75522,75587..75829,75886..76088,
FT                   76121..76344,76400..77388)
FT                   /codon_start=1
FT                   /gene_family="HOG000217320" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261227"
FT                   /orf_name="AFUA_8G00350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EBA27220.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000F51ADC"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA52"
FT                   /transl_table=1
FT                   /translation="MPSKNTTHYILLDSVNTLSPADLERLLRAIQQRDQGMPSRVRVLT
FT                   IDITKHNKPDIKAFIVEELKRKGIFQGADEDSQRRKTMVEERLWVRSNNSYLTIQQDLR
FT                   KVEEIITSGGTEEELHRVLHESSTDPKELVRAEIEGLEAMLKAREIEEINELLVWVIAS
FT                   DKSMLLVELEAALFLRFKTVSLQPLDKKITGKYSKIFTLIYGKYLALKDHVRDCVVAQR
FT                   DRPRQSADDPKITATISITNGDLKLVQRFFWDLNHYSFLGGFAFEPTSDQTNVGQRKIQ
FT                   VYEADAHLEIVKRTFDILSQPVVDERGKALVPYLMRSLTTHLKALSEVTGLDELQPADK
FT                   QFIGSHVYEMFNEGDVIERNWDFCYAVRWYERDDEMDIFWEWLDDPVAIAGLGPRDKRW
FT                   LAELKKDKKHRNSGLLTPAMTMVARNWLQDTKWSTFRVFRWIRGFLRLGAEPQQEDRTT
FT                   VAEQTGKSDTGSGRIIIYDNDSNVRKILKAEQWCKQLLGVTELDYTWCIRLGDTYADVR
FT                   EYDAASEQYKKAAEILQAQDPIDKEQLRDVFKTLAEFATDPDYALEYLKEAARLDAEDV
FT                   EIPCAMLRQCITSKNEDEARVPGTQSTLLMAMLSTALGKGNEIDMLAVFNAVFSVVSSS
FT                   AELRAIFQHEMEVAIVAARTEGKNEELATLLFQLASDLRECLNTIRERVAEEDRYRLDF
FT                   IKQSAIDRLSMVYFDRAIQTEGEEPEADVERLRQVHMNDPAAKIPKSALASLYSIKGQR
FT                   DKARDISRAEIVEAFNILADDDILNDLDGFVALRNLLNHTGDYENALRAALLLPELRFD
FT                   GTVLTTLLAGEGPSMEAVSEELVQYYDRECPDTDRHWESLTKVWREASKLADEADAASE
FT                   RAACLDRVQKLLAKLEREIECSLPGNTCNRYWDYDNGLHACKYCYNVFLCNGCWDELRS
FT                   GKAGKGLVCSSTHAWYPLPPWTMEKYLQTCQGLVRMKTDNGGEELVSVSEWLRTLCEEW
FT                   GLSKADWDFE"
FT   CDS_pept        join(78111..78164,78263..79003)
FT                   /codon_start=1
FT                   /gene_family="HOG000217321" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206920"
FT                   /orf_name="AFUA_8G00360"
FT                   /product="NlpC/P60-like cell-wall peptidase, putative "
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="EAL85130.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="HOGENOM:HBG057596"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI000051FDC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY2"
FT                   /transl_table=1
FT                   /translation="MRTVFTPGIKASRIPPLPLKLFALTLAAAVSMVNGYPITGNGVNC
FT                   RAGPSTNDKVIKSYAKGTDVKLSCQTYGENINGNSIWDKTTDGCYVADYYVKTGSNSMV
FT                   TKECGGGTPPEGNSSYNGKITRKEIISRGQYWVSRHVPYSMNKVYPDPQGRKYRTDCSG
FT                   FVSMALHTNSPGFSTVTLPEVVKAISWNDLKPGDLVGTLGPGTGGAAGHVTLFLSWADS
FT                   SKKEYNTLECRGTYGCVKYKRPVGWKDGSFTAKPYRYIRVVD"
FT   CDS_pept        join(complement(86283..86887),complement(80794..86223),
FT                   complement(80560..80749),complement(80197..80511),
FT                   complement(79285..80133))
FT                   /codon_start=1
FT                   /gene_family="HOG000217122" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206921"
FT                   /orf_name="AFUA_8G00370"
FT                   /product="Polyketide synthase, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL85129.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG057595"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="UniParc:UPI00005206DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY3"
FT                   /transl_table=1
FT                   /translation="MTLTYGHKRLQDAPEPIAIVSAACRLPGHVNGPHKLWELLQSGGT
FT                   AVSNEVPQSRFSSEGHFDGSGRPGTMKALSGMFIEDIDPAAFDAAFFNLTRADAIAMDP
FT                   QQRQLLEVVYECFENGGIPIEKVRGKQIGCYVGSLNGGKSLWMSRWSVADIIRILIDAD
FT                   YHDMQMRDPEQRVSGHAVGTGRAILSNRISHFFDLRGSSFTIDTACSSGLVGVDVACKN
FT                   LRAGTLTGAVVAGVNLWLSPEHTEERGTMRAAYSASGKCHTFDAKADGYCRAEAVNAVY
FT                   LKRLSDAVRDGDPIRAVIRGTASNSDGWTPGINSPSAQAQAAMIREAYANAGIDSSEYA
FT                   ETGYLECHGTGTPAGDPTEVKGAASVLAHMRPPASPLIIGSVKSNIGHSEPGAGLSGLI
FT                   KAMLVVEEGEIPGNPTFLNPNPAIDFDNLRVYATRIRIPWPKESSHYRRASVNSFGFGG
FT                   SNAHAVLDNAEHYLGKYWASLEIPRSHLSSYINLSDMLSLFDGRRSSKTVTRRPQVLVF
FT                   SANDMDSLKRQISTLSAHLLNPRVKVKLSDLSYTLSERRSRHFCRAFLLSYPAKSGHAS
FT                   KIAVEEAQFSKISQEATRIGFVFTGQGAQWSQMGLELVRTFPGVVKPILEQLDNVLQEL
FT                   PADLKSEWSLLQELTEARSSEHLSRPEFSQPLVTALQLAQLAVLQSWGVRAEAVIGHSS
FT                   GEIAAACSAGLLTPRQAILNAYFRGLAGKSALATSPKGMMAVGLGAQDVQPYLEGVSAD
FT                   VVIACHNSPASVTLSGSASTLAELEGTIKAAGHFARMLRVEVAYHSPHMAKIANRYEEL
FT                   LKEHGRLDDGSKTNKRSNRMISTVTEDEVTGAQVCDAAYWKANMLSPVRFDGACNKLLT
FT                   NTQLAPNFLIELGPSNTLAGPVTQIARAAKVDNLTYAAANKRGPDESSRAIFDVAGHLF
FT                   LQNADISLDKVNLGDNTPDKAKPAVIVDLPNYQWKHSTHYWHESLASKDWRFKKFPSHD
FT                   LLGSKVIGTLWQSPSWHKMLRLSDVPWLRDHRIGSEILFPAAGYLAMAMEAVRQAALST
FT                   ATAEARELLKTRHYRYCLRDVQFPRGLVLEDDAEVHIMLLLVPMAKLGQGWWEYKITSL
FT                   AESDSVASSSSSTLSPEKWNINSTGLVRLETILEASSSRAPEHTCSLPLDNPTPGQMWY
FT                   KSLRDAGYSYGPSFQRLVAVESTEGKSATRSLISLEPPRSKWEPQSEYPLHPAPLDSVL
FT                   QSMFPSLHRGNRTKLDQLLVPRGIGELTVSGDIWKSGEAISVTTWNKVSGDASLYDPAS
FT                   RSLIMQLNSVSFSPMLDGRDSLYMSHVYTQLTWKPDFQLLDTDEKLQQALSGGDGAASS
FT                   LVQDLLDLAAHKAPNLRVLEFNLVPGSSESLWLAGHPTPRAVRTALTEFHFAANSADTA
FT                   LAAQEEYAEWPAARTARFSVLDPFSKALAVPAGSSQFDLVIIRRPQHADLGELDILVGN
FT                   LRRLTSDGGSVIFYDSKQSSLSGGRGLANGHNHFPAALQRFGLTKVRQTRDGSCIVAEV
FT                   SPAQNLSLRNDFRVVIVRFSTARSTIIDHTISQLRQFGWTLTEICIYNESGTGLPQLPP
FT                   KSTVLVLDELDRPLLATATDHEWTALQAIIQSECNLLWVTEGSQVRPTAPLKAVAHGIF
FT                   RTVRAEVPMMRIVTLDVESATTESLGTNASAINMALREITLADRSSLPIECEIAERGGL
FT                   LHVSRIWPDAGVNKRKVEDNAGGAPPVLTNLHDSKSTIRLMASRPGSLEALHFAEQGRD
FT                   VCSRQDMGPDDVEVEIFAAGCNSRDIDVAMGDISGDLDGLGLEGAGVVVRVGACVSARC
FT                   VGQRVAVFGKGCFANRVTVSCKATFPLPDAMSFEQAATLPIALLTALYAVGRLAHVQGD
FT                   DRVLVHSPCTDVGIACIRLCQRSGSTPFATVDNLEQRHFLTHELGLPEDHIFMSEPAAF
FT                   PRALRHATKGHGLDVIISQPANRNLDNENMRLLAPGGRLIGIANGGADVGNLLPTGSLA
FT                   PNCSFQRLDVTALPEKTIESGNSFDSVFLELSRLVTDGSVQPLSPSTLLGYEEIPKALQ
FT                   LLREGTHIGKIVISDPRGTKLAVLTRPATTLAQSMINPSHCYLLVGGLKGICGSLAIHL
FT                   ASHGAKNIAVMSRSGGGDQVSQGIARNIRALGCSLDLLQGDVTSISDVRRAFSQISVPL
FT                   GGIIQGAAVFRDRTFESMSHEDYHAAVSSKVTGTCNLHTVSLETNQPISFFTMLSSISG
FT                   VIGQKGQANYAGGNAFQDAFAEYRRALGLPAISIDLGPVEDVGVIHGNEDLQNRFDGST
FT                   LLSINEGLLRRIFDYSILQQHPDPQHRLNVTSQGQMITSILVPQPEDSDLLRDCRFRGL
FT                   RALGEHSPRSRRDPTKDKEIQSLLFLAQSQDPDRAALRAAAITVVGARLAKQLRLTDAV
FT                   DPARPLSYYGLDSLAAVELRTWVRMTLAIELTTLDVMNAASLGELCEKVIGKMGFGM"
FT   CDS_pept        join(87370..87474,87522..88295)
FT                   /codon_start=1
FT                   /gene_family="HOG000217123" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750317"
FT                   /orf_name="AFUA_8G00380"
FT                   /product="DltD N-terminal domain protein "
FT                   /protein_id="EAL85128.1"
FT                   /db_xref="HOGENOM:HBG057594"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="UniParc:UPI000051F425"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY4"
FT                   /transl_table=1
FT                   /translation="MNREDVEFPTCDGLILRGWLYPGTIRGPAIVMNQGFNTPKEILLP
FT                   DVAVWFQQQGVTVLLYDNRCIGASDGEPRNDVKPAKLVEDFHDALTFMARHPMVDEDKI
FT                   ILYGYSFSAMTALVAAGLDHRVGAAISVTPIANYDFREKEKNNVMALAMQDRVSTLAGN
FT                   DPVYIPFVGDDGYNPAGWGNQYNMEQFRAFLGTSFFTNRTTVQSYYHVLAWQPYGAMRL
FT                   IKGTPVMMVTPAEDTISSPADQRAVFDMIPEPNKEFDLVAGRGHMDVINGEGAEEVLQR
FT                   QLAFMRKHLDF"
FT   CDS_pept        join(complement(88861..89296),complement(88492..88802))
FT                   /codon_start=1
FT                   /gene_family="HOG000166235" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261228"
FT                   /orf_name="AFUA_8G00390"
FT                   /product="O-methyltransferase, putative "
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="EAL85127.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="HOGENOM:HBG057593"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="UniParc:UPI000051E5E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY5"
FT                   /transl_table=1
FT                   /translation="MHWPDFLAKTNYRKPRDDKASCYIDTFPEKKSFFERCSANPVHQE
FT                   SFSSFMDVWAKGKRPWPEFYDTQALLDGADLSNGSPFVVDVGGHHGIDLMRVAEKHPDL
FT                   PAGSLVLEDLPDVVGAVHLTTDKIRTVAHDLFEEGVEQPIKGARAYFMHAVLHDWSDET
FT                   SVKILRQIAAVMKPGYSKVLINDIVIPSTGASCYQAAMDCLVLQASANERTEAVWSKVI
FT                   KDAGLKLVKYYPDGRGYESVIEAELP"
FT   CDS_pept        join(complement(89570..89870),complement(89383..89516))
FT                   /codon_start=1
FT                   /gene_family="HOG000048600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261229"
FT                   /orf_name="AFUA_8G00400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85126.1"
FT                   /db_xref="HOGENOM:HBG057592"
FT                   /db_xref="UniParc:UPI000051EF25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY6"
FT                   /transl_table=1
FT                   /translation="MADIAEQLIEKLQTLETSIFEGQDATRQKLALAARKLFHTLETKE
FT                   EKTMRLAIEEPVMFSVLQALIDTGLFEGWAAAGGGERDVTELAKLSKRDVEPELLRHQL
FT                   RLMAANHIILETANDRYAPTPYALAIGDKSTKVAPALRIR"
FT   CDS_pept        join(complement(91893..92235),complement(91766..91813),
FT                   complement(90548..91698),complement(90406..90492),
FT                   complement(90299..90355))
FT                   /codon_start=1
FT                   /gene_family="HOG000226278" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750318"
FT                   /orf_name="AFUA_8G00410"
FT                   /product="Methionine aminopeptidase, type II, putative "
FT                   /EC_number="3.4.11.18"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85125.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG057591"
FT                   /db_xref="HOGENOM:HBG318153"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000051F688"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY7"
FT                   /transl_table=1
FT                   /translation="MLQSQRRGLDWILLVVESRGIAYTRLASTCWIPKFPNLSLSNGGP
FT                   GPAPSTYPWCPPCNCSRRLLALRCFCVIAPPAPPRAGSHSLRCPRYGVRRTSEVQDCTL
FT                   RSPLAFRWYWYMTVDAPELLEKLRITDAGANGADMSSSTSAAANGTGKEVDDGSDDDGT
FT                   ENPPAVAAEHSTAKKKKNKKRKPKKKQPKVQTDPPSIPLSQLFPNNSYPKGEEVEYKDE
FT                   NRYRTTSEEKRHLDNLNSDFLSDYRQAAEAHRQVRQWAQRNIKPGQTLLEIANGIEESA
FT                   RCLVGHDGLTEGDSLIAGMGFPTGLNIDNIVAHYSPNAGCKTVLAQNNVLKVDIGIHVG
FT                   GRIVDSAFTMAFDPMYDNLLAAVKDATNTGVREAGIDVRVGELGGYIQEAMESYECEIR
FT                   GKTYPIKAIRNLCGHTILPYSIHGTKNVPFVKSNDMTKMEEGDVFAIETFGSTGSGRYV
FT                   EGGEVSHYALRGDADRKDLTLSSARSLLTAIKKNFSTIPFCRRYLDRIGQEKYLLGLNY
FT                   LVKSGIVEDYPPLNEKPGTYTAQFEHTILLRPTVKEVISRGDDY"
FT   CDS_pept        join(93113..93319,93375..93642,93708..95101)
FT                   /codon_start=1
FT                   /gene_family="HOG000200002" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055620"
FT                   /orf_name="AFUA_8G00420"
FT                   /product="C6 finger transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85124.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057590"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051EA80"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY8"
FT                   /transl_table=1
FT                   /translation="MDVNRKRMVRMASAQRSEMLVRLSGKAKRWTVGGGGEVETHTFHT
FT                   FCAGQKSYKSVVRRQRPRIARRDSRPSHPIANRGMNMLVHDLGFSHRACDRCHGQKLRC
FT                   RRENNSDTCVRCARAGVRCTPRPMRLRSRAQSTKNTQQQQSQSPANGGSTQQLHVNQEQ
FT                   GPNDTNDEHSDHFEYLPTSLLDMPTDLNMGMDPSSLQVDIHPALTAPYGPEGSVHTSQP
FT                   SGPQAPSHLRTAEQAGQTRWSDAPNLDTSDELYDFSLPATMRSSFPATYHRHRASLARN
FT                   MSPQPAHQQGRDDMMVDFDQAEGNPRGSDGKDSRADSGYGNELSPSDLLRSPYGDAPDS
FT                   DSELQPRGNSQDQGEQSNSILDTRHQNMTSWIRRLSDTNVQLHQHMQSIPLVGTGKKTR
FT                   GSGAGTSLSPMELPVDSTFKLSSQYTGLLTSICARLQACRSCNDSQALAQLALDQPSQL
FT                   LVLSSYMCLLASYDRILQHIEAWLKVRLKMGVRGSAMTLDDDESSSCFPTQLPSLAVGS
FT                   FEVPKTSSIQSLVLTCIMETNVMHMHSLISEIMRPVSHPATGSASKTAASGPPAAEKRP
FT                   GNGAADAGDGLSTVAKVTLQAIEANEDSTLRLVHTVSRLALQRVML"
FT   CDS_pept        join(complement(95646..95807),complement(95277..95588))
FT                   /codon_start=1
FT                   /gene_family="HOG000189637" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261230"
FT                   /orf_name="AFUA_8G00430"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85123.1"
FT                   /db_xref="HOGENOM:HBG057589"
FT                   /db_xref="HOGENOM:HBG325631"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI0000520229"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAY9"
FT                   /transl_table=1
FT                   /translation="MAETLQKKRLLRMTVAHYRQPNVSEEEFYQWVTEQHAARAAKLHA
FT                   KNGIEGFCIYFTPQSFRDFTSELNNARGNPWRVRDFDAQVEFFFRDMETFYKGAADADF
FT                   QALQAEEGPFVSGERAEISLGWVETYVREGQVVNLDEAGKPTFLPFKDMSQAP"
FT   CDS_pept        complement(96252..98969)
FT                   /codon_start=1
FT                   /gene_family="HOG000048599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902315"
FT                   /orf_name="AFUA_8G00440"
FT                   /product="Steroid monooxygenase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85122.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057588"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000051F8E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ0"
FT                   /transl_table=1
FT                   /translation="MTRIRPDYDAIVIGAGFSGVRSLWELRRLGLTARCFDAGSDVGGT
FT                   WWWNRYPGCRTDGEAWVYALKFLPELLEEWDFTERYPPQEEIQWYLSRVLDRYDLRKDI
FT                   EFNTEVKSAHYSDHDSIWKITTASGKVATARYFLPATGITSIPKEPPFPGLQSFKGEVY
FT                   QTSTWPAHEIEFENKRIGVIGTGSTGIQVITKLAPVAEQLIVFQRTPNYVIPAQNYPLD
FT                   EKKREDIKKTFDATWDIAKRNLAGHAVKHSGRMVASAGGPEEIQRVFEDGWARGCYDFQ
FT                   LGTFDDSFMDPHANAVTSDFIRQKIRSIVRDGDTAEVLCPTYPFGARRPPCADGYYETF
FT                   NRSNVKLVDIREDEIEVYDQGIKTASGAEYELDMIILALGFDTGTGAMNKIDIRGSQNR
FT                   SLRESWTRRLETFAGVLVHGYPNMFVVCGPHLPAGNQPVSLEAFASWIGKTIEHMETNG
FT                   LASIDVSNEAMDAWTTHVEQVWGGSFLAKHAHEQGSWFVGTNIPGKPSRIMFYFGGMVN
FT                   LEPWLIKELETGWSSMSFTRLDGAEASNGVSKQTVGGVHVTPEMLESVQIPLEADKVGM
FT                   TPAEKSKLVNAATAVYIDMAVEEMRSRGLAPKADYRVHWWKVMQDFVDSGEGQRVLQET
FT                   SLTNQELERVIAKLGIEGEVIARMGPEIVNILTGKTHALAHIMRDDLLFRVYLSDEGRR
FT                   ANRYMAEYARLLTSQRRDIRILEIGAGTGGTTSEVLNLCSPNGESFCAEYMYTDLSPGF
FT                   FNAAKTTLKKWESHLAFQVLNIEDDPAGQGFKEHTYDLIIAANVIHATARLTNTLSNVH
FT                   KLLKPGGVFGLVELTRLTPFYNLTFGSLSGWWAGVDEGRTESPLQSPQQWNSLLKQTGF
FT                   SGVDLAAYDLPGPERHSCLLLSTALSNSVTTNGH"
FT   CDS_pept        join(100917..101057,101116..101152,101214..101527,
FT                   101586..102132,102187..102341)
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902316"
FT                   /orf_name="AFUA_8G00460"
FT                   /product="Methionine aminopeptidase, type I, putative "
FT                   /EC_number="3.4.11.18"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85121.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG057587"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000051E83C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ1"
FT                   /transl_table=1
FT                   /translation="MTNSDPKNKCCGTDCDNEAGTLQCPTCLKLGVKGSYFCSQECFKK
FT                   NWTTHKALMHKTQNATGLYNPFPSYQFTGSVRPVYPLSPRRSVPKHIKRPDWAETGIPR
FT                   REMRLSRSKWDLLDEKGQQAMRKVCRLAREVLDITAAAVRPGVTTDYLDEICHNACIER
FT                   DSYPSPLNYNHFPKSICTSPNEVVCHGIPDQRVLLDGDILNLDVSLYHGGYHADLNETY
FT                   YVGDKAKADPDSVRLVETTREALDMAIEIVKPGVPIREFGKIIEKHAASRGLVVIKTWG
FT                   GHGINSEFHPPPWIPHYAKNKAVGTCKPGMTFTIEPILALGGNREKYWPDEWTNVTVDG
FT                   KRTAQFEHTLLVTETGVEVLTARLENSPGGPIPIPEVANGKAHNGHANGDANGEVKN"
FT   CDS_pept        join(complement(103294..103368),complement(102474..103226))
FT                   /codon_start=1
FT                   /gene_family="HOG000217322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902317"
FT                   /orf_name="AFUA_8G00470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85120.1"
FT                   /db_xref="HOGENOM:HBG057585"
FT                   /db_xref="UniParc:UPI000052047C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ2"
FT                   /transl_table=1
FT                   /translation="MDQSMKPLLSPTERPRRHLTASVISFFLPNQFRLSTILCIGALLQ
FT                   TILCAVLPLRYAAVPCVTVLLISVLTTIQECFQPNTNSFMADVIRGRTTAQIPGKDGTH
FT                   GREPGKGSVVVFHLGIQYNHPLGVFAPHMREISNRFLAMQQDILRRKDELGLLAVQNWR
FT                   GSERDSGNTTLIKYFFKDVESIHKFAHEPLHKETWTYYNQHHPGHVGIFHETFITKDGG
FT                   YESMYVNCHPILLGRGEVKVNNRKDGTEEWVGTLVSADTPGLKSFKARLGRDD"
FT   CDS_pept        103765..104694
FT                   /codon_start=1
FT                   /gene_family="HOG000217324" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261231"
FT                   /orf_name="AFUA_8G00480"
FT                   /product="Phytanoyl-CoA dioxygenase family protein "
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="EAL85119.2"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG057584"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniParc:UPI0000F51AEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ3"
FT                   /transl_table=1
FT                   /translation="MLGRHECTISESVSALDPTAQEPEYTLVPSTSRDLVRDMTLNMED
FT                   AQAHLKEHGWVKIPAVLSKAEAEDALSRLWEAKAASEARGECTFQPILDPNPANVRVFY
FT                   LPELDAYWRDMLVNPTALDLAKSLLGDQLLVSNFSANIARPGAESMALHSDQSIVLPAP
FT                   WLDVWAVNVIWCLTRMTKENGATLYIPGSNKWTTWEDVPDNAPDLLVPFEADAGDIVVI
FT                   DGRLWHTSGSNVTEDEDRAILFAYYSAPHMRPLTNWSAKLPKELQETLSPQLKELLALS
FT                   HIGYVVKGDLTYMAQKYPSEKGTTAVSA"
FT   CDS_pept        join(105095..107481,107529..107883,107938..108249)
FT                   /codon_start=1
FT                   /gene_family="HOG000048598" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055621"
FT                   /orf_name="AFUA_8G00490"
FT                   /product="PKS-like enzyme, putative "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL85118.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG057583"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="UniParc:UPI000051E838"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ4"
FT                   /transl_table=1
FT                   /translation="MLGLPNELSGSQVPGATEYEPGWRRVFKVEDLPGLGDYHIDNQTA
FT                   VPTSIVCVIALAAAMDISNGKQANSIELYDVTIGRPIHLGTSPVEIETMIAIEPGKDGA
FT                   DSIQAEFSLNKSAGHDENPVSVANGRLRMTFAGHELELLSSRQAKPCGLRPVSISPFYD
FT                   SLREVGLGYSGPFRALTSAERRMDYACGVIAPTTGEASRTPALLHPAMLEACFQTLLLA
FT                   FAAPRDGSLWTIFVPTQIGRLTIFPNSSVGINTPASVTIDTHLHEFTAGHKADLPMIKG
FT                   DVSVYSSEAGQLRIRLEGLTMSPIAPSTEKQDKRLYLKRTWLPDILSGPVLERGKPVFC
FT                   YELFGLSLAPKSILAATRLLSHRYAKLKILQVGTSSVHLVHSLCRELGSSMDSYTIACE
FT                   SDSSMEDMRRRLLSDALPIKYVVLDIGKSLTEGDEPAAGEPTDLGSFDLIILLKASADD
FT                   SPILKRTRGLIKPGGFLLMTVAATEAIPWEARDMTRKAIHDTLQSVGFSGVDLLQRDPE
FT                   GDSSFVILSQAVDHQIRFLRAPFDSTPPFPTRGTLLVIGGASHRAKRPIETIQNSLRRV
FT                   WAGEIVLIRSLTDLQTRGLDHVEAVLSLTELDQSVLENLSRDTFDGLHRLLHQSKIVLW
FT                   VTYSAGNLNPHQSGAIGLVRAVQAETPDKVLQLLDVDQIDGNDGLVAESFLRLIGGVKM
FT                   KDGSSNSLWTVEPELSVQGGRLLIPRVLFDKKRNDRLNCLRRQLKATDSFEKQSALARP
FT                   IDPCSLFSPNKTYVLAGLSGQMGQSITRWIVQSGGRHIVITSRNPDKDDLWTKELEQRG
FT                   AHIEIMAADVTKKQEMINVRNQILSAMPPIGGVANGAMLQSNCFFSDLTYEALQDVLKP
FT                   KVDGSLVLDEVFSSDDLDFFLLFSSISAVVGQPFQANYDAANNFMTGLVLQRRARNLPA
FT                   SVINLGPIIGLGFIQNIDSGGGSEAVIATLRSLDYMLVSERELHHILAEAILIGKSDET
FT                   PEIITGLETVSDNPAPFWHKSLLFSHII"
FT   CDS_pept        join(complement(108801..110523),complement(108297..108739))
FT                   /codon_start=1
FT                   /gene_family="HOG000229981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261232"
FT                   /orf_name="AFUA_8G00500"
FT                   /product="Acetate-CoA ligase, putative "
FT                   /EC_number="6.2.1.1"
FT                   /function="acetate-CoA ligase activity"
FT                   /protein_id="EAL85117.1"
FT                   /db_xref="GO:0003987"
FT                   /db_xref="HOGENOM:HBG057582"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000051F424"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ5"
FT                   /transl_table=1
FT                   /translation="MDHPYLQDEVLRQSLQNPDEFWSRQAERLHWHRKPDTALRTTQKS
FT                   LPDGTAHPMWEWFPGGEISTCYNCVDRHVAAGNGHESAIYYNSPVTNTKETITYHTLLR
FT                   EVETLAGVLRETGVKKGDVVMLYMPMIPAALIGMLAVNRLGAVHSVVFGGFAPNALAQR
FT                   VEACKPDVLLTASCGIVGNRPPIAYQALVEEAIKLSYHKPAHTIVWQRDQLQWDFQESA
FT                   PTWWRTVWQWIQRVLFRRRIRTAKQSSWQQLVASARARGLKADCVPVPSDQPIYIMHTS
FT                   GTTGAPKGVLRSSGGHAVGLQFTIQYIFNIHGPRDVMFAASDIGWVVGHSYILYAPLLA
FT                   GAATVLYEGKPVGTPDASAFWKVVEEYQVNTMFATPTALRAIKQEDPSNTKLAEIGARG
FT                   GLRSLQALFLAGERSEPTLVSMYQELLDQHGGRNAQVIDNWWSTEAGSPITGRAMAPHF
FT                   GLTTELSRSFDIPIPPIKPGSAGKPMPGFDVRVVDEHGEEVPKGSMGNIVLALPLGPTA
FT                   FNTLWLEEERFYKSYLQRFDSRFLDTGDAGWVDPDGYVHVMSRNDDVLNVSAYRLSSGA
FT                   IEEAISSHPQVAEACVVAIPDQLKGQLPFAFISLSVADHPDSAIPAPTIAAEVQSLVRS
FT                   RVGAFASLGGIVQGKGMIPKTRSGKTLRRVLRELLENGVYGDLDRSVEVPSTIEDATAV
FT                   QVARAQVREYFNRNKGKHKAIEARETA"
FT   CDS_pept        join(complement(112067..112596),complement(110932..112012))
FT                   /codon_start=1
FT                   /gene_family="HOG000166103" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750319"
FT                   /orf_name="AFUA_8G00510"
FT                   /product="Cytochrome P450 oxidoreductase OrdA-like,
FT                   putative"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85116.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057581"
FT                   /db_xref="HOGENOM:HBG325625"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000051F1A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ6"
FT                   /transl_table=1
FT                   /translation="MAYELSTLQLSCVAFVAFMAVLVFRTRTRNLKQNVPPGPRPLPII
FT                   GNFFDLPPKGQPEYLHWFKHKDAYGPVSSINVMGTTLVIFHDKDAAHAVMGKKAQKTSA
FT                   RPQLNFAQLCGFENFLITHQYNDKYRLHRKMVHQEIGTKGLSAGFRPIQEQESIRFILQ
FT                   TFNRPDDILQHLKTLAAAIVLKITYGYSIERKGQDPLVELIEHAMENLSQAFVPLAWAV
FT                   DSVPAIKYLPDWFPGMSYRKTARKWRAINEAAAELPYDFVKRQMAHKAHQPSYVSNLLE
FT                   KHMIKSEDNKINVSAADEEAIKWTAVSLYAAGSDSTVAIIHSVICGLVMFPEVVTRAQE
FT                   EIDRVVGSDRLPNFDDRTNLPYVDGIIKEAWRWNPVGPMGLTHKSEEDLVCGEYLIPKG
FT                   SYLLPSLWWFLNDPKEYPEPRVFKPERYMEPFNHPDPSEIAFGYGRRSCAGRYFADASV
FT                   YITVVQLLAVFNVRKARDDQGNEIPVTLQAIPGMVNRPAPFQFKVEPRSQHHIDLLRRI
FT                   ESEQIPEVSHASLLKPSTV"
FT   CDS_pept        join(113744..113909,113972..114042,114101..114358,
FT                   114412..114438)
FT                   /codon_start=1
FT                   /gene_family="HOG000201238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261233"
FT                   /orf_name="AFUA_8G00520"
FT                   /product="Integral membrane protein "
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85115.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057580"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI000051F684"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ7"
FT                   /transl_table=1
FT                   /translation="MWVAAVYTNTISCTLVYSIAIVVYNEGGLAAIPVVKNLIGAIGLG
FT                   CYCWGTTIIFDGGKELHGLKAVAVLMIVGIFATTGHAQDFRDRTADATRGRKTIPLLLS
FT                   QPVARWSLATITAAWTIGLIALWKPPAIVTLAYVAASLRCLDGFLSSYDEKDDYVSYCW
FT                   YGITVLASWE"
FT   CDS_pept        complement(115218..116555)
FT                   /codon_start=1
FT                   /gene_family="HOG000079257" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055622"
FT                   /orf_name="AFUA_8G00530"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85114.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG057579"
FT                   /db_xref="HOGENOM:HBG325623"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="UniParc:UPI000051FDBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ8"
FT                   /transl_table=1
FT                   /translation="MATIHKLFKSPFFDFEFLRLLAMAPYEGAEIGEVLEAAAKIKDQD
FT                   PESWYSTLLETGGKAEAIAKQAEASGDRVGARRAYLRSSNYLRAAQFMLNEGPIGHDER
FT                   VLPTLERAIANFRKGVQYRDGKTIFLEIPYEGGKTLPGYLYLPPAARRIPGRKIPILLN
FT                   SGGGDSTQEEIYFVNPAYGPDLGYAVLTFEGPGQGIVLRRDKLPMRPDWESVTGPVLDH
FT                   LFDLATRHPELELDLDHIAVTGASMGGYFALRAAADPRIKACVSVDGFYSLSSFVGGRM
FT                   PGPLFNGFMSGWLSDWMFNGILGVLKKLAFQARWEFNHLRWATGSTTDADVMRSFGAYT
FT                   LQKADGTEYLADVKCPTLVTGAGASFYFDPATTTDKIYDCLTSLQDGVDKEKWIATDVA
FT                   YGGLQAKIGAFGYSAQKTFEWLDQRFGIQREPLAASSRLEDLVSRL"
FT   CDS_pept        join(117018..117981,118037..118174,118239..123621,
FT                   123679..124036,124097..124561,124608..129323)
FT                   /codon_start=1
FT                   /gene_family="HOG000162255" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055623"
FT                   /orf_name="AFUA_8G00540"
FT                   /product="Hybrid PKS-NRPS enzyme, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL85113.2"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG057578"
FT                   /db_xref="HOGENOM:HBG325622"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020842"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51CF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WAZ9"
FT                   /transl_table=1
FT                   /translation="MVYTHSPKEPIAIIGTGCRFPGGSTSPSKLWDLLYSPRDLTREVP
FT                   AESRFNPKGFYNVDGEHHGASNATNAYFIEEDPRYFDAGFFSIAPREAESIDPQQRLLL
FT                   ETVYEAMENAGLTLNGMRGSATSAYMGAMSADYTDTQLRDIENVSKYMITGTSRALLAN
FT                   RLSYFFDWKGPSISVDTACSSSLAAVHLGVQALRAGECTISCVGGSNIILNPDCYLAAT
FT                   SLHLLSPTGRSQMWDQAADGYARGEGVCVFFMKTLSQALRDGDRIDALLRETCVNSDGR
FT                   TQGIALPSAEAQVSLMRTAYKNAGLDLSKAEDRPQYIEAHGTGTQAGDPREAYAIATTF
FT                   FPPGEDHSHRPKLVVGSVKTIIGHTEGCAGIAGILKAVLAMRHKTIPPNQHFHNLNPSV
FT                   KPSFKHLSIATSPQPWPVVPPDTPLRASVNGFGSGGTNCHAIVESYVPEIHDNGPWGKP
FT                   KEMTQVPNGVAAPETDFSPIPLIFSASSGTALRAMLERYQEYLERTEVSLLRLAMTLNS
FT                   HRSTLPVRVSIPGTSKADVLAAIRTQLAKVGSNPGAEIGTRSSVPEFDHVRRPKILGVF
FT                   TGQGAQWAGMGQGLMAKSALFRQVIEVMEEAMAQLPDGPEWSLKEEIMKPPKTSRLGEA
FT                   EISLPVCAALQVGLVKVLRSAGITFSMVVGHSGGEIGSAYAAGKISEVDAIKIAYYRGV
FT                   YTKLAIGKDGKKGGMIAVGFGYEDGLNFCAMEQFADRLTVAASNSPKSVTLSGDLDAVH
FT                   EAKELLDAEGVFNRVLRLDTAYHSPHMYPCAAPYLAAIERCGLVAGKSNGTAWASSVYD
FT                   DNRMMTSAQDKDLEAAYWKDNLIGRVLFSQAVERALDEGNGDFDLALEIGPHPSLKGPT
FT                   LETIRHKIGSEIPYSGVLDRKADDILALSTALGFSWLTLGSGVVDFAGYVSGFDPSNAS
FT                   ILNAPALPDLPTYPWDHKKVLYRESRLNKNVRHRVDPPHPLLGSRTPDDTDYEPRWRNF
FT                   LIMEELPWLRDHCVQGQIIVPAATYSVMALEAAKVLCRGKHVQSIELSDVAILRPIVLD
FT                   EASDGTETLFSVRSDLDSNKKHEDEIHAQFTLSAGAMDDRHLRTAATGHIRITLAAEAP
FT                   SSFPNGPRPTELDLLPTSVDRFYASMDEIGLSYSGPFRAMTSMKRRLNVASATVAVDRD
FT                   LAGTIPVHPTWLDACFQTFLAAFAAPRDGSLWTAFMPTAIGRMVFSPSSTSQVPGRSVT
FT                   VDAHITDFAPGYQVSLPTLTGDMSIFNSETNQLQIQIEDFVMSSFLPASEKDDRRFYLQ
FT                   NVWGQEMLSGALCAAAERCVAPTESESKIIDTCEKAVHYYLSKLKAAGLLDQWADKNPG
FT                   LRSLMNEIEARVTSIPEQSDLVSMLGEVGEHIDLVLVRTIGESLLNSPSEGLGPITPSP
FT                   MGALISRWHHEGLGFAQLQRHFVSAAKQISHQHANLRILQVGPSSPGLVRSVCQELGRS
FT                   LERYTLVDDSEQTIEEMKSALAADQLRVDFTTASVENGIDAVNHLTSAGGFDLVIVHKA
FT                   FTKQVTALKTVRNLLRPGGFMLMMAATGAQLRFPFMLMSTLPSLDDERLAQTKFINATR
FT                   AETHDLLRQIGFSGVDSIALDNVPDKHTFSVVVSQALDDHIAFLRSPLTSPSPVPLSGN
FT                   LLVVGGFSADIAKLATAIQSLVSTVWHGDIINVRTLAELDDEASTVEAVLSLTDLDRPV
FT                   LEDVRAPTFRGLQRLFSEAKTVLWITHRAKADNPYHNATIGLGRSFQSENPQKVLQFLD
FT                   VDTLDGVESAIAETFLKLIGGVNMRNSNPADPTRLWTIEPEVSLENGKYLVPRLFPDTE
FT                   RNDRLNALRRKVQTQVSVETQPISLSRSAQSDQVAYTAEAVHFHRDLADGATDPVTIQV
FT                   ELCSTEPVIPNIDNEDLFCFVGRTSEGARLVGLSTSNSSVVKVPREWTIPVDKHTSHDQ
FT                   GAFVLELRNEIQSLVIAKSIPPGSTTLIYEPDPHLAASLQRPGRPATSSVSFRARSTWS
FT                   IPGSHILIDPHASRKDIQAKVPPKTRMLIHMEQGPETCEFLALRQALPPYATVVAFNDL
FT                   AADDVNPRELLAEALSIIRGDSQSTKVPFDPSSVVKASALVAGGTREHANAAVVDWTGA
FT                   QSITLSPRPVDTRNLFSPNKTYLLVGLTGHIGQSICRWMVQGGARHIVVTSRHPEKQGQ
FT                   LWREELLRQGVNIVIEAADVTKEHDLLDLRARIVSSMPPVGGIANGAMVLDDKLFIDMP
FT                   FESFQAAMKPKVQGSIYLEEVFSADNLDFFLFFSSISVMTGQRTQANYVAANNFMVAMA
FT                   ERRRARGLPASVIDIGMVVGIGVIQRSQNDKGVSAMENSIRQMDYMPVSETDLHHLLAE
FT                   AILVGQRDESPELITGLETYKPVEGEAPFWHHNVRFSHLITDPDAAQAGADSAGSAQKS
FT                   LKEMLLSSGGPEEARKVMENALLQYLASSLKLSRETIYTDVPIIDLGIDSLVAVQIRNW
FT                   TWAEAGYDLPVLKILGGSSVTQICDEVVASLSFDKSSIAAAKVDSQAAPAHKLRPWDKP
FT                   SADTKRTDSIAPVPRSQIAANGPNGLPNGALKKASKLAVKVRPLWTTQAGGKDTKKGPR
FT                   PAPIRIQPLSLGQSRLYFLSQYMDDDRVLNCTISYALSGKLDVSKLEQSLIQVVQRHEA
FT                   LRTSFYTDEKDGKPMQGLLEKSPFRLRVVPGVSASSDVETEFNLIRYRPYDLEQADTFA
FT                   ATLLSHSPDSHTLICGYHHIIMDGVSWQIFQKDLAMFYNNSGIADSAKHLPAQYSEFTR
FT                   KQQEDLSCGAYAERLRFFQDQFREPVESLPLFPFAKVGTRKVVKQYAVQEATTHLNAKV
FT                   VSAIKQASQTSRTTPFHFYLSAFQVLLHRLLETDKMCIGVVDANRSDQNFVNTIGFFLE
FT                   TIPLWFKVNSEQRFVELLKETRTKAYAALAQTGVPTEEILRACGVASSTTETPLFQVCF
FT                   NYRMGAGRTAALQGVEMKFLDYVDAQNPFDLVATVDDLDDGTAMITLYLQDYLYDQEGA
FT                   QLLATMYANVLQVLAENPERLVGSVSISNATLEDEGVKLGTGPILDLVAPSTPTLSKIF
FT                   HTWVDKDPHALAVKDTTGKSKTYVQLAERANAIAASLLNAGAAPSIPIGVLLDPGVDTI
FT                   ATILAILRIGAAYVPLDTRSSDAVLSDILQESQPGIVIHHSATAPRSQILLKASAKTKL
FT                   VTLNAVPQKTIRKIQDVSVPEGLAMILYTSGSTGSPKGIPLTNANIRTPILGVSERVPL
FT                   GREVVLQQSGQGFDAAVYQIFIALANGGTLIMVDNRDDPAKVAALMAQESVTCTTHIVS
FT                   EMQALLKYGYDELRNCSSWRIAMVAGEAFTVHLLDQFRALNRPDLKVINAYGPTEASIC
FT                   SSLGEVSFNRISSSETSIPIGKAIPNYGTYIVDQHCKPVPLGWPGEVAIAGPGVASGYL
FT                   NLGELTQAKFRSAATLGEVFGSDCLYLTGDRGRMLSDGSIVLSGRVDGDDQVKIRGHRV
FT                   QLGDVARALVQASRGVFADAAVILKGDDTSNPQLVAYVVFSRTSNIQDQQTYLRQLNQD
FT                   LPVPAYMRPAITIPLDTLPVTDRGKLDSKKLASLPLPSISVDYEEDEQLTPTEARLRDV
FT                   WKNVLGDIASSIPIRRSSDFFSVGGNSLILLALKAEIAQVFGVGLSVSELFQASTLELL
FT                   AARLDGTSLLAQINWEEETAPDETQFTLPPPINGINGHGSSNGHAQGISVLLTGATGFL
FT                   GGHILRQLVQLPSVEHVHCVAIRPNKVDVRRQLSVESPKIIRYSGDLALPNMGMSESEF
FT                   SDLFKSIDVIVHNGAEVSHMKNYRSLRAANFLSTVGLARAAVSRGIPIHYISTGGVARL
FT                   SVADEQPEASLAAFHPPIDGSDGYVASKWASEVFLEKVQRRFQGQVWIHRPSSITGDDV
FT                   PDNDIAHSLLKFSRELGAVPELTGSGFFDFINVETVSNNIAASVVRSSEKSGGGLIYLH
FT                   QSGEQVIPVGDLQKYVEELEGRPLQVLPLKEWVDLSIRKGLDEVLGSYMLASKGVIRAP
FT                   LLQRGPHVE"
FT   CDS_pept        join(complement(130259..130427),complement(129558..130204))
FT                   /codon_start=1
FT                   /gene_family="HOG000162244" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261234"
FT                   /orf_name="AFUA_8G00550"
FT                   /product="Methyltransferase SirN-like, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL85112.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG057577"
FT                   /db_xref="UniParc:UPI000051E83F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB00"
FT                   /transl_table=1
FT                   /translation="MDNFMEMTKKLGHQPELLRLRALDATYDDALEGKLVVAPLDMSEP
FT                   GKKILDSGTADGTWLRNVRSKQSVPHDYYGSDVEGELFPKDPDGITYFAHSFKDPWPQQ
FT                   YLGFFDLVHIRGSLAGSAPEGPAPVIQNLTTLLKPGGWVQLMEMNAFSPPPNGPAMTDF
FT                   AKMASEMFTGIGVGDFANNNKSMLEDAGLKNVQEKRVIVNLGKKAKPELHDQSIHGVTG
FT                   PIVPLTSVARTVKSSFTGEQLDALPARVKEELETEGGQVEMIIAFGQKA"
FT   CDS_pept        join(130966..130991,131062..131402,131464..132268,
FT                   132330..132714)
FT                   /codon_start=1
FT                   /gene_family="HOG000162233" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902318"
FT                   /orf_name="AFUA_8G00560"
FT                   /product="Cytochrome P450 oxidoreductase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85111.2"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057576"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000F51AD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB01"
FT                   /transl_table=1
FT                   /translation="MIISSYHLLAPRCRRDQKVYNKSIHVLNTVAKGIKGWPFLGSAPA
FT                   LAAVDTNGIIGIFKSWAEQYGSITQFSAMGDKQVILTEDKDARELFVRRGIKYSDRGAP
FT                   HAVEYISMKQNPGFRPKDDGWRRQRSMIQSAINITSINKYQSLMDDEATFTVNALLQSP
FT                   DSFHGEFLRYSYSVLTSSLLGFSVRSPSDPFIHHNETFTAELMNSFRPDCFPSNVFPVL
FT                   RKLPMWLLPSLRTMERLRKEYVGEMWAFRRKIEKLVKEGSATECIYKHFLLHRDQYNVT
FT                   EEESVHTFQAMIDGGTRSPHNNLLTFLFLMMEFPEWQKKLQEEVDRVVGRDRMPSYRDI
FT                   PNLPTVRAIVKETVRYRSIVAEMGIGHCLQTDDIYKGYFFEKGTVFNAIFASILMDKDT
FT                   YPDGKLFNPARWLEPSYPTYKEPLTTYPNCQGFPAFGYGRRACPGVDFAERTLVIMFAK
FT                   LGWTMNIRWPRDEDGNELREELQYEPVPAPRPLKFGCRLEARDADRAKIVEEAAKHLKL
FT                   Q"
FT   CDS_pept        join(complement(133653..134016),complement(132803..133596))
FT                   /codon_start=1
FT                   /gene_family="HOG000162222" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902319"
FT                   /orf_name="AFUA_8G00570"
FT                   /product="Alpha/beta hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85110.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG057574"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="UniParc:UPI000052047B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB02"
FT                   /transl_table=1
FT                   /translation="MDLGLALVITLLSAPLSVYLYRQIRASLEDIQHTPEELTFTPARS
FT                   GPAAPGAQTFPKPVYPIDAFPGSRQFKTVYGTIHVFEWGPEDGEKVLLVHGLGTPCIAL
FT                   GDMAKELVRRGYRVMMYDLFGRGYSDAPNDLVFDARLYTTQVLLVLASSPLSWTGASAF
FT                   HMIGFSLGGSIAVAFAAYHATMLRSVTLVCPGGLIRTSHMKPLDKMLYSSARVIPEWLR
FT                   LRLFRESLEPRNGAACADVPGEMEDEDDVAFDDVPIAQDRPQVTVGDVIRWQLAANAGF
FT                   VRSYLSTLRSALVYRRHDRTWRVLADELARRRVADALPGLPGGKVCLIVAERDVIVVGD
FT                   ECASDAAEILGAEAVETHVLGGGHEIAISRARDVISIAVRFWNRR"
FT   CDS_pept        join(complement(135634..135663),complement(135395..135575),
FT                   complement(134841..135343))
FT                   /codon_start=1
FT                   /gene_family="HOG000162211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055624"
FT                   /orf_name="AFUA_8G00580"
FT                   /product="Glutathione S-transferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL85109.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057573"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051F8EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB03"
FT                   /transl_table=1
FT                   /translation="MVFGTLYTFPGDQCRTIAIKAVAKANGLDLDIRETPRTPDHLSIS
FT                   KLGKVPAFQGADSFKLFECMAIALYITSQNEQTTLLGKDKKEYAEIIKWMSFFNTEIVI
FT                   LMTQQLLPQLGVIPYDRDQVEFFANMTQRSVDVVEEYLQDRTFLVGDQLSLADLFCAGN
FT                   ISLGFQFFYGKAWRQQNPNVSRWYEMVCHQPIYAAVTDKFQLLDEPKLTNNPPEKKPET
FT                   VPKNGAAVAIEATQA"
FT   CDS_pept        137689..139371
FT                   /codon_start=1
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261235"
FT                   /orf_name="AFUA_8G00590"
FT                   /product="Fatty acid desaturase, putative "
FT                   /EC_number="1.14.99.-"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with oxidation of a pair of donors resulting in the
FT                   reduction of molecular oxygen to two molecules of water "
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85108.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016717"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057572"
FT                   /db_xref="HOGENOM:HBG325617"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniParc:UPI000051F41F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB04"
FT                   /transl_table=1
FT                   /translation="MAPAMLNKNRVWTRGEIEGLIAEDHKIIILGDQVLKVDAWLPYHP
FT                   GGIKSILHMVGRDATDEITALHSKEAQAHMQKYVIGRIHGKWENFLPPIQGGTFRMLTS
FT                   KDVDDEAPSAEEDVSSSGQSTPPSTIFDSDETGDQVHLRRVGIDTPMSRDSSLSPTEPE
FT                   LSRYKSAEASAAHAISSDLSKYPRLDKKSQDEVASKYRQLDERLQSEGLYDCPYSSYAV
FT                   ESIRYLVLFVLFVTCLHYSYYALSGLFLGLLWHLLAFTVHDAGHLSITHGFHTDSCIGI
FT                   FIADFLGGLSVGWWKRNHNVHHIVTNSPEHDPDIQHMPFFAISSRFFGSLRSTYYDRDM
FT                   KFDTAARFFIKYQHYLYYPILLFGRFNLYRLAWAYLLDPAQAPRKGAAWWHRYLEMTGQ
FT                   VFFWYWYGFRTVYLSIPTWSSRIVFVLISHMVTAPLHVQLTLSHFAMSSADLGVDESFA
FT                   QKMVRTTMDVDCPPWLDFLHGGLNFQVVHHLFPRLPRHNLRRAQPYVKEFCRDVGIPYV
FT                   IFGFTRGNKEVISRLGEVADQLRVLEECRKVAAKDLIGGRHGR"
FT   CDS_pept        join(140560..140723,140755..140897,140948..141099)
FT                   /codon_start=1
FT                   /gene_family="HOG000253043" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261236"
FT                   /orf_name="AFUA_8G00595"
FT                   /product="Ham1 family pyrophosphatase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EBA27219.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="UniParc:UPI0000F51ACF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA51"
FT                   /transl_table=1
FT                   /translation="MPLTYKNTIPCAMIKAEQMKGPVLTEDSALEFLAINGLPGPYVYV
FT                   TETLGLYAVQEFYSALEITDCVSFWLCAFSSRPGVEPVLFQGRVDSQTVTPRGSNGFAF
FT                   DPIFEVQGRIRRDAQTKACQARSKNKVIYRWTTRISCQNCSARAQALS"
FT   CDS_pept        join(141640..141670,141719..142944)
FT                   /codon_start=1
FT                   /gene_family="HOG000216741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750320"
FT                   /orf_name="AFUA_8G00600"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="EAL85107.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG057571"
FT                   /db_xref="HOGENOM:HBG325615"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51AEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB05"
FT                   /transl_table=1
FT                   /translation="MPSAIVTGATGINGSAIVRHLCKDPHYQKIYSLSRRNPGGGNAKI
FT                   QHATLDLRGSAEDMARNLKDISAEYVFFCAYLAHDDPAELSRVNGLMLSNFIQALEITG
FT                   AIRTVKRFVLTCGLKQYGVHLGNCKQPLIEDDPLLEGNQGGTTWPPNFYYEQQRILKEA
FT                   AARGKWEWIVTLPQDVLGYARGNFMNEATALGLYCAVSKALPGSELPFPGCKANYFAFN
FT                   CWTSANLHAKFCLWAATAPNAGNNIFNVMDGDTESFQNLWPRLAARFGCKIPNPMFPHG
FT                   GTPDTQGFREYEATTVRMPNRHPLAVHADRIGVSADDTPTLFLQVDPEKWAKRKDVNEA
FT                   WAKLRDKYNLDQCGWDTATWDFLTFALGRDWSCVATMSKARRLGWNGYADTWEELEDTF
FT                   RVLETEGILPPVDKLRGDF"
FT   CDS_pept        join(complement(144208..144322),complement(143824..144147),
FT                   complement(143728..143775),complement(143505..143677),
FT                   complement(143172..143450))
FT                   /codon_start=1
FT                   /gene_family="HOG000217327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261237"
FT                   /orf_name="AFUA_8G00610"
FT                   /product="Cell surface protein Mas1, putative "
FT                   /protein_id="EAL85106.2"
FT                   /db_xref="HOGENOM:HBG057570"
FT                   /db_xref="InterPro:IPR021476"
FT                   /db_xref="UniParc:UPI0000F51AF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB06"
FT                   /transl_table=1
FT                   /translation="MLIKDILTVTALLASQVSAHGLVTRIKGANGVDMPGLTIIDGVPR
FT                   DCPSAACGGQKDTAIIRDQEMGGIKASPLGRTMGAGPVYAATVINKFMGAATEKRGRAS
FT                   PSERRMRLPSHCSINWANMFSGRQLINDAASVITNAGGTILNGVQDIADKTPLGGTIKS
FT                   AQSAVDDALSIVPGLKSGAMTPQGTKENGIQLYSGKGSRTGLPTASPDGVVTVIYHQVN
FT                   QDGAGPLTADIDPSSGGTNAKAFVSAKVIQNIPGVAGFSTSSTMDYEVKVQVPNGMKCT
FT                   GTVGAAKNVCILRVRNTAISGPFGGSAAFTM"
FT   CDS_pept        join(147860..149073,149140..149248)
FT                   /codon_start=1
FT                   /gene_family="HOG000200278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261238"
FT                   /orf_name="AFUA_8G00620"
FT                   /product="Dimethylallyl tryptophan synthase, putative "
FT                   /EC_number="2.5.1.-"
FT                   /function="tryptophan dimethylallyltransferase activity "
FT                   /biological_process="alkaloid metabolic process "
FT                   /protein_id="EAL85105.2"
FT                   /db_xref="GO:0009820"
FT                   /db_xref="GO:0050364"
FT                   /db_xref="HOGENOM:HBG057569"
FT                   /db_xref="InterPro:IPR012148"
FT                   /db_xref="InterPro:IPR017795"
FT                   /db_xref="UniParc:UPI0000F51AE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB07"
FT                   /transl_table=1
FT                   /translation="MDGEMTASPPDISACDTSAVDEQTGQSGQSQAPIPKDIAYHTLTK
FT                   ALLFPDIDQYQHWHHVAPMLAKMLVDGKYSIHQQYEYLCLFAQLVAPVLGPYPSPGRDV
FT                   YRCTLGGNMTVELSQNFQRSGSTTRIAFEPVRYQASVGHDRFNRTSVNAFFSQLQLLVK
FT                   SVNIELHHLLSEHLTLTAKDERNLNEEQLTKYLTNFQVKTQYVVALDLRKTGIVAKEYF
FT                   FPGIKCAATGQTGSNACFGAIRAVDKDGHLDSLCQLIEAHFQQSKIDAAFLCCDLVDPA
FT                   HTRFKVYIADPLVTLARAEEHWTLGGRLTDEDTAVGLEIIRGLWSELGIIQGPLEPSAM
FT                   MEKGLLPIMLNYEMKAGQRLPKPKLYMPLTGIPETKIARIMTAFFQRHDMPEQAEVFME
FT                   NLQAYYEGKNLEEATRYQAWLSFAYTKEKGPYLSIYYFWPE"
FT   CDS_pept        complement(150256..151299)
FT                   /codon_start=1
FT                   /gene_family="HOG000169997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261239"
FT                   /orf_name="AFUA_8G00630"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85104.1"
FT                   /db_xref="HOGENOM:HBG057568"
FT                   /db_xref="HOGENOM:HBG325612"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI0000520941"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB08"
FT                   /transl_table=1
FT                   /translation="MKLHHFLLPVALTATAGAQTLNIVAHEDDDLLFLSPKLLDEIRSG
FT                   RRVRTIFVTAGDAGNGADYWISRQEGSKAAYAQMSGDENAWTQSDAGIPGFNIPLFTLN
FT                   NDPNISLVFLQLPDGNNGGEGFGSGSLQQLWQGTIPELTSWGGSSYSRDDLVNVLRNLA
FT                   DDFGYDHINTQDFVHDYGDGDHSDHHTTAYFVHEAFADCASSASITGYMGYPVVSQPAN
FT                   VDGELLQEKKAVFYNYASHDRNTCSSDEACRGRDEALWIEREYIVSEIDQSPCRKAASK
FT                   APASTTSKASVSTTSKASVSTTSKASVPTASKGSASPAIKGSVSTAVTPSASPTRPHKV
FT                   ISRPLQA"
FT   CDS_pept        153240..154358
FT                   /codon_start=1
FT                   /gene_family="HOG000201536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902320"
FT                   /orf_name="AFUA_8G00640"
FT                   /product="Glycosyl transferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL85103.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057567"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000051F1A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB09"
FT                   /transl_table=1
FT                   /translation="MIYSRPCSSYTFLVAAAIFAVVILWREYAWKFKSQLLLNCSAPPT
FT                   SINVTGSAIPNQVHYVYILRDVDADFAFQFKHFLSLYSVLQHWHPDTIYLHTNANPKTI
FT                   ENARAGKTGKWNQLIFNTPNLRINHVEPPTVAGNGKPIDQIEHKSDFVRVSTVCEFGGI
FT                   YLDWDAHPVRDIKALRESGFNSITGRQANGEIMSGTFMAKKDALLLQMWKAEMHKVYDG
FT                   GWTTHSNSVVTRLGQRLARLPGEVLIMEQDAFGPGSWTTPENIVLYGIHNETVSNLENA
FT                   TDCRSLPSYDEGVTDRWDRPQDFPSWERDYSHTYILHAFSPARNGNPVKDFKHITPKYV
FT                   LERQSNFARLLYPVTRDMCRAGFVEVNDSYAG"
FT   CDS_pept        join(155917..156108,156167..156310,156364..156434,
FT                   156504..157260)
FT                   /codon_start=1
FT                   /gene_family="HOG000168842" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18206922"
FT                   /orf_name="AFUA_8G00650"
FT                   /product="LPS glycosyltransferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL85102.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057566"
FT                   /db_xref="HOGENOM:HBG324005"
FT                   /db_xref="UniParc:UPI000051F67B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB10"
FT                   /transl_table=1
FT                   /translation="MILTAPHRRLHITKILPVVLVFYASVYLLWPVIQTSYRDTNWSFI
FT                   SRDVLSDDKLSHTQNETLGFEHIYAIGLKERTDKRDFLTLASLAAGFKVDWIDGVRPDE
FT                   LDPRSLPNGLNLTDLKPTAVACWRAHMNALRMVLQNSYTTALILEDDADWDVALKMQLR
FT                   EFARGVRLLNGEENAPKTAPYGTDWDILWIGGCASGPGANETTFFAIPDDPTVPSPDKR
FT                   DGWGGPLETWKQQYPNLPIGTTRFLYRAEMGCCTYGYAVTREGAKKILAALSVDRLDCA
FT                   VDNAMSDLCAGTNGRRQLKCFATFPNLIGTYRHAGPASRDSDINGGDDASWHEAQAWNM
FT                   VYSTRLNIHQLVAGERKVYSQHENEKSGAITELDLAEIHYPRGVLVG"
FT   CDS_pept        join(complement(158175..158702),complement(157908..158098),
FT                   complement(157702..157822))
FT                   /codon_start=1
FT                   /gene_family="HOG000168831" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261240"
FT                   /orf_name="AFUA_8G00660"
FT                   /product="Solute transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85101.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057565"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000051EF2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB11"
FT                   /transl_table=1
FT                   /translation="MASRPWCGVFTAKGVPVYQTLHLAVLMCLQVILQNLSLAYSSVIF
FT                   HQLVRLLLTPLTALLNYLLYRSRIPTASIIPLIMLCAGVGTMSYYDTLPRTDGKITASS
FT                   KGAVFAFTGVVASALYTAFVGRYHRKFEISSVQLLLNQAPLSAAMLLCVVPFAETLPAT
FT                   AGLSTSLYVSIMASGILACLVNLSQFIIIDSVGPVSSTVIGHLKTCIIVGLGWALSDRP
FT                   ISRGCLVGILMALTGMTFAWQPLKSCDSCANCSNAAVDMPDETVATYEVVTLLECLS"
FT   CDS_pept        join(159755..159884,159996..160213,160263..160670,
FT                   160719..160967)
FT                   /codon_start=1
FT                   /gene_family="HOG000170162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750321"
FT                   /orf_name="AFUA_8G00670"
FT                   /product="Integral membrane protein "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85100.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057563"
FT                   /db_xref="HOGENOM:HBG610285"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI0000F51AD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB12"
FT                   /transl_table=1
FT                   /translation="MAVHDLYGDNKSNWQLVLDVLSWIFWSNATILLNKWIINSTDFPI
FT                   ILTCWHSVFATIVTQVLARTTRLLDGRRSMPMDARMYCRTILPIALLYCGTLVCSNVVY
FT                   LYLNISFIQMLKAAGPVVTLITSWSWKVAKPSIGAFINILIITLSVAMAVSGEIRFSWL
FT                   GFGFQFASLVFDANRLVMVQILLSDSGQKMDPLVSLYYFAPACAVMTSLVAWQTEYASF
FT                   EWSSVAQAGWTVLSLSAVMGFMLNVSIFLLIGKTSGLAMTLISIPKNILLIAISVVLWH
FT                   TPISLLQILGYSIALWSLLFYSIGWKTVKAYIDALGVWSRKSDENEVLLSDRV"
FT   CDS_pept        join(complement(163007..163220),complement(161835..162944),
FT                   complement(161238..161779))
FT                   /codon_start=1
FT                   /gene_family="HOG000170141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261241"
FT                   /orf_name="AFUA_8G00680"
FT                   /product="Glycosyl transferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL85099.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057562"
FT                   /db_xref="HOGENOM:HBG325608"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000051E837"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB13"
FT                   /transl_table=1
FT                   /translation="MLSKHEYDIRELPPDDRIRFSVKYRNALYVVSKAAIWAFYFYFLM
FT                   RLLLVITAPEQTWQIWLMLLVEYIFARMPWNDQLLTVAAGRSLQSRPRDRLRLHGSDHL
FT                   PRVDVLVPCCGEPTDVVLDTVRAACTMDYPVTHFRVLLLDDGASPALRDAVAGLRSQWP
FT                   HLSYHTRGQHSGRVFAKAGNLNYALFSLQNEVQPEFCAVLDADCMPTPDFLRATLPHLL
FT                   KDPQAALLTTRQYYYNLPDGDPLQQSRVHFYTCHNSELDRMGAAIDAGSGAVFRRKAIV
FT                   DVGGYPTFSFSEDWQLSLMLQGLGYRTMQVLEPLQLGLVPSSLEGHIAQRNRWQIGHSQ
FT                   QPSVLFSSNHGIPRPLQWSIAFNGLSIVMGLVGYMVGFAAVPVLCASGRLIPAASPLLV
FT                   QIQVLLAVLHIALTWLHGLIQSAHAGFRIGPFAHLENSWLASTHIFAIIRFHCVSSKPK
FT                   GSFVTGSSANSWNRLTELPIYKKLRKDLLDNGLVYSLFLYVATLGTFLLAFYAAVSSNY
FT                   APGATPTHNRLITELLTTVAWPPMLHIGYLTVSNLWVPVGYLLRRPEYPERRSMMAVSD
FT                   RGIFFPQADVQMKLLHQSRPPLGSYKHYVLVPFVLVAILVAATVL"
FT   CDS_pept        join(complement(164689..164798),complement(164519..164597))
FT                   /codon_start=1
FT                   /gene_family="HOG000048597" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261242"
FT                   /orf_name="AFUA_8G00690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85098.1"
FT                   /db_xref="HOGENOM:HBG057561"
FT                   /db_xref="UniParc:UPI000051F1A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB14"
FT                   /transl_table=1
FT                   /translation="MREDPGHKERQKVNKISKNGKKRKDRFVKNLEGERTVTITRHTSE
FT                   QHPWMLHLRCLHAMVTS"
FT   CDS_pept        164811..165815
FT                   /codon_start=1
FT                   /gene_family="HOG000217328" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902321"
FT                   /orf_name="AFUA_8G00700"
FT                   /product="Class III chitinase ChiA2 "
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85097.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG057560"
FT                   /db_xref="HOGENOM:HBG588556"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000520472"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB15"
FT                   /transl_table=1
FT                   /translation="MYFTTLLSALSLMAAAASALPHQLSSRASGAQNVVYWGQNGGGTV
FT                   ENNDLASYCTSTSGIDIIVLSFLYQYGNGNTIASGTIGQSCYISPSGQPQNCDALASAI
FT                   KTCQSRGVKVILSLGGAVGAYSLSSQAEAETIGQNLWEAYGNTQGNGNVPRPFGSTFVN
FT                   GWDFDIESYSGNEYYQYLINKLRSNFASDPSNQYYITGAPQCPIPEPNMQVIVTKAQFD
FT                   YLWVQFYNNPGCSVNGPINYDQWVSNLANTPSANAKIFIGVPASPLGATGTSSGAQYYL
FT                   QPSALASLVAEYKDNPAFGGVMMWSAGFSDANVNNGCTYAQEAKRILTTGSPC"
FT   CDS_pept        166798..167103
FT                   /codon_start=1
FT                   /gene_family="HOG000170130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902322"
FT                   /orf_name="AFUA_8G00710"
FT                   /product="Secreted antimicrobial peptide, putative "
FT                   /biological_process="defense response"
FT                   /biological_process="negative regulation of growth "
FT                   /protein_id="EAL85096.2"
FT                   /db_xref="GO:0006952"
FT                   /db_xref="GO:0045926"
FT                   /db_xref="HOGENOM:HBG057559"
FT                   /db_xref="InterPro:IPR015201"
FT                   /db_xref="InterPro:IPR015791"
FT                   /db_xref="UniParc:UPI0000F51AD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB16"
FT                   /transl_table=1
FT                   /translation="MKFLAIATLLASASATIVYPYTSASCSGSTVGKITSCGCTNMSGN
FT                   YKIKGAKLDFQKATASFYKGRNCEGVRISKASDQSCVKLPVGWESFGSVRIHGGTC"
FT   CDS_pept        join(complement(168976..169081),complement(168781..168853),
FT                   complement(168395..168726),complement(168200..168343),
FT                   complement(167733..168145),complement(167657..167684),
FT                   complement(167482..167597),complement(167346..167432))
FT                   /codon_start=1
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055625"
FT                   /orf_name="AFUA_8G00720"
FT                   /product="Amino acid transporter, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85095.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057558"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI0000F51AEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB17"
FT                   /transl_table=1
FT                   /translation="MMLWLKRRNMLMGRRQMTRLEMKNAERSNIVSCRGVMVAENISLG
FT                   ILSLSSAVATLGIVPAVILLLGLSAISWYTGYIMGQFKLRFPQIHSMGDAGELLMGRFG
FT                   RELFGIGQLLFLIFLMASHILTFSVVFNTITNHGTCTIVFGVVGLVVSFIGALPRTMGK
FT                   VYWMSMASCISIVTATVVTMIAIGVQAPDHVHVNVTTKVSFQDAFLAVTNIIFAYIAHV
FT                   AFFGFISEMHDPRDFPKSLTMLQVVDTSLYIVTAMVIYRYAGPDVASPALSSAGPLMKK
FT                   VAYGLAIPTVVIAGVVFGHVACKYIYVRIFRGSAHMHQNSFLAIGSWVAIALGVWVVAW
FT                   VIAESIPVFNELLSLISSLFGSWFSYGLPAIFWLVMNKGRWFSTRSKICLTIVNFFILA
FT                   FACALCGMGLYVSGKSIHDSSSKASWTCKNNAT"
FT   CDS_pept        join(171081..171205,171271..172954)
FT                   /codon_start=1
FT                   /gene_family="HOG000215243" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055626"
FT                   /orf_name="AFUA_8G00730"
FT                   /product="Transcription regulator (RTG2), putative "
FT                   /protein_id="EAL85094.1"
FT                   /db_xref="HOGENOM:HBG057557"
FT                   /db_xref="HOGENOM:HBG325605"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniParc:UPI000051E5CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB18"
FT                   /transl_table=1
FT                   /translation="MGGGDRFPDRPSVSQPLLLPDSTLIQPSAKRRHLQAVVDLGSNGI
FT                   RCSVSDLSSPTARILPTVYMRRVNISVYDAQFDDDSGCQIPIPKHVIKSVVGAIVRFQI
FT                   TCAQIGVPPENIRIIATEATRTALNANEFVDAIRRATNVSVETLPKEVEGIIGAWGIAS
FT                   SFSDIEGLAIDLGGGSMQMTWIVSHAGNVHISPKGSFSFPYGAAALTHKLNQLRKGKSP
FT                   DEAHRAEEAFRREMESNFRMALEQLEIPDRLVEKARTEGGFPLYLSGGGFRGWGYLLLY
FT                   LHQVRGQYYPISIINGYSAPKEDFENTEVLKKVARTARDIFRVSDRRREQVPSVAFLVN
FT                   VLAKAVPYGIKEAHFCQGGVREGLLFREIPPFVRQQDPLEVATTAFARPSAQVIAFLMF
FT                   GAIPARTEERTFPPSIRGTLIQAFANSLFVHAAMSKESSSTAALYSTSAGLLASTHGIP
FT                   HSDRARLALMLQERYGGELPPREKDFKSRLRELLTPEEVWWIRYLGKLGLVLARLYPIG
FT                   IIDPARPRITTEARWASNLGKHGNKTGIELKVFVQKVAYDPTQLKSELERDVRKIHKVG
FT                   KRKNWIGGRDGWGMKVKAVVAEEAML"
FT   CDS_pept        174026..175519
FT                   /codon_start=1
FT                   /gene_family="HOG000170118" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750322"
FT                   /orf_name="AFUA_8G00740"
FT                   /product="Cytochrome P450, putative "
FT                   /EC_number="1.14.99.4"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="progesterone monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85093.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0050214"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057556"
FT                   /db_xref="HOGENOM:HBG325603"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000520471"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB19"
FT                   /transl_table=1
FT                   /translation="MELVAPTLLAIVLVCCCLHLLRSQASRLPLPPGPTLLSRPFPEKD
FT                   IATTFQKWNQRYGPVISFRVGSRTFVVLGTRQAAQDLLEKRGSIYSSRPPSVWMEKYLN
FT                   KGLAAAFMPYGHEWRLNRRLHGSLLSAHHTNAYRSLQDIQSKQLLHDFLSTNDFSHCFH
FT                   QYTSNVMFTLVYGKGRGKDDNDHRRLEQINELAGFVLQGASFWTFLMDLFPILDYVPRI
FT                   FWKWRTEAARLHDRTMVVYRECCEEALTAECWHWSKEVTQKPDIMQLPWDNVCYSLGEL
FT                   YVAGIHTTKMVLELCVMVSILYPDVVCKAQQELDSMVGADRLPSFDDMERLPFINAIIS
FT                   ELLRWRPISPIAVPHAAIQDDEYMGYFIPKGATVIANQFGMNMDDAFFYDPSSFHPERY
FT                   VENPDLPVSAFGFGRRACPGHRLARSSLFIVISRLLWAFHITSANKEPLTEESSPAAVK
FT                   ATFRVRSPHRQKIIERDWALAEKDERIVLSQIESRIRGK"
FT   CDS_pept        join(175941..177009,177073..177320,177367..177450,
FT                   177500..177821,177886..178310)
FT                   /codon_start=1
FT                   /gene_family="HOG000217329" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16261243"
FT                   /orf_name="AFUA_8G00750"
FT                   /product="C2H2 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85092.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057555"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051E5D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB20"
FT                   /transl_table=1
FT                   /translation="MKTSPAYANLATSPHQCSICFKSYKRREHLQRHRNSHSADRPHRC
FT                   PACPSTFQRADVLRRHFRTCDRIISSAYQGATRKRACDRCARQKKACNSARPCQNCSKR
FT                   GVECAYSTPKNDTSAGTEIASPSISLGADSSNAAPAAATSVDLWTPRTGNDERPDSTGF
FT                   DAFACPDLGLLQYCDQSWQDLFNVGSEDLSPTSGDRNYFFHFLDTFTSRTGFVSSFECG
FT                   TLEQRFMVLYSIEEKERLSDAFWTIDMDQCSNQESNNSYGVSSQWLNDPLALQTHQILL
FT                   LIKEVVMIKPRNSCVTISWSQDIEQRCLQFFSPTSLRKYIELYWLIWSPNVNFLHRPSF
FT                   HPASSKPILLASMAIIGACVSPNLEDNDNAWMWFNCVEEAVFADEDFNRDPVSPFSPVR
FT                   DRQKMQALQAAYMVCLYQNWEGTDASKKRIRRHRFSTVVSTVRDLDITTARHVDYNAKH
FT                   RDEFSWNEFRFQVNSPARTFIWVFLMDTAFVTFNNLPPRMVVKEMKMHVAAPESCFQAP
FT                   TADQCYDAIRHWMPSASLCWKFSFRALFETLCIDDLTVKMQQAVAALGPLNLFTIISGI
FT                   HSLVFHYQSFFSAGNLLSRTHTALQNFKHIWHLHETTAIGRLPHTTVDESNLNADNMWQ
FT                   RVGFCRHAGDFWLLASVKVDRLSVAEAEQHRATRGELVPDDSEQSDPILPQYDQTSMRQ
FT                   VNELISEFQRVHLGDMPSAVD"
FT   CDS_pept        join(178807..179022,179050..179099,179142..180372)
FT                   /codon_start=1
FT                   /gene_family="HOG000185376" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902323"
FT                   /orf_name="AFUA_8G00760"
FT                   /product="Cytochrome P450, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85091.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057554"
FT                   /db_xref="HOGENOM:HBG325601"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000520948"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB21"
FT                   /transl_table=1
FT                   /translation="MPTRDAHLQLQKWAQEYGPVYSLILGTKPLIVLSSDQAVKALLDK
FT                   RSALYSHRQEMYIGQTLCSGGLRMLMMCAGSADPRRDTPQSGEEFQFRKMVHGLLNVTA
FT                   AKSYVPYQMLENKQMMYEFLTQPERFLYSIRRYSNALTTTMVFGWRTPTYEDAKMKQLF
FT                   DGFSEFAEINQTGTAALIDFFPWLRMLPDFLLPTQKRAKELHEREKALYLGHYLRAKQD
FT                   IRDGQIKPCFCVGLAEAQKSDGFSDDQAAYISGTLLEAGSDTTSNTLYAFVQAMLLFPD
FT                   VQRKLQEEIDRVVGPRMPTMDDEQDLQYVRACMKETLRWMPTTILGAVPHAVTQDDEYM
FT                   GYLIPKGAGVVNNVWAIHMDEKRHPNPRVFNPDRYKDDRQSLAEAAANPDATKRDQFTF
FT                   GAGRRICPGIHIAERSLFLGISRMMWAFNVEPAVDEKGQPILPDPDRLTQGFVCMPEEF
FT                   PARITPRSQAKADMVIKEWKEAEQQCLDPETKQWLLSPVQ"
FT   CDS_pept        join(complement(182220..182300),complement(181994..182167),
FT                   complement(181736..181928),complement(180566..181680))
FT                   /codon_start=1
FT                   /gene_family="HOG000259757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262232"
FT                   /orf_name="AFUA_8G00770"
FT                   /product="Sugar transporter family protein "
FT                   /function="transporter activity"
FT                   /biological_process="carbohydrate transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85090.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057552"
FT                   /db_xref="HOGENOM:HBG293363"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005206DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB22"
FT                   /transl_table=1
FT                   /translation="MAAGWFYSPSQIGRYILTRFTSLKPPRNKIRNPISVLRELTTHQW
FT                   LMFLVGFLGWTWDSFDFFTVSMTVTEIAKDFDTSVTSVTWGITVTLMLRSVGALISGFF
FT                   SDRYGRKWPFIITLSAFIVLELVSGFCQNLPQFLGVRALYGIAMGGLFGPAAATALEDL
FT                   PYDARGVLSGCFEMGYAVGYLLAAAFYRALVPTTSHGWRSLFWFGAAPPVLIIFFRWML
FT                   PETNHFQVMVAEREERIRLAHAEDDHVRAMGLRSFLKDSGTALKENWVLFIYLVVLMTG
FT                   FNSCSHGSQDFYPTFLKDQVGLQPTQVTVITVVGQAGAFVGANFFGYISTFFGRRLTMM
FT                   VTCVIGGALVPVYILPRDMSLIAAVFWQQFCVGGVWGPIPIHLMEVNPPALRSLLVGLT
FT                   YQLGNLASSASATIQSTIGSRYPLPPIEANKKRFDYGKVIGIFLGAVWAYILFFLFWGP
FT                   EMSAEEREEEAEAAKYLENLRSEGVSLAEIGVVQARKAKGAGMPPRDNDEEKGNEAITE
FT                   HIE"
FT   CDS_pept        complement(184726..187524)
FT                   /codon_start=1
FT                   /gene_family="HOG000170107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262233"
FT                   /orf_name="AFUA_8G00780"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="EAL85089.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG057551"
FT                   /db_xref="HOGENOM:HBG325600"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00005206E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB23"
FT                   /transl_table=1
FT                   /translation="MDLTVLRSMSSRFPWPLSLSSFLSPRKPRPSALVSVSTQTVPNSR
FT                   PPSVKVHTPSPEEELHARREIARSDAEDWLQSLVGQDNIKRRLNEIQTWITICQRQGKD
FT                   PRQEWYNIVLEGNEGTGKSTVARVYANVLFSTGITDVLTFREISGAALAAQGCEGLKHL
FT                   ISDMVDTASPSAQIVGVLLVEDAHLLATSSSTRTQEIFNALFEAMERTTGRVIVVLSGH
FT                   PPHMEGLVRSHPRLERTICCTLHFADFTSNDYLTMLAQSLRERYNGKLEVAGGLDGPFM
FT                   QMAARRLARAAAGNGPRNVHAVQRLLDTITLRQLQSHMTQEEDNLEEVDTFFFSPEDIV
FT                   GLRPADVLAKSRAWADLQKLVGQEAVKASVSELLDTIEENFWREARNQRPFSVRVNRIF
FT                   VGPPGTGKSTVARLYGQVLADVGLLSSGKGELSIFETETAALTTVVVEMRVSQRPDVKD
FT                   LLDSSIGKVLLVDVSDLDESSQIWLKTLISQLSLIPRHDRCVILVGTNSSIEPLVQEKD
FT                   LLKLFRQHHIVQFHSFTKAQLRQILEMKLHDDEVHVTSEALDNAVKLLEVARMRKDFNN
FT                   GRAIAHLLGSAHSAYERSRSQGEGTQSQLARILVPENFEDDLSSCRSKLDFREELKYTL
FT                   VSDDLITLLERYRHDLKAAWLLNTDPTRRVPLAMVFKGAIGIGRRIFARLIGRLYYDMG
FT                   VLDSGKFMECSATDLALNACNPSTPTRSLLERARGGVLFIEDAHRLSEIESAARTINDL
FT                   VYLMPKYSRDTVVILAGSGPEMDLLLCNQPRLSSLFQEEVVFKSPTPRECLRLLDQRLQ
FT                   QEKIPGSRPFLTDTRTETYREFTRAMQTLSLFPCWSNARDIDVLAMWMVSSVLRAVPLD
FT                   GDSLCAPQLTEEQAMACVIKMYNLKRDRLRFNQDPKVKSLPRNLSQPRSSPSIRSAVRF
FT                   PV"
FT   CDS_pept        join(complement(189339..189464),complement(188964..189308))
FT                   /codon_start=1
FT                   /gene_family="HOG000217330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055877"
FT                   /orf_name="AFUA_8G00790"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85088.2"
FT                   /db_xref="HOGENOM:HBG057550"
FT                   /db_xref="UniParc:UPI0000F51AF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB24"
FT                   /transl_table=1
FT                   /translation="MVSAQWHPPHAEDQPYAHLILTTHVFDRGFQAGSVLGVAVGILSV
FT                   ASIITRSTGSAAFLGSCAMTIVLPIRMAGKERIEWQDRAWRLLENKGQVEVDTWSSIGM
FT                   TAGIGMTAVIMRRNALRLEVWKHLVGGAALGNLAGVVGYLGWRYGVNGGHTD"
FT   CDS_pept        join(complement(191744..192163),complement(191516..191696),
FT                   complement(191006..191469),complement(190388..190954))
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055878"
FT                   /orf_name="AFUA_8G00800"
FT                   /product="Amino acid transporter, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85087.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057549"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051EA8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB25"
FT                   /transl_table=1
FT                   /translation="MESPTYEAPSNSNGPPDKKGDIHSTIDVDHDYGADTDLHRSLSTR
FT                   HLTMIALGSSIGMGLWLGSGTSLVNGGPAAIFIGYLLSGTMIWAVSHSIGEMAVVYPLP
FT                   SAFVQWSSIFISEPAGFTLGWSYWFQFFITLANELQGVVTVLNFWTDKVPTAAWISIFW
FT                   VVIILINVWAVKFFGEVEVAASSIKFSWIIIVIISLIVVSAGGAPGEGPIGFRYWNAEP
FT                   FTHGFKGFLSVMPTCIFAMSGSENTALVAAETNNPRKSVPRAVGSIWLRLSLFYILGSL
FT                   MVTITVDPKDPDLFGASGTNASPFVIAYRNAGLAPLAHIMNAVVFISVVSTGSIQVYAG
FT                   SRTLMGLAHLKMAPKFFGKADKVGRPVAGLVLTLVIGGGLAYLNVSNSGAEVFTWFSNL
FT                   TSLLTLFGWGMICLSHLRMRYAWKVQGRSPSELPWKSWTYPVGAIWGLFWCVLLIVVEF
FT                   YLSVWPLDGKPTAKGFFANYVSVVAIIVIYIGSMIYYKGPLLNDARSIDLDQFRRFYVD
FT                   PRDEEAKAEKAGVKKYLAKGIGFVFN"
FT   CDS_pept        complement(192284..192460)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750579"
FT                   /orf_name="AFUA_8G00810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85086.1"
FT                   /db_xref="HOGENOM:HBG057548"
FT                   /db_xref="UniParc:UPI000051ECB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB26"
FT                   /transl_table=1
FT                   /translation="MHAEWQTGEGYLSSLDDNQHASTVRPKGLSQAKPFSHFIGRHGIG
FT                   LYCGGGVCERESL"
FT   CDS_pept        join(193996..194197,194252..194841,194895..195782)
FT                   /codon_start=1
FT                   /gene_family="HOG000217331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262234"
FT                   /orf_name="AFUA_8G00820"
FT                   /product="Rhamnogalacturonase, putative "
FT                   /EC_number="4.2.2.-"
FT                   /function="carbohydrate binding"
FT                   /function="lyase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85085.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG057547"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000051E842"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB27"
FT                   /transl_table=1
FT                   /translation="MRLSSLVSLALAAGVHAKGPFLQKVDDTTYIIGNDLWNVTIGRQY
FT                   GVKLYYKGKDLVGDAVGHYVSYNGAQSDLNWTSAEIYRRGKTNGQDFLDIQFTAKEGDF
FT                   HWVIFEDLVGAYQYFVNHALPTLGEFRTLWRLDNTSFPNGRTNIKDGALPTLAEIASGT
FT                   KVQDETWQLADGSYITKYDWTAWIRDQDYYGVYGEEFGSWYINPGKDYYNGNHLKQELM
FT                   VHRESSTGDAVQLNMIHGTHFMVSSNDVFPDGKVWGPWLWYLNDGSKTDAAARAAAEFK
FT                   AWPYKWFEDEAYQSRGSVSGRLVLSDGRPAAGASVFLGDNHPDKTALDMGTTYYYTGQT
FT                   DDKGWFKFEDVRTGAYGLQAWSNGGQLADVATSFLQNDVTVRKSHTAKLGTLRWEVPSR
FT                   TRIFQVGDFDRKSLGFRYGGAPYEHALVAQCPANLTYTVGQSTTADWCFGQAALGTWSI
FT                   RFQAAKSSAALLTVSLAGYSSGTTSTILLNGDAASPIGNLTTLPNDPCLYRSATTAGEW
FT                   RLFQFEIPQGKLQPGWNSIDFAVGKASRWHGFMWDSIILEYL"
FT   CDS_pept        join(196575..197005,197068..197557)
FT                   /codon_start=1
FT                   /gene_family="HOG000217332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207163"
FT                   /orf_name="AFUA_8G00830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85084.1"
FT                   /db_xref="HOGENOM:HBG057546"
FT                   /db_xref="UniParc:UPI00005206DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB28"
FT                   /transl_table=1
FT                   /translation="MPSFLLLLLAIGVVPVWSFSLDTPTKYWNYTTASLSSTTSPECKA
FT                   AYSAHIDCDDFLLALAVSKEDRWWLQDFDSAVFDRTCTATCQSSLSAYVANVEQTCNKA
FT                   RDAACKTNGPENLGDPVLVPVVTLGHILQYVLMRSCAKDDDGSYCYIGQSNLYYDNGEC
FT                   DWTCALAYFWVCHEYPYDNYQFGIHLPGMEGQRTELIPSSVLLDDSQNSTYGWATVEQC
FT                   GWTTNDSLPLYNPGMSKRVVEEQSTTNTLAASTATSTATSTATSTATTPAASSTVTADS
FT                   GTGSIRMHLDTGMAVWILAFGIVVL"
FT   CDS_pept        join(198936..199493,199617..199816,199871..200451,
FT                   200521..200738)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055879"
FT                   /orf_name="AFUA_8G00840"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85083.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057545"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00005206DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB29"
FT                   /transl_table=1
FT                   /translation="METGTDKGSADAILEHLGYTPELSRNRSVLQVAFMCFILSSVPYG
FT                   LATTFFYPLAAGGPSTIVWGWIIVSLVILCVAISLAEITSVYPTAGGVYYQTFALSPPW
FT                   CRRAAAWICGWAYVLGNITITLAVNFGTTLFFVACLNVFESEPGVGIVDDMQTYQIYLI
FT                   FLAITLLTHAISSLGNKWLPSLEISAIFLTLIGLIALIISVLVVAKHGRHSGKWVFADF
FT                   EPQSGWPAGWSFCIGLLQAAYATSATGMIISMCEEVREPAIQVPKAMVGTIVLNFVAGL
FT                   GFLLPLTFVLPDITMLVNLASGQPTPVILKDALGSSTGAFLLLLPLLILGVICGVGCVT
FT                   AASRCTWAFARDGGIPGSKWWKTVNATLDIPLNAMMLGMTVEIALGAIYFGSTAAFNAF
FT                   SGVGVIFLTLSYACPIAVSFFFRRRSEIANARFNLGIIGSICNVVALAWSLLAIPLFCM
FT                   PTYKVVTLETMNYACVVFVGFTTIAGLWYLVWGYRNYDGPPKEGIDGVEADFPDLPAKS
FT                   G"
FT   CDS_pept        join(complement(202267..202401),complement(201976..202069),
FT                   complement(201653..201925),complement(201454..201595),
FT                   complement(201039..201399))
FT                   /codon_start=1
FT                   /gene_family="HOG000256259" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207164"
FT                   /orf_name="AFUA_8G00850"
FT                   /product="Dihydroorotase, homodimeric type "
FT                   /EC_number="3.5.2.3"
FT                   /function="dihydroorotase activity"
FT                   /biological_process="pyrimidine base biosynthetic process "
FT                   /protein_id="EAL85082.1"
FT                   /db_xref="GO:0004151"
FT                   /db_xref="GO:0019856"
FT                   /db_xref="HOGENOM:HBG057544"
FT                   /db_xref="HOGENOM:HBG628648"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000051FB69"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB30"
FT                   /transl_table=1
FT                   /translation="MILKETTRLELPAAADMHVHLRQGKMMELVVPQIRNGGVDTVFVM
FT                   PADLVPYQSVTPETIREAAAAGITGVKVYPQGVTTNSAAGVRDYDEFFPVFAEMEKHDM
FT                   VLNLHGEVPGSPGSGITDMNAEEKFLPTLTMLNEKFPKLRIILEHCSTEAALEAVRSCS
FT                   STVAATITAHHLYLTHHSCENPLAFCKPLPKTSKDRDALLRAVCSGDPKFFFGSDSAPH
FT                   PRLAKQGGAEGTAKPPAGVFTQPCVVQYVLLALEEGVERGVIANEDITPEKLANFLSGY
FT                   GRRFYKLPEATERIVLERKGEVIPESVKSEDGSVEVALSRGGEKVFSLTWKTS"
FT   CDS_pept        203496..204338
FT                   /codon_start=1
FT                   /gene_family="HOG000250265" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207165"
FT                   /orf_name="AFUA_8G00860"
FT                   /product="UDP-galactose 4-epimerase, putative "
FT                   /EC_number="5.1.3.-"
FT                   /function="coenzyme binding"
FT                   /function="isomerase activity"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="EAL85081.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG057543"
FT                   /db_xref="HOGENOM:HBG418344"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FFF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB31"
FT                   /transl_table=1
FT                   /translation="MKIAITGARGTVGRTTVKVCADAGHATVQVNRTEQPPGAIPNTEM
FT                   RTADVAMNYQQTVEAFRGCDAVIHLAAIPNPVGKDEYAVHNNNVDSAFNGFRAAAEVGI
FT                   KRFCYASSVNAIGLAFSNRPLHFDYFPIDEEAPQHPTDAYALAKREAEIQAQAFAEWFP
FT                   GMKIACLRIHEVSSLERVQKVHANDWENAGVKQLWGWVNPVATARACLLAVEKCDNWEG
FT                   CEVFNIVAPTTTQDLPSEKLARKHYPDAEIRADMSGNQGFWTTDKAKQLMGWEHYETE"
FT   CDS_pept        join(205132..205429,205477..205532)
FT                   /codon_start=1
FT                   /gene_family="HOG000048596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262235"
FT                   /orf_name="AFUA_8G00880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85080.1"
FT                   /db_xref="HOGENOM:HBG057540"
FT                   /db_xref="UniParc:UPI000051EF24"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB32"
FT                   /transl_table=1
FT                   /translation="MICPFGALQVSRSSPDSRIPGFLTDWPIVTSCGMSYSACPAIWAP
FT                   SPDFRWNLAWRCRCQGRTGVVYNVLVHSTDVTSTASPGQRTLTSGTMYRISNIYVLAAF
FT                   GTIGGALFGFDVR"
FT   CDS_pept        join(205733..205907,205962..206488,206553..206843,
FT                   206894..207277)
FT                   /codon_start=1
FT                   /gene_family="HOG000202869" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902584"
FT                   /orf_name="AFUA_8G00890"
FT                   /product="MFS glucose transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85079.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG057539"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051E5DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB33"
FT                   /transl_table=1
FT                   /translation="MSAGSFAGAIAAGFISDRIGRRLSLLVASLVWITGAVIQCSAQNV
FT                   AHLVAGRVISGLSVGITSSQVCVYLAELAPARIRGRIVGIQQWAIEWGILIMYLVSYGC
FT                   SEGVHSPAAFRIAWGVQAVPGLILAVALLFFPESPRWLASKERWEESLDTLALLHGHGD
FT                   RNHPEVQVEWEEVQEAVRIAREAKDVSLFSLLGPRVWKRTMCGVSVQVWQQLLGGNVAM
FT                   YYVVYIFQMANMPGDTVLYSSAIQYVIFLVTTGVILPYIDRIGRRLLLLSGSIICMALH
FT                   YAIAGIMATYGNPVDEIDGNKNLRWEIKGAPGKGVIACSYIFVGIYGLTWAPAAWIYAS
FT                   EVFPLKYRAKGVGLSAAGNWIFNFALAYFVAPAFTNIKWKTYIIFGVFCTVMTFHVFFM
FT                   YPETARRSLEEIDMMFDSKVKAWQSHKVHDKFGEEIEKHRQQSVVEAEKPVESVHAEVV
FT                   "
FT   CDS_pept        join(208415..208593,208650..209007,209057..209362)
FT                   /codon_start=1
FT                   /gene_family="HOG000170063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902585"
FT                   /orf_name="AFUA_8G00900"
FT                   /product="Spherulin 4-like cell surface protein, putative "
FT                   /protein_id="EAL85078.1"
FT                   /db_xref="HOGENOM:HBG057538"
FT                   /db_xref="HOGENOM:HBG325593"
FT                   /db_xref="InterPro:IPR021986"
FT                   /db_xref="UniParc:UPI000051F8E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB34"
FT                   /transl_table=1
FT                   /translation="MFLENYSRFLVGLLGCMALVQQGYSACIPSVSRPSTSKGNIMIPW
FT                   YTYPAGGAWTSMEKLISSNPDVQFTIIINPDNGSGPTALPDENFLAAVPRLTAYSNALV
FT                   IGYVRTDKGTRDISEVKKEIDTYEGWPSASGNPSFAVHGTFLDEAPSEYDAAAVEYFQQ
FT                   LASSIRGSNGLGPNNHVVMNPGTVPDAAYLGIPDTTVIFESPYSEFVRAVSSDQFQGIK
FT                   GQDLSRFASMVYDVPDNVDLENLLSQLRAISSQTYLSNLNTYQAFDSVWTKVVSLLSA"
FT   CDS_pept        join(complement(210039..210522),complement(209753..209988))
FT                   /codon_start=1
FT                   /gene_family="HOG000170074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750580"
FT                   /orf_name="AFUA_8G00910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85077.1"
FT                   /db_xref="HOGENOM:HBG057537"
FT                   /db_xref="HOGENOM:HBG325592"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI000051EA7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB35"
FT                   /transl_table=1
FT                   /translation="MTINSLPRIACFHGGGSSAAIYRIQCEQLAHLLKNDFQLVFFEGP
FT                   FERSAGPDVLPVFADYAPFKSWFTQDERGERANGSGYDASGNDGVERVWRLMEDEGPGG
FT                   EWVGAMGFSQGSRVAGGLLLDQQRRDALGIPKKTPIKLLFGVLCNGAGAPMESDVAEYI
FT                   EKPDESLRRVSLPTLHVHGLKDPFLMLGRQQFQDYYNPNAATLYEVDYHHAMPWARHEA
FT                   KQLADHIRTIYKNNAKQ"
FT   CDS_pept        join(211324..211534,211584..211909,211960..212106,
FT                   212162..213115)
FT                   /codon_start=1
FT                   /gene_family="HOG000153773" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262236"
FT                   /orf_name="AFUA_8G00920"
FT                   /product="UDP-glucose dehydrogenase Ugd1, putative "
FT                   /EC_number="1.1.1.22"
FT                   /function="NAD or NADH binding"
FT                   /function="UDP-glucose 6-dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85076.1"
FT                   /db_xref="GO:0003979"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057536"
FT                   /db_xref="HOGENOM:HBG400967"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR014028"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021157"
FT                   /db_xref="UniParc:UPI000051FFF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB36"
FT                   /transl_table=1
FT                   /translation="MPFFPLLVLLAGITLLISRRRYKAIADRESPRVIVEGHTYSESVG
FT                   EGQSSTREGKIESIRSACIIGAGHVGALTAIVLASQNPQVQIHVVDDDPRLITAWNSDR
FT                   LPVVEPGLDDLVFEDHAVASNIPKKQAGHQLETHQSDLRQPRIRKLRNITFSTNIHAGI
FT                   AASEIIFLCLDPPLDHSCSDDETPGLDLTSLKSAIRAIAQVSSGHKIIVHRSTGPSGIV
FT                   PRIKKMLKKTASPSASFEVLSNPEFLVPGSAIRDLLYPVRIIIGHIFSEDMSPEALTAL
FT                   KGLYSWIPEDRIVTMDAWSSELGKIAASAMLAQQTSSIQSLRAICESTNANITHIEQTV
FT                   GALSTTGYGSSESILLRDVGCLVYLAQELGLPEVAEYWRAVLRMDAYHTRRLAQHITES
FT                   VPAGTERRDVAILGFASKWNTIEIGDRSATRLVQELTRTGVKVDIYDPHVSKEQIERAL
FT                   GLVSGHLDAVTVVEDLHAACSGCGAVVLHTDWDEFKEDRLDWEKVAGKMESPKALCDPH
FT                   GMLDWQRMEKLGFKVLRPGVNCANKLQA"
FT   CDS_pept        join(complement(213910..214008),complement(213492..213863),
FT                   complement(213181..213438))
FT                   /codon_start=1
FT                   /gene_family="HOG000170085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055880"
FT                   /orf_name="AFUA_8G00930"
FT                   /product="Chitosanase, putative"
FT                   /EC_number="3.2.1.132"
FT                   /function="chitosanase activity"
FT                   /protein_id="EAL85075.1"
FT                   /db_xref="GO:0016977"
FT                   /db_xref="HOGENOM:HBG057535"
FT                   /db_xref="HOGENOM:HBG324436"
FT                   /db_xref="InterPro:IPR009939"
FT                   /db_xref="UniParc:UPI000051F1A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB37"
FT                   /transl_table=1
FT                   /translation="MHFLATAAVLAGVGLASAYTVPANLQQIYNKHKTGTCQNKLQDGF
FT                   SDGISGSRSFAYCGDIEGAIFLHSSANGGQYVNMDIDCDGANNSAGDCANDPSGQSMTA
FT                   FMDTVKQYGISDLDANIHPYVVFGNSGSSPTFDPQQYGMEPLSVMAVVCNNQLFYGIWG
FT                   DTNGGTSTGEASISLAKLCFPNDGITGDNGHGEEDVLYIGFMGQDAVPGASAAWTARDT
FT                   KTFEESIKALGDRLVAKLSA"
FT   CDS_pept        join(complement(216655..216948),complement(216524..216600),
FT                   complement(216410..216461),complement(216186..216360),
FT                   complement(216110..216133),complement(215983..216054),
FT                   complement(215422..215925),complement(215208..215368),
FT                   complement(214752..215150))
FT                   /codon_start=1
FT                   /gene_family="HOG000239129" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262237"
FT                   /orf_name="AFUA_8G00940"
FT                   /product="MFS multidrug transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85074.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG057534"
FT                   /db_xref="HOGENOM:HBG330720"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EF2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB38"
FT                   /transl_table=1
FT                   /translation="MRTEVEGEDAPQPGDRNNEASFTQNAQNTPSETSGLSDIKQKPEA
FT                   IPGDNTEELANAIPNDGGEHSDKWIKGIPLFMVTSGITLVIFLMLLDMSILSTAIPQIT
FT                   NQFHSLQDIAWYGSAYTLASSALQPLTGKFYTYFTSKWVFLGFFTVFELGSLICGVATS
FT                   SKMLIVGRAIAGMGSSGMSNGALTIVAGAVPLHKRPFLVGIMMGLSQVGLILGPLIGGA
FT                   FTTYTTWRWCFYINLPIGALVAALLIFTRIPEQREKGRAVDVLPTFFKTFDIFGFVLFA
FT                   PAAIQLLLALEYGGNEYAWDSATVIGLFCGAGATFLVFTAWEHRMGKDAMIPFHVIRNR
FT                   IVSCSCVVIMFLFGMTITASYYLPIYFQAVRDKSALVSGVDLLPGVLCQIVMALVSGAL
FT                   TGRIGYYLPFAVLGGILNSVGCGLLSTLSPTTPTRDWAGYQALIGFGRGAAMQTPMIAV
FT                   QNAVLPDELSPAMAILTFSQTIGAAIFLAAAEVIFSHGLRSTIPKYAPTVDSERVIAAG
FT                   ATGFRRIVSEASLPGVLIAYSKSIGHVFYLIAALSVLQFFLAWGMGWKNVSKPKEDKSK
FT                   GEEEGKVNN"
FT   CDS_pept        join(complement(219091..219200),complement(218454..219041),
FT                   complement(218182..218406),complement(217842..218125),
FT                   complement(217204..217787))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750581"
FT                   /orf_name="AFUA_8G00950"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85073.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057533"
FT                   /db_xref="HOGENOM:HBG326419"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51AF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB39"
FT                   /transl_table=1
FT                   /translation="MNDTASYVPAPYGRACANCARAKCKCIIPETGGICARCCRLNKAC
FT                   QPATRVRRTRRNTSIASKTVQLEQKLDGILALLKTHQSQSMSECLSPARPDQNQVSTGR
FT                   QDVMPPLLTPDGSTPPDNSPARSFTPSARSAEDYFPHTTDSGPEEVLRAFRSGPLKYLP
FT                   FVYIPDGVSAAELKTESPFLWFCICAVQCKHTARQSALSVNIREKAAQALLVDCRKNLD
FT                   ILQGLLVYLGWVTFHCQPQKYSLCTYIQLAISVVFDLGLQKSPPDGSHPADCDWNGPTQ
FT                   NLLFPVSRTRTMNERRALLSCFLLSSFISQFLCKPDPMRWTAHMKECLEVLTERKETPN
FT                   DAVLVQLVQIQLVVDKVIRRSWDESGLATEEGPRLPTSFFIQTMQHQLQSIRSRIPPEL
FT                   ADNKVVLFHLYQAEVTVYELALSRSATRVENVDVTRISHLYACLAATKNWLDLLLTLSP
FT                   EEYVFLPVTIIFQVSHCLSTLFYLSTFDYPGWDKEAVTRIADLQSVSQEVIDRLGSVAE
FT                   AAGIQNEGTDGDSWSKAARILPKLQASWASRLPNAVAISETSDGQSSALPSVDEDFLEA
FT                   YLNWPDVWLLESWMQASQNE"
FT   CDS_pept        join(complement(222226..222429),complement(221648..222138),
FT                   complement(221451..221595),complement(221069..221401),
FT                   complement(220679..221012),complement(220536..220630))
FT                   /codon_start=1
FT                   /gene_family="HOG000170052" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902586"
FT                   /orf_name="AFUA_8G00962"
FT                   /product="Cytochrome P450, putative "
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="EBA27218.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG325590"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI0000F51ADA"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA50"
FT                   /transl_table=1
FT                   /translation="MLLNISAFALSTTGVLCMLLCLVVKLFETSPVPKNIPWVLSKKGF
FT                   FGRAAERFLGVNPIGFIQEGYQQYSKNQQPFVMPSVNEGDEVILPKEHSNAVLFAKESE
FT                   YSFKAHISDFFQLKYTSWPLAFAERYDFFVKLVSKDLTETLKSKAVAESLAEEARSCLS
FT                   EFWGEDTDNWVEVPLYSFMEKVAARMVNVMAIGPGSSHDTTLLGAMTNCSNAIVFGANV
FT                   IKAFPSFVHPIIGPIVGLVNRWQERVFHARMKPIIEAKIKEQKEADDPQSLQERLKANG
FT                   SLLDLLIQAGLRSKWPVERETMWLAYRIFMLNFPGVHTSGISATSALLDILSYPTEEGL
FT                   MDMLQAEIEQIAANSDGSWSAADLERASLLESAIKESLRFNGINALSPTRKVVAPEGAF
FT                   LPNGVFLPYGTKIGIPQYAVHRDSDLYPNPNEYNPYRFYKENATPEERRQNLMTNTSDT
FT                   YLVFGHGRRQCPGRWLFAHIFKLLIAEMLLKYEIKPFAARPKIHRWGRFQLPPLSVKIT
FT                   VRRKKNPVAVCNQFST"
FT   CDS_pept        join(224912..225015,225515..226784)
FT                   /codon_start=1
FT                   /gene_family="HOG000170041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262238"
FT                   /orf_name="AFUA_8G00980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85070.1"
FT                   /db_xref="HOGENOM:HBG057529"
FT                   /db_xref="UniParc:UPI000052094B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB42"
FT                   /transl_table=1
FT                   /translation="MRIAVVPPSRPSRVGLPYSFSPREISPAKSDAWSSRHRLSCRYGN
FT                   SVPSKQLRPPSGVRASEATPSKKAKPSSPTDDSSSSSSSSSYSSPSPPAQQYPPPAASP
FT                   STSQSPESNTSDVDQDDKIRVLDAPAGNPSEDLNAEDQRLLDNWCNSTEQSLAHSKSKD
FT                   RPWQAIIRREASRHPALRHSTLALSAMELASTSEAGTPQRQRHLQAAESHYTQATEQLP
FT                   NILDSRTASGPNAAFSTASILFMCDLASSALAGEGSKSVFPSPDNQTPASQESPDPSPS
FT                   ACPSLQKLLDLFDTIRALLPCAETLNKVETGALKDLFTQGDPYHQLPSTYTLTILSMKN
FT                   LNALSARSDPAHETAVYNDTIAHLDNSLEMLTKGGDPTTIALRWMFRIPSRYLDLVREK
FT                   QPLALIIFAHYCAVLHHLRDRWWMGDLGARLLKEICRLLGSARMGSILWATDIVGIQT"
FT   CDS_pept        228526..228846
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055881"
FT                   /orf_name="AFUA_8G00990"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL85069.1"
FT                   /db_xref="HOGENOM:HBG057528"
FT                   /db_xref="UniParc:UPI000051EF29"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB43"
FT                   /transl_table=1
FT                   /translation="MNLLDLPTEVLVMIAEALQTAHDINTLARTSRTLYSCINYVLYQS
FT                   DVQNGNGKALIWAARRNKPATAQKSLQAGVKKLKKMASPAPDALVKGRPRSHDAVVIGR
FT                   RC"
FT   CDS_pept        228901..229677
FT                   /codon_start=1
FT                   /gene_family="HOG000048595" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262239"
FT                   /orf_name="AFUA_8G01000"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL85068.1"
FT                   /db_xref="HOGENOM:HBG057527"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000051E5DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB44"
FT                   /transl_table=1
FT                   /translation="MAAGRGHDAIVKLLIEKGASVNLKKAPGYPLVIAASNNRKAVVKV
FT                   LLEKGADSNARRDDSTTSLHIAVMRGCSDIVSMLLNKGADTDLGDNTGTTPLHTAVWKK
FT                   HCKITQLLLERGAAVGSRDSYGRTALDIAMTHGSQRSLSLCLKHAKINAQDCQPLHPAI
FT                   SLNKTAVVRWLLENGADINRKDSRGQTPLLYAMLEAHDHLVELLLLYDVDPDAERYDGL
FT                   TPLKLASEINREDWAQKLRAKRDKHKYRSHSLHSTS"
FT   CDS_pept        join(230319..230614,230665..231138,231190..231703)
FT                   /codon_start=1
FT                   /gene_family="HOG000219186" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207166"
FT                   /orf_name="AFUA_8G01010"
FT                   /product="Thermophilic desulfurizing enzyme family protein "
FT                   /EC_number="1.3.99.-"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85067.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057526"
FT                   /db_xref="HOGENOM:HBG570147"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000051F42A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB45"
FT                   /transl_table=1
FT                   /translation="MAQANVPATDPAVYDAYKEKWAAPPDSADAWLARAREVAEVLAQD
FT                   AAQRDQDNKSPRAEVALLKHSGLLKLLGPKKYGGGEQPWRVGYKAIREVAKGDGSIGML
FT                   LGYHLLWSTTANVVGTAEQADRLQKLIITNNLFVGGAVNPRDNDLQITADGDSIVFNGF
FT                   KHFNTGGVVSDLTVLEGVLDGTQDHIFAVVETNQPGIQFAYNWKNIGLRLTESGSVKIE
FT                   NVRASWTDALGWDATTKRPLAEILTIPFASLFLPTIQLVFSNFYLGIAIGALEFAAKYT
FT                   TTSTRAWPYGGDNKERATDEFYILERYGNFFAHLRAVEALADKAGDRLSELYERHSGDR
FT                   LKVTAEERGEVAEWVASVKVVTTDVGLRVTSGIFEVTGARATSLKVGLDRFWRDIRTHT
FT                   LHDPVAYKNRELGRYVLLHEYPEPTWYT"
FT   CDS_pept        complement(231757..233814)
FT                   /codon_start=1
FT                   /gene_family="HOG000217335" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262240"
FT                   /orf_name="AFUA_8G01020"
FT                   /product="HET domain protein"
FT                   /protein_id="EAL85066.1"
FT                   /db_xref="HOGENOM:HBG057525"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniParc:UPI000051E83B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB46"
FT                   /transl_table=1
FT                   /translation="MARYQYIPLPPVDELGQSPAFTRILTLYPGAEHDPLYCTLDIVDI
FT                   EHYPWPPEALSYVWGSERAPAPLYCGNGQLSITRNLDIALRHLRLPHAHRRLWVDAICI
FT                   NQEDPRERERQVGYMRLVYKHAVAVIAWLGPGMPETAEAFDFARRMSELQKDMNETAAS
FT                   APDGRALFSMKNEADGIMFASMAAEPRATDALARLFTGPYFERVWCIQEVVASQRCIAK
FT                   CGQHEMEFFDLLSLQTYVCNFRGVILDAQGLEYPDGTVSFWSTFVLGRRKILVSRKQQS
FT                   VEGSIGKMFTLLAAIRNFKCTDPRDRIFALLGISDEGLQPALALTQVEGAQDSRALSLL
FT                   RRGMIWLSDKVNSLGPEINFLRPAALRPNYSKPVREVYRDFTRFSVRLQPRKLDILSLV
FT                   QHTTHPFQDNWPSWVPKLHEERSVSLLPPGLCLAGIPMYGHYRYFAELHDSPLNGRSVE
FT                   PDILQLDGYRVDLVDAVSDRIHYKYTETPPIEAIWSQLFDFPLFPRPGFQYTGSGEALD
FT                   VAFLQTISAGILGVIGMFLNQQAAWQDSRSAAWPALRRQVKSNILAWLQAYPPAQGLHY
FT                   PDLVPEGQFADLPGDSIAYRHFLWVYSRNRRMYRTRSGLVGLGPQLMQPGDQVVVLFGG
FT                   SLPFILRPWGREWLLIGDTYLHHDSIIQGEQVQMVRSSSTPFRVETFRLA"
FT   CDS_pept        234722..236968
FT                   /codon_start=1
FT                   /gene_family="HOG000217336" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055882"
FT                   /orf_name="AFUA_8G01030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85065.1"
FT                   /db_xref="HOGENOM:HBG057524"
FT                   /db_xref="UniParc:UPI00005206DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB47"
FT                   /transl_table=1
FT                   /translation="MEGNSTVALRQLSLSTVSSRSYQALGYSQNDLSGDSGASHNEEPP
FT                   AYSHVSPAAQVPGRGYSTTLHRSPGVLLPTLLYAGLAIYAWVAIVYLSFRPMSAKSWGA
FT                   LLSENRLYSESVDYARNEGIYRSAVVIWTLIAIMTLPWLSAVCASAAVIYVQNQKTADS
FT                   LQMRQVTNLADRRWLDLSLYKALVSGGWKKHGSTFLILAIVLHLVAGLTYPIQSIFLET
FT                   TTINVPQAMDRVASIADLPSLEYPDAAISLIGNDILAVRRALSDADSVTVQPFLWQNTS
FT                   GVQLHTLSDILSLNDSFYAQLPTGFNTGVLRQFAPRVNSTATYETILASEFPSNCDSTP
FT                   GSFYSRHYSEYAVSEYRRIWGVTACMPSNWTKSQWQKTRARQEFSETLYLNFTSSKGNS
FT                   GDTPADGKLYRVTVSTTAGYFELPNNMNDGKHGPLLEQDPVGLCGADCHYQTFDPDLSL
FT                   SRIRRDNITTTDTLDAVSWDPLATVSKGPLLTTALALFGQGSFLDTFAAKIWAINDSFN
FT                   RANVTARICLDGPPLLDLMLYQSYSTKHYCLDAPMGTRYGASAADPLIHQWIDYFLKVE
FT                   DRFPMLFTAAAFLSNKQLLESVSGQWWIYQDLGTEMIIPTISLAGIIVGSIMMALYIIP
FT                   MVGLAFYAAWYPRWTERLDSFTMLRLGATIGDKLLPLRAAKSVDRIPVLDEIPGVVRDV
FT                   SIPDGNVVLPVGTLGLGDGRPLEGQRRYEAYKESDEPLTPMERRMLQSRINDDP"
FT   mobile_element  239747..243286
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        246208..247179
FT                   /codon_start=1
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262241"
FT                   /orf_name="AFUA_8G01050"
FT                   /product="Lipase/esterase, putative "
FT                   /protein_id="EAL85063.1"
FT                   /db_xref="HOGENOM:HBG057522"
FT                   /db_xref="HOGENOM:HBG757640"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051F8DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB49"
FT                   /transl_table=1
FT                   /translation="MASPILRSPITSDLANVTPDLVDVSTPEKLKSYRESLEPIFTLEN
FT                   IIRGKENIISYEELDIPGPAGPMRATIFRPKHQTHPIDEIPGILHIHGGGLATGNRFLG
FT                   FTMLDWVESLGAVCLTAEYRLAPEHHQPAQLEDSYAALQWMSDHAAELGFNPRKLVVCG
FT                   SSAGGNLTAGVTLLARDRSGPQIRGQVLIYPWVDDGMDYVSMRQYADIAPVRDVDAAVL
FT                   ANYAFGERREHADMYTVPMRATNFAGLPPTFIDVGEADVFRDQDIAYASALWKDGVSTE
FT                   LHLWPGSWHGFDVFVPDAPISRRARAARLEWLRKLLSVPDGI"
FT   CDS_pept        complement(247961..249328)
FT                   /codon_start=1
FT                   /gene_family="HOG000217338" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902587"
FT                   /orf_name="AFUA_8G01060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85062.1"
FT                   /db_xref="HOGENOM:HBG057521"
FT                   /db_xref="UniParc:UPI000051F680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB50"
FT                   /transl_table=1
FT                   /translation="MRNFWHFSQQLYPDLPPIDAYLALHRDYVAPIVGPVLHGTLTTTE
FT                   ALALWTGSTPWVAKIQALRQGKEVAERLFSYTKSLCATQQSTLSSLTADEKQISAHLTT
FT                   EILRRYTADTLGQPTPFTDGVDTAAGGASLAGGSAKNIPKGITNNPSLAASASSGPAES
FT                   LFDRINYFECYNTALRMIQTAQAQRMIKALDVIAEKLEDGNCITVMGASGPDGFARPVY
FT                   DLIRMKINKINAADRENHCFFIYHNSNTWHQAFERLTGENPLPPEFINNPCDDLDHACL
FT                   FMREVRQKLLAKDEKRGKGMKFHLLIPSWSKLQIKEPLHFPEDLYPLQIEGLKHNGSNQ
FT                   VELSLPAAPPGLLHGVSNVLDPNNWNAIAEGTGVAVTAPAVGWGVNGACLALGLGVGTL
FT                   TGAGLLLALPLWMGTAPFAMGKSAPVIQETIYDALREEDPRVLGSNERLRMPGRRS"
FT   CDS_pept        join(252274..252778,252831..253288)
FT                   /codon_start=1
FT                   /gene_family="HOG000200579" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750582"
FT                   /orf_name="AFUA_8G01070"
FT                   /product="Sterol desaturase, putative "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85061.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057520"
FT                   /db_xref="HOGENOM:HBG559159"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000051E5DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB51"
FT                   /transl_table=1
FT                   /translation="MDVALEFLDPLILDKAYAWLLPSEPNVPDPTSRWDRDNVYRQVIS
FT                   ILVLTQLGATSLYLFFSALSYYFVFDRRLEYHPRFLPNQVRQEIKSSLSAIPFINILTL
FT                   PWFLAEVRGKSMLYRSVSDYGWPWLVVSSILYMAFNDIGIYWIHRLEHHPSVYKYIHKP
FT                   HHKWIVPTPWAALAFHPLDGYVQSLPYQSVSLSPVAAILRAIPLTINSVFVFICPMQRH
FT                   LYMVLFAAVQIWTILIHDGDMISGHWTEKFINSPAHHTLHHMYFTVNYGQYFTWADAYF
FT                   GSHRAPEPALDPLHDALKVMRAKGLVDEQGNPIKKPKGE"
FT   CDS_pept        join(254415..254615,254894..255253,255961..256494)
FT                   /codon_start=1
FT                   /gene_family="HOG000217339" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750583"
FT                   /orf_name="AFUA_8G01080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85060.1"
FT                   /db_xref="HOGENOM:HBG057518"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI000051F8E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB52"
FT                   /transl_table=1
FT                   /translation="MRVTVFSLLTALSASLVCAQGYSKDCSDIYLQEGWLVATCPKDDN
FT                   NGRITSSVYLPNKIANDNAVLEEHIANYDGHLLSNLAGAVTHVPEDSSYPIPSEFEVEL
FT                   DVSTLNNSCASYGGTIKLTRPTSCWYLNVGVEYSWACGNSKNNQGWEIVGYSDKDCTSD
FT                   PVAAFTQENQGTCLTFSTGVKGFSSTNAPDLATAVSHHIRRPASMREVGEMWKNILVGF
FT                   FPNREYAPFPFRDTHYYINLDLNTHGYLGLGSVVRTQGFNAGVHFLQLNFTAAPADGSP
FT                   FSWEGNEHFLKREMRGSLQSVPEDRKRAIYGLIAIGTYVRLYRYLPDGQFAPVTFVVGK
FT                   QTLHVRADQAVIREFLAGVQEEWM"
FT   CDS_pept        join(complement(257127..257149),complement(256754..257081))
FT                   /codon_start=1
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055883"
FT                   /orf_name="AFUA_8G01090"
FT                   /product="Thioredoxin, putative"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="EAL85059.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG057517"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI0000520227"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB53"
FT                   /transl_table=1
FT                   /translation="MPVTEITSAKLSTHGRFEQFKELTDGDKPVVIDFWATWCGPCKAI
FT                   SPLFEKMSDNPEYGNVGFYKVDVDEQEQVSQEVGIRAMPTFVLFKNGYKIGEAVGAAPP
FT                   RLEGLLNTARSL"
FT   CDS_pept        complement(257872..260223)
FT                   /codon_start=1
FT                   /gene_family="HOG000115363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750584"
FT                   /orf_name="AFUA_8G01100"
FT                   /product="Melibiase subfamily, putative "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85058.1"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG057516"
FT                   /db_xref="HOGENOM:HBG325581"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051E83D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB54"
FT                   /transl_table=1
FT                   /translation="MEFYNPIDRVSHIIPTYHKMLNEPIDDAHWRNISRDLPCGYLPLI
FT                   YIRFSRSRKILETPVTRPVSPKMPPQTITLESQALRVKVLIDNDGAAFLQQVLPLPGTS
FT                   PNPVSKNFSDSYAPLVEVRLAGEGTERNKSSKSLVGSYVGSRLRYQSHEIEKGADTQTL
FT                   HVRLQDGSSGALVTSHLTVYEGFPVLRATASIQNGGDKDFVVTQLTSLVLGGLSTGSER
FT                   WWHEYRLSVPNNSWFREAQWVEHDLPSLGVDDCGVYGRPDEHWGSLTHYSVSKRGTFST
FT                   EGHLPMGLLKHVSGKDTWLWQVENNGSWRWEIGDWKDSIYLAAGGPVETEHDWRERLSP
FT                   GQKFTTVPVALCHVQDDYEAAFAAMTRYRRQIRRKHRDHDRLPIIFNDYMNCLMGDPTE
FT                   EKILALVDPVVNAGAGYFVIDAGWYADDSGWWDDVGLWEPSSKRFPSGFKALLSQIRNK
FT                   GLIPGLWIEPEVIGVRSAVAKQLPNEAFFQRDGHRIVEKNRYQLDYRHPAVREHMSAVI
FT                   HRLVTEYGVGYFKFDYNIDVTQGTDINCSSPGSGQLGHNRAYLQWVDELHDRYHDLVIE
FT                   NCSSGAQRMDYAMLAVHALQSSSDQQDPERYPAIASALPTAVTPEQGAIWAYPQPAWDG
FT                   ELNAMTVVNSLLGRVHLSGRLDLLRPEQIDLIKEGMDVYRAIRADLPTATAFWPLGLPQ
FT                   WHDDWFSLGMDVTKPEGNGRQCYYLSIWRRGGPESIDLPVKALCGRAVSTEILYPTSLP
FT                   AKAVWLSNKGLLEVTIPSAMGARLIKLTAE"
FT   CDS_pept        join(complement(261283..261462),complement(260864..261186),
FT                   complement(260750..260811),complement(260386..260702))
FT                   /codon_start=1
FT                   /gene_family="HOG000217340" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207167"
FT                   /orf_name="AFUA_8G01110"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL85057.1"
FT                   /db_xref="HOGENOM:HBG057515"
FT                   /db_xref="UniParc:UPI000051F1A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB55"
FT                   /transl_table=1
FT                   /translation="MLIQNRQDVHVFSLFCLNVEYGSFSPISPGPNMYLVTRYGYGRHF
FT                   ELIAKQPSTVSMFLKMSFCVLYMHIFVPSRVLNSLCVALIILLIMECVEEIIVVILQCR
FT                   PVQAAWTPIPAKCLNLTLFYYVSFGIKLATDIAIFVLPIPPLLRLRVRGLQKFVVILMF
FT                   ALGLMVCVTSIIRVTYIKDLNPDHTWSLVAPLNWSAVEICVAIFISCLPSLKTLITIHW
FT                   QNASRVTSSNTDSTADSLCTRIRTFFLGNGKEADHEQRHTSPDGTAGADIPLPENNVRT
FT                   VDSAHSNIGGDV"
FT   CDS_pept        complement(262330..263142)
FT                   /codon_start=1
FT                   /gene_family="HOG000169986" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262242"
FT                   /orf_name="AFUA_8G01120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85056.1"
FT                   /db_xref="HOGENOM:HBG057514"
FT                   /db_xref="HOGENOM:HBG330503"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniParc:UPI000051E5D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB56"
FT                   /transl_table=1
FT                   /translation="MTFRHRDTQSIPHETDWLLHPGNNTPSPTKSRARRFAAHLTTEIN
FT                   PHYGDILLIFCYIITGLLDSSAVFIWGSFVSMQTGNTVYLGLGLIGIDDTTRWIKAGVS
FT                   IFSFCFGSLCFAAFHRRFPSRQRWVLCASFAIQMLCVAVAATIVTLHFPSRQSDLSWKA
FT                   LVPQVLVAFQSSGQAVTSRVLQFNGLTSVVLTSVYCDFFSSPRFPSLSAVEDRRRLGAI
FT                   GCLLLGTVLGGLWARSSAGLMGALWMAVLCKGMITGAWLGWKGQQSDD"
FT   CDS_pept        join(complement(266621..266648),complement(265929..266535),
FT                   complement(264326..265877))
FT                   /codon_start=1
FT                   /gene_family="HOG000170018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262243"
FT                   /orf_name="AFUA_8G01130"
FT                   /product="Alpha-galactosidase C, putative "
FT                   /EC_number="3.2.1.22"
FT                   /function="alpha-galactosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85055.2"
FT                   /db_xref="GO:0004557"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG057513"
FT                   /db_xref="HOGENOM:HBG302872"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000F51ACA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB57"
FT                   /transl_table=1
FT                   /translation="MAQKSTTANAIVVEGKTFALNGYNVSYRFHVDESTGDLRSDHFGG
FT                   SVSGPIPDDSAPIMNGWTGMPDRVRREFPDQGRGDFRIPAIRIRQSQGHTVSAFRYDSH
FT                   TVLKGKPALAGLPATFGTEEDVSTLVVHLYDQHSEVAADLMYSIFPKHDAIVRSVRITN
FT                   KGEGTISIEALSSMSVDLPCEDFDMIGLRGDWAREAHRRRRKVDYGIQGFGSTTGFSSH
FT                   LHNPFVALAHRSTTESHGEAWGFSLVYTGSFAANIEKGSQGLTRVSMGFHPNQLSWPLA
FT                   PGEIFTSPECVSVYSKDGLGGMSRSLHRLYRNHLMKSKFAADNRPVLLNSWEGLYFDIN
FT                   EENMHRMAQESAALGVKLFVMDDGWFGDKYPRVSDSAGLGDWVPNPTRFPNGLAPLVKA
FT                   ITSLKVAKSPENLRFGIWVEPEMVNPQSSLYHEHPDWVLHAGSYPRTEQRNQLVLNLAL
FT                   PEVQEFIIDAITNILNSADISYVKWDHNRAINETPSPAATHAYMLGMYRVFDTLTSRFP
FT                   DILWEGCASGGGRFDPGVLQYFPQIWTSDDTDAVERIFIQMGTSLVYPASAMGAHISAV
FT                   PNHQTGRTVPLTFRAHVAMMGGSFGLELDPLKMCPEEKAVVPELIALAEKVNPIVLKGD
FT                   MWRLSLPEESNWPAVLFVSEDGVKAILFLFQLSPNVNHTIPRVRLQGLDRQAMYSVDEQ
FT                   GPYSGDMLMNLGLQYSFSTDYASKVVFLERVDVM"
FT   CDS_pept        join(complement(268781..269658),complement(268368..268727),
FT                   complement(267954..268317))
FT                   /codon_start=1
FT                   /gene_family="HOG000170019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262244"
FT                   /orf_name="AFUA_8G01140"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85054.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057512"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F51AE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB58"
FT                   /transl_table=1
FT                   /translation="MRSSTLADAKPMAVGPYSPNACALCRSQKRRCDKTLPSCSRCIKS
FT                   EFSASSLCLSVTDTQKRSKLSCDYAWNATRTEGLPRVSLSDFLLFHVPVTQDQLWLPGS
FT                   FQALQPHWDNISFRRVDIDNYFVGLAMATLTEQCVSVERMLEEYFCNIHPWFSVIIEPG
FT                   FRKRLSNLHREPCAETAMLLLAVSLVTGSHDRSSNDSHRTRIYQIGKYLFSFLQLQREP
FT                   SLEMVQSGLLLVLYELRASRLNEASVSVGNCARLGYTLRLNIDHTQQGGNWPWIESEER
FT                   RRVWCGLYMLDRIICQVATEFRAPHAVEEPDASYRLPIDDIFCYNPKTPVPGNSYPSLS
FT                   TPVEIPLCYFAREIQASRILGQVQMLRRLSDAVWSYEQFAVVDRKLMRFMKILFEQTPG
FT                   SWAVLCGANAICLASAISLHQDRLLRAARGAISPTDLDTSILAITAYIKMVRDICAKFD
FT                   ALEPRRKIPCVPLPAVMCIGEAVLAIRYLKQSYGLAYQFDEEPFQRVLTYATRTWNLAG
FT                   MFDLLCQRSIRRTADP"
FT   CDS_pept        272935..275097
FT                   /codon_start=1
FT                   /gene_family="HOG000170030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262245"
FT                   /orf_name="AFUA_8G01150"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85053.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057511"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051EA7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB59"
FT                   /transl_table=1
FT                   /translation="MATPSSSATGLGGCDVLQWQHEGRPAKRRKGISMTSTCQPSPREI
FT                   GIMRETERDDSATFLGSSSGIHFIRTVYSAFAKRSAVLQEARVRNQSLVPGEDDQLQRS
FT                   PGKSHGLDELCLKHELSLQAPDSVSFESLVGWSRSYFEYWHPIFPFLHAPTVLKAMERV
FT                   GESGIGSLDRINLAILRSILSISVVDNRQVQNSGMTADPIPSVLVYRTVQEAMESIHAL
FT                   LLEPSTLPLLQAVFSVQLVLTSVLRLNTASRVGGLISRTAFHLGLHRCPARFSCFSRED
FT                   ADIRRRLFWSIYCLERYLSQALGTPPSIQDDDIDVCYPDNERHGEIGKVPRAKGPHSHL
FT                   RLLTHLAKFARLRGLILELRNKSILHSHNNTLAATYVNGELAQWWNEVYDDIYPMEEQL
FT                   ECPSQYETSLQPYHRLLLVVLRHESIISMNRPLLAAERHSPEYKPALQTCIESSRSLIS
FT                   ALRTYLLAHNSGRSDQDGADSGKRQAPLSWPSFTWATWMSCLILMYAASEGEFSSISAL
FT                   KYAKLGISILENLSLRKSSWPETCIEAIRGMESALRINLDSDSREQTPVPRTFSRRTQR
FT                   TTLSALSERRVDVEPNGSMDQDEGSSRADPLSSPWTSKRSTFNITEITSSHSTSTHEQR
FT                   PLSEQAHHPSSYDLNNDQSTIGIETDNMDDYNSAGLVFGDTMGSQFPFAIAAGLDLAPF
FT                   STADPCAVTNLWSIADWPWMIHENFS"
FT   CDS_pept        join(275678..275936,275984..276474,276550..276900)
FT                   /codon_start=1
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055884"
FT                   /orf_name="AFUA_8G01160"
FT                   /product="Tartrate dehydrogenase, putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="NAD or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /function="tartrate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85052.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009027"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057510"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI000051FFF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB60"
FT                   /transl_table=1
FT                   /translation="MSPSVSPNKTYNIAAIPADGIGPEVIGAGITALNALSETLNTFKL
FT                   NFTTYDWSSETYKKTGKYIPDGGLDELKKHDAILFGAVGAPDVPDHISLWGLRLAICQP
FT                   LQQYANVRPTKIFRGTESPLRRCKTGDLDWVIIRENSEGEYAGQGGRSHRGKAWEVATE
FT                   TAIFSRHGVERIMRFAFETAQKRPRKLLTVVTKSNAQRNGMVLWDEVAAEVARDFPDVT
FT                   VDKMLVDAMTTRMVLKPETLDTIVATNLHADILSDLAAALAGSIGIAPTSNLDPTRENP
FT                   SMFEPIHGSAFDITGKGIANPVATFWTAAEMLAWLGEEDAAKKLLNCVEDVCEMGILTP
FT                   DLGGNATTREVTEAVVGQIRKLAAAQ"
FT   CDS_pept        complement(278043..278222)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262246"
FT                   /orf_name="AFUA_8G01170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85051.1"
FT                   /db_xref="HOGENOM:HBG057509"
FT                   /db_xref="UniParc:UPI000051E5CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB61"
FT                   /transl_table=1
FT                   /translation="MVAAQLSAVHWETGWSLYRPLWSRGETVRESCSATDSAPPTFPVR
FT                   GVSGPGLVPLEELL"
FT   CDS_pept        278229..279806
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262247"
FT                   /orf_name="AFUA_8G01180"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85050.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG057507"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00005206E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB62"
FT                   /transl_table=1
FT                   /translation="MASQSPSYLGLSGRALHWAQVALVGAPAFIVFGYNQAGVGPLATL
FT                   QSWVKTFPQIDTINTTGSLEAHNSTSKGAVIASFQIGALIGALSCTLISDRLGRRKTIF
FT                   LGSILTIIGEVLQVASYGLVQFVIGRIILGMGVGQYSVAVPVWQSECSSAKNRGQHVII
FT                   DGIFMCLGYSLCNWIDFGLSRIPQSTTQWRVPLALSLLPALVILLSVFLLPESPRWLVQ
FT                   VNRAEEATHSLASLKGLPANDEAIRAEISGIESSLELTAQSKGSLMEMFDPNDQERLFY
FT                   RFCLCIILQFFQQMCGGNLISVYASTIFEQNLGLSASLSKNLAACALTWKFICCFIAFF
FT                   TIDRLGRRVVFMISGTGMAICMIALAITNSRGTDNKGASIASVVFLFLFNLFYPIGFLG
FT                   GNFLYCTEVAPVRLRVAMSSISTANHWLWNFVVVMVTPIALDTIGYQYYVMYAVLSACI
FT                   PLLVYFFYPETMNRNLELLNHVFRDASSPWKIVSMAKHLPQGEVTEADLMEMNKKGDGC
FT                   SVEMAEKV"
FT   CDS_pept        join(complement(282332..282395),complement(281420..281993),
FT                   complement(280030..281365))
FT                   /codon_start=1
FT                   /gene_family="HOG000217341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262248"
FT                   /orf_name="AFUA_8G01190"
FT                   /product="Isoamyl alcohol oxidase, putative "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85049.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG057506"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000051EA87"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB63"
FT                   /transl_table=1
FT                   /translation="MWLACMEPAVPGCVSFSSVDYGFKCGFINNDTVGIGQESYLSIIR
FT                   SCASTYKMISFCFITFVSLLSFPGAVHTVSHCKLSPLDAEWPSNEEWAALNASIQGTLI
FT                   RTAPVASSCYTGNPFVSTESCTSVKKYWSYAAYHSAWPESVDYSIYTNNSCVPPGVVGY
FT                   TEGRGCTIGALPQYIVNATTEEQVARAMLWASKRNIRIVVKGTGHDLNGRSTGAYSLSI
FT                   WTRNFRHIVHQASWPVPASNHTEDVIIIGSGNNWGSIYTAVHAINRTVVGGQDATVGPG
FT                   GLIQNGGHGLLSSHHGLASDQVYQVTVITTDGRRLVANHAENEDLFWAVRGGGGGQFGV
FT                   VTEFVLKTYPVAANVVSGGLSFYPSRSIKASELASWDALAETTRLIPDLMDSGMTGTVT
FT                   AMTKEAAIRLTGVKESIPGVAVSINMIGYNMTMTKMNTSIHHLAARIRKYSNSSSLTVT
FT                   YQAPSAQSYWAFVNPDPMASRASGASSSMSSRLLGRRELTDLSRGDLITHLQQILTSQE
FT                   PEKGAMLLLGLQGGPGPAATSPEMRGSVLPAWRSAYVHAMVYGASINDTADPAEALATA
FT                   AEWYESTIEPVWRRWAPDTGSYMNEGNAFSKTWKKDFYGENYDRLLAIKQRYDPDESMF
FT                   VWSGVGSDRWEYDLRSGLLCRR"
FT   CDS_pept        complement(283312..283593)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262249"
FT                   /orf_name="AFUA_8G01200"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85048.1"
FT                   /db_xref="HOGENOM:HBG057505"
FT                   /db_xref="UniParc:UPI000051EA86"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB64"
FT                   /transl_table=1
FT                   /translation="MRNDVFESSIVSSSTWPDMDPISNGDARAAVLPMSVMEAVCKTIS
FT                   GTWGALELSINGFTSSNSGIGVPATRYNGYWNSTPKESKAIVREKARP"
FT   CDS_pept        join(complement(284961..285177),complement(284762..284892),
FT                   complement(284675..284704),complement(284504..284620),
FT                   complement(284271..284448),complement(284091..284221))
FT                   /codon_start=1
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902588"
FT                   /orf_name="AFUA_8G01210"
FT                   /product="Enoyl-CoA hydratase/isomerase family protein "
FT                   /EC_number="4.2.1.17"
FT                   /function="enoyl-CoA hydratase activity"
FT                   /function="isomerase activity"
FT                   /protein_id="EAL85047.1"
FT                   /db_xref="GO:0004300"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="HOGENOM:HBG057504"
FT                   /db_xref="HOGENOM:HBG748731"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="UniParc:UPI000051F429"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB65"
FT                   /transl_table=1
FT                   /translation="MRIVMDYSTQTERFILARTCQSSTRILTLDRPNKRNALCQTLIDE
FT                   LLQQLKIASADPHIRAIVIAGSGAIFSAGADIKEIAQLDGESARQKRYLEDLCHGMKQV
FT                   RKPIIAAVEGRALGGGFELALMADFIVATPEVEFRLPEISIGLIPGAGGTQRVTAAVGK
FT                   YRAMNLILLNEPLSGSEAYQVGLVSKLVEPGMALSGALEIAEKLASWSAPTLMVAKEAI
FT                   CRADELQHDHEFERSLYYATFGTRDMAEGVTAFLEKRAPVWRTPS"
FT   CDS_pept        join(286174..286747,286811..286945,286994..287076,
FT                   287130..287233,287287..287574,287633..287729,
FT                   287779..289108,289157..289530)
FT                   /codon_start=1
FT                   /gene_family="HOG000169964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262250"
FT                   /orf_name="AFUA_8G01222"
FT                   /product="NRPS-like enzyme, putative "
FT                   /function="ligase activity"
FT                   /protein_id="EBA27217.1"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51ACD"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA49"
FT                   /transl_table=1
FT                   /translation="MMSPLVSPRDGNLFRSFGFGPQRPVPYPTVHHAFIDCAKQYPDTV
FT                   AVCDLSWNKSVEVTYGKLLQYAQFVALRLQSHGVVPGSRIVLATKRSVEMVAGILGILM
FT                   CGAQYIPLDGAVVPDETLAHAVIQSQNSVALCTGTFRSRLHSLPQVSSVLVLEDLLAEA
FT                   EHTGIRASTTPLICEGDENSGCYVIYTSGTTGTPKGVDVKHGNVTNVVCHAPGNLGMSR
FT                   GSRVGQVLSISFDMGAWEILGSLCNSATLVLRGSDWHAALQQVDTLICTPSILSRYRPQ
FT                   DFPNIRCIATAGEPCSQSLADKWAANGATFYNCCGPTEVTIINTMHRHQFGQQLTIGRP
FT                   LPNTSVYILDDKQLPVVIGEVGTMWAGGAGITRGYLGQPEKTAERYRYDPFVDDGHSMM
FT                   FNTGDLARWLPDGSLETLGRNDDQVKIKGFRVELDGVSASLASCPGVLEAAAIMVEGDV
FT                   VAFVTPQALDLQQLQMHLKARLPYYAIPTQVHRVDEFPLTPNGKIDKRALAQLSRPQKK
FT                   TSQSDTEMLDEKKHVVLNASRETVSTRSDSSDSLRKPLPLAEKKNRKVVRGLRYRIFIV
FT                   YRRLFTLIWLANVAALLCILFIPKLGPQWISTIAFINLTIAVLVRQDAVINVLYTICCS
FT                   VPKSWPLAIRRRCAKIYHLGGVHSGAAMAATAWFAGSIGYNIYNQVDDARALAKASPAT
FT                   LTLSLIVLLLLFSMIGFAYPTFRKKRHNTFERIHRFVGWTILGIIWIQTILSIRDQRGT
FT                   QPLGRAVISSPNFWMLLVITASIASSWVFLRKVPVDAEVLSNHAVRLHFDYTMPVNGTF
FT                   TRLSERPLLEWHSFATVPAPTAVNGRPKGYSLVVSRAGDWTGRQISKPPTHLWVRGIPT
FT                   CGVMRIATLFNRVVLVGTGSGIGPLLGHIQVPTCPFRLVWSTPNPVDTFGRDVVDAVYA
FT                   ADSGAVVHDTRKQGRPDLVRLTWDAVQGFQAEAVIVISNEKLTKKVVYGMETRGVPAYG
FT                   AIWDS"
FT   CDS_pept        complement(289722..291413)
FT                   /codon_start=1
FT                   /gene_family="HOG000172790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262251"
FT                   /orf_name="AFUA_8G01240"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85044.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057501"
FT                   /db_xref="HOGENOM:HBG325572"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E5DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB68"
FT                   /transl_table=1
FT                   /translation="MSAQLKRQRRSKIACEPCRTRKRKCNGQHPCEMCTDSEYTCHYDL
FT                   GSRKKRNKGLVLESLMTVRPAQRQQAGSHWERPTAPTPRRPSPPGERFTNTVQQSIGPN
FT                   SGAVFVQNLGLKIDPVNALNPQVFAWNIGLRKLPGSFMAMSIVNIISAEEMTALAHMFF
FT                   DKVAPYYGFVDRDSCFEHIRSRWDRPTGFEPYDIVLCGVAAMGCLFSQRKAAAAELHLV
FT                   ESAKSALEQRSQCEIPPLILITGWALRVSYLRLTASPHTAWLASCSLMHLIDASGLHLD
FT                   PSSRHELLRPTPNIDDDIRRRLVSFAQYINTWVSFDLARSRIILHGVSYKTPSSRDGDF
FT                   TAEMLDLLPLSESLDPFTPVDAAQLTTMLVNIMQSSRAQPPSVLSQCNLVLCIFRRLRA
FT                   VHSTLSPALMSQMLELITKALACARQLVDANCPWSHVANVPFQAICTLLAVDSPESLSL
FT                   LDDAVQTLKYVTDVYDTEVLREAYRTAGSLILLQQRRKEHDAGRLTSIWGRHFGPDNDT
FT                   MSQRRPSIQDSESFRDLVADLSSSENFDFAQFFIADNPWNALGMDS"
FT   CDS_pept        292208..292900
FT                   /codon_start=1
FT                   /gene_family="HOG000217343" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262252"
FT                   /orf_name="AFUA_8G01250"
FT                   /product="GNAT family acetyltransferase, putative "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL85043.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG057500"
FT                   /db_xref="HOGENOM:HBG325571"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051EA7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB69"
FT                   /transl_table=1
FT                   /translation="MPTDYHYTYFRVSKTEDLDRSAQRYRDLRLQALKLSPASFAATYE
FT                   SEALLTDEYWKWRLSQPGRETFVCAARPEANPNAFNEEDLEWVAQLTLLGPRTKEEFTL
FT                   PAASGQPEPGPDDEEERWQLLGLYTLSSHRGRGIAKRLCAEAIKYLVEYRVEPKNVHVR
FT                   LMVKPGMEAAVRLYRGLGFVEVGSCTLAEALIANGEGDLLPEGYEVKEKFCARGGHVML
FT                   QCFTRDSV"
FT   CDS_pept        complement(293335..294984)
FT                   /codon_start=1
FT                   /gene_family="HOG000174171" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262253"
FT                   /orf_name="AFUA_8G01260"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85042.1"
FT                   /db_xref="HOGENOM:HBG057499"
FT                   /db_xref="UniParc:UPI0000520470"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB70"
FT                   /transl_table=1
FT                   /translation="MFPPFFASALHYESFQRNYARFPLYTSLLFPKARNELSSGMAPDT
FT                   TLSIRSGRPETPMKSSKTNKERSKRCRSERSKTEGRGRVLLAETIGRALYHSHAGLPHD
FT                   VNHIPHDLFEFHETPAQGSSSIWLSVANHNGRSSGSTGSSMRTSDDTLSARSYDTLPTG
FT                   SSCISEEDAHSQRNRSILASQKSLPHKRIVSLDGQPSVDDVERLATRYGQASHMGLLDP
FT                   SYSIFLNGDRTAGLCFKVLNKVAIVMGDPMCDPTKICSVLDEFKRYRRRQRWDISFLGA
FT                   GQMLVSYIRMRNKKWTVLEFGKERVLNPLANEVLLETSGKRILTQNRQLLNPSKGGITL
FT                   HIYAPSLETDYELETELCAIYDEWRMARNKSGRLQAFITEYDPFLMPNLMTYIYTRGQN
FT                   GKVNGFAALRWIGEKNGYHVDPCIAAPRAPKGISDLLIFASMAWLRQIGISHLSFGYEP
FT                   SDSLAEVSGMPSPLAHLTRQIYRYTFQRLPIGGKKAYFDKFKPDEEQDSPLYLIFPSTI
FT                   PEPRPIIAMAHVANISIRKLWFHHRSKPAVPQ"
FT   CDS_pept        complement(309481..310962)
FT                   /codon_start=1
FT                   /gene_family="HOG000171526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055885"
FT                   /orf_name="AFUA_8G01270"
FT                   /product="Beta-lactamase, putative "
FT                   /protein_id="EAL85041.1"
FT                   /db_xref="HOGENOM:HBG057498"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniParc:UPI000052093F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB71"
FT                   /transl_table=1
FT                   /translation="MTKVNIIFALFNLIPAILAICLTQSPFYPPPSYNRQSSEVWEALG
FT                   LVEASLSNLLRNSNNLNTSSYSIEITPSRSTLWSTFHTAKDKNLTRPGADRVDETSRYR
FT                   IASITKVFTVLGILQQHAAGNLSLEDMMDKYIPQLRSSHHDGTRSSGSIQWDKISLRSL
FT                   VSQLSGLPRDWVQGDFLTDPESVNTTTKCDSDNSHRPCTAEDLFDNLRRRRALFAPNTK
FT                   STYSNLAFDLLGLVLTNVTGTTFEEYITASILDPLGMAQTSFVKPPDSVSVLPKGIAWY
FT                   SDVDEAVENPTGGLYSSTHDMSILLRYILSNYKDIADAKLNWLLPVSFTAGMGSYYGMP
FT                   WEIFRADRILPPDDKRRARTVTFFTKDGGVPRYRSIILIVPEYDLGITVLTAGDETLLE
FT                   VIVDMVIVPLIRAADALAARQVKETYMGRYTSSPTKEQTVNSTLTLTYTSTHGLEINEW
FT                   ISKFHRCARLHIQALSVPRKHKVSRSVDPLWSLQR"
FT   CDS_pept        join(313033..313662,313715..313855)
FT                   /codon_start=1
FT                   /gene_family="HOG000169196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262254"
FT                   /orf_name="AFUA_8G01280"
FT                   /product="Epsilon-lactone hydrolase, putative "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85040.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG057496"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051F423"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB72"
FT                   /transl_table=1
FT                   /translation="MQRSKDAEKLLMIGTGGGFAMDATAPYLDFWPRIQTTLANAGIEN
FT                   AWFHCTYTLTPHAAYPTQFCEAVEALRYILEDVGHSPSQVLLVGDSAGANLCLAVLSHL
FT                   THPSEDVPELVINEPIKGVVLMSPWVSFRHHWPSVEASEHRDIDAAEVLTEWSRAYLNG
FT                   RESNNYIEAAEAPEWWWDNIRVRQTLVLAGGDEALSDPIKTWVNSFKEANHDTALVIGE
FT                   RECHVAPLVWPMFGDYHETQQERALKHWLLERLN"
FT   CDS_pept        join(complement(315075..315184),complement(314436..314961))
FT                   /codon_start=1
FT                   /gene_family="HOG000217344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262255"
FT                   /orf_name="AFUA_8G01290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85039.1"
FT                   /db_xref="HOGENOM:HBG057495"
FT                   /db_xref="HOGENOM:HBG325566"
FT                   /db_xref="UniParc:UPI000051FB63"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB73"
FT                   /transl_table=1
FT                   /translation="MLCSLSGEVEITKHQPNRILHIRDLGMSYAYNMKSEEPNSVILTL
FT                   NYTTTMKYQVLITDEQDAKVAGKRRAVYLRPFLLFWLNSLFAEVIFLAVGVFIMTGTRD
FT                   LVYKVLWTLVFCPLGMGGAMGGLINCFIVDHYYGKKAAHSAGILALLVLSSCNYLCYNL
FT                   DRHFGWFGASEHPWWFHWRYPMIWAVGYFNGLLLFTDKGQERLARMGL"
FT   CDS_pept        join(complement(317075..317688),complement(316376..317015))
FT                   /codon_start=1
FT                   /gene_family="HOG000169953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207168"
FT                   /orf_name="AFUA_8G01300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85038.1"
FT                   /db_xref="HOGENOM:HBG057494"
FT                   /db_xref="UniParc:UPI00005206D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB74"
FT                   /transl_table=1
FT                   /translation="MSGRSRQTWANPSSSRTLGSNPSYVMSNLAENLGLAVLTVHLQIV
FT                   VSIMIGSLIINRRRGFSIFGSRATVDDDGSSTEDYPSKIPTICGITIEVPDSSRWAHHI
FT                   HSRILQKFPFLVEMFYWVVNYLFYSVTKATSQWLSPAEIGVVQVARDHGIGILNFEHHS
FT                   IARFFFPIEESDFQSFFLNGHQSIMTFFNRIYSLVHIPGTVLFLGWYYYAAENHNTFAV
FT                   ARRTMTLGNFAAFLIFCFYPCMPPRLLPDSYGFYDTVRQEHAESVWVGGKSVNQFAAMP
FT                   SLHFTYAFVIGCTFIYHSGLVHRLQGRPVRKSPFTQIFFIIMAVVYPLLVLSVIIATAN
FT                   HYWLDATVATFTVTICFLGNRVLLLLLPVEYCICWVLRLAKPVPTTGDRHLHKWRQSHG
FT                   DVPLLAEQDSDRFSDSVV"
FT   CDS_pept        join(complement(322051..322604),complement(320419..321997))
FT                   /codon_start=1
FT                   /gene_family="HOG000217345" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262256"
FT                   /orf_name="AFUA_8G01310"
FT                   /product="Ferric-chelate reductase (Fre2), putative "
FT                   /EC_number="1.16.1.-"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85037.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057493"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniParc:UPI000051FFEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB75"
FT                   /transl_table=1
FT                   /translation="MKLSQYRQKAQILLFLAIPVASHNTNGRPGHGLIGYGISMYKPVC
FT                   AYACRASITNPLVCDNTIDHDMAMDAASMAMDTPSPACYANNDPFLQTLAYCMYIHCAD
FT                   VSVSVLETYWELNVAGRQQHQPSPKESYQEALGSLARPPTLILNTSAVLDIPSLVEEET
FT                   YLSNHNTLRVFEAVETSHERYGLVLLLTGAIIPIASSLLRFVPFPAAWRVWFRAVFIDP
FT                   PFVGRRHSSPILDTFFMPTRGQALFIAYLLIINIVLCSVGFHSANPSIWFASKHDEILA
FT                   YVANRIGVLSFANIPLLVLYTGRNNFLLWLTDWSHSTFLLLHRWLAFICTLQACLHSAI
FT                   YLQIAVANNEHSTESKESFWIWGVVATLALAITIPSSAWPIRKRCYELFLAWHVVLSFL
FT                   ALLACYWHIWYRYGHQWGYETWIYVAFGIWAFERVFRVLRLARNGIHKAHVTVLDDEYI
FT                   KIEVPGVHAQGHVYLYFPTLTWRVWENHPFSAIASFRREDSIEKNIDVVPQDVESKYLS
FT                   KNGTSVTRCLDSDKPPSTSSQDLATGPYQPCLTFFVRTLSGTTRQLCARSQLPVLVEGS
FT                   YPPSPLISHHWSSHPNVIAIAGGVGITALVPNLCSHRGGHTLFWASRSKALIKSARETV
FT                   GDACWYNMNVRIYHDQRMDIPMLLTEEVRKYQCAPVFVVVSGPARMADEVRHVVADMVR
FT                   QNPSLLVSFVEESFTW"
FT   CDS_pept        join(complement(323836..323972),complement(323442..323787))
FT                   /codon_start=1
FT                   /gene_family="HOG000217346" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207169"
FT                   /orf_name="AFUA_8G01320"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85036.1"
FT                   /db_xref="HOGENOM:HBG057492"
FT                   /db_xref="UniParc:UPI000051ECBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB76"
FT                   /transl_table=1
FT                   /translation="MDLENESSNSSSGDGQGNGVRMSTSFHGGTRLNLPFYDQSTDSIA
FT                   VHLVAVRDILENKIIEARALEALGRLPFHRRTTRFKARFSPLPRFVRINRGDHAHAHTD
FT                   DEPIEMLAHRAERVGSHDSTTNNLFPMESTALRSVSYYVWMRALVEILRVLIAFVL"
FT   CDS_pept        326039..326746
FT                   /codon_start=1
FT                   /gene_family="HOG000217347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262257"
FT                   /orf_name="AFUA_8G01330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85035.1"
FT                   /db_xref="HOGENOM:HBG057491"
FT                   /db_xref="UniParc:UPI000051ECBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB77"
FT                   /transl_table=1
FT                   /translation="MAEPNEVRNAHLASKSIPQRRKPRKLRHKRPVSHGLDEEIEKEAI
FT                   VDTPASQRETVVFKTSEDQSNFEDALEEDSSVIEAQLQPVPERQRQTNRYKPFRDEEEG
FT                   DVAEGGGAPATAERQRLRRGRHGDRTLIQSNIIDGAGRTVGESQDLVLNRAEGVVGRVT
FT                   DTSGRVLGQPSEQSDQPKKEKDEPLKLRLDLNLDLEVQLKAKISGDVTLTLLLVYALSY
FT                   NEVGYSLRLIKRK"
FT   CDS_pept        330721..332547
FT                   /codon_start=1
FT                   /gene_family="HOG000159003" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055886"
FT                   /orf_name="AFUA_8G01340"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85034.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG057490"
FT                   /db_xref="HOGENOM:HBG328361"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051ECBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB78"
FT                   /transl_table=1
FT                   /translation="MDSNTDPYSEPPCPLQQLRTPAPISPSTLDPTEPVSCHREPISST
FT                   HKTTHSPYEVWGCDSNSTNGLVSPATRPSEPDLFNGLSTLIPGLRRLDYGARAATNAER
FT                   KITFLDGCRLYPKAMAWSAVVSSTLIMEGFDTLLLFTFFSLPAFKRYYGVPSKNGDFEI
FT                   PARWQFGLSTAIEVGEIAGLLLNGLLADRVGYRITISAAIVLLFFCILLPFFAVNLQML
FT                   LAGQILCGIPWGVFQTLTINYAAEVMPVALRAYLLSSINMCWVVGQLLATGVTRSLANN
FT                   ESTLSFRLPFGLQLAIGLPVLIGVILAPESPWWLIRHDRPEEAKRSLKRLTRSGVSVDQ
FT                   TAAMLTHTNEVEKHLMAGGAISYLDCFKRVDLRRTEITCCVWISQQLCGTSLKGWAAYY
FT                   YKQAGFDTSHAFDLSVGTFGLAIAGGVITWFLMPRVGRRRLYLSGLLVLFPTLLTAGCI
FT                   SVASSTQWRLWALGSFLIFMTFVYNITVGPICYVLVAEIPSTRLRVKTVVLARVAYNFS
FT                   GVLINWMTPNMLSPDEWDWKGKSCFFFAGTTLLCLLWCYWRLPETYGLSYLEIDILFEK
FT                   KAKKTKFRELQANLQDRGYFGLREDECPFRGY"
FT   CDS_pept        join(complement(335103..335805),complement(334178..335030),
FT                   complement(332736..333180))
FT                   /codon_start=1
FT                   /gene_family="HOG000217349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750585"
FT                   /orf_name="AFUA_8G01350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85033.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG057489"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI000051FDCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB79"
FT                   /transl_table=1
FT                   /translation="MRDEYAQAILSYSQQSVTRSLYAGVHFENLARYLQQPYEAQVPDL
FT                   VANKHDANIDPVFNFVTFYNLDPSTDIRETYISSPDVFESKAKELADSPYGRLIFMRGH
FT                   PSPEWLLTIGATYQVDPEFFRRHLDFRHGLRDHYSLPSLPSTLSTALTLRVATIGASVA
FT                   KTKTDSEQDTIEILREENKLRLNEYREKLKSLTQMKLGDSIVRDLSIHDLQQFSIEQDI
FT                   SLYVGTCGAGWFALIWLDTTSNWKEGATSFLTSPLRTGSWMIFSVPVIQHRAGLALRQP
FT                   RKLRERAAEEADTDGPKPSERMVQSACLLHLDYGLDLDKALAAGNSFYALHEILVFAAF
FT                   SENQFLNMLETKLLNELDPTFLVHQKNPTLSNLLYHQRILDRHIQRIKDNLAAFKGNGS
FT                   LGWPRSALEPGKQRIVDDVAETLIGDYEYLLSRSLTLSGQCSRGMQVVMNNAMIKESRD
FT                   AMSQAEGVVKLTRLAFIFVPLTFTASFFGMNFAQFGQGHLSLWIWFVVSTPVFILSLLL
FT                   MRRKRNKYSTYTTTTKCHAGKKTAEIAKDIEQSLIQNAARQASQHSSEMTQTEEEINGY
FT                   AVRAAQLANDIKDLTDQPVFWVVISYKDPPVLSTRSGSCGAGELWRRSDRLVENYSDKP
FT                   GEGSFPDRNIHGIGSSIASLDPGKFRLSPRW"
FT   CDS_pept        join(336369..336503,336559..336935,337003..337427,
FT                   337457..337588,337685..337734,337840..337980,3
FT                   37998..338015)
FT                   /codon_start=1
FT                   /gene_family="HOG000217350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262258"
FT                   /orf_name="AFUA_8G01360"
FT                   /product="Putative uncharacterized protein "
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL85032.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG057488"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="UniParc:UPI000051F430"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB80"
FT                   /transl_table=1
FT                   /translation="MGGGLLTQPMAFPQSNHATAPVPVIEHHSYFQLGDKRFLALPELE
FT                   LDLPTAITSLATVFQLGPTETPNSTWLQNQIQAWLHIDDIFQPEFLSGIIFVTEDNGIQ
FT                   PNLSASIESLPKEWKPDWWIFFNKEVGGQLHPGPRMVSYGKIHTVYRIYDDVNGAFMVA
FT                   IQPPITPGPFKNLHVSGDFYTSLGVAVSSRIPGVYAEDKPLGGVRFAIKDIFEVEGLRV
FT                   TAGDRAFYSLSKPAAVTCPAIKRLIDAGAELLGTLKLGSLIAREEPTESVDYHAPFNPR
FT                   ADGYQSAWSSSGGSGAAIASYDWVDFTLGTDKDPEWLTIMPQQQEAVGGPQWQMELSRS
FT                   ALRMTWFPWTMQYPLFQKWVGVWLNQTSAVYDDMQLIDSFIADMEATFGIKTEKVSIAD
FT                   TWKASPPNEAGNHTIQEYLKDSIQQI"
FT   CDS_pept        join(340262..340580,340694..340741,340824..340890,
FT                   340944..341223)
FT                   /codon_start=1
FT                   /gene_family="HOG000217351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750586"
FT                   /orf_name="AFUA_8G01370"
FT                   /product="CmcJ-like methyltransferase, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL85031.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG057487"
FT                   /db_xref="UniParc:UPI000052093E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB81"
FT                   /transl_table=1
FT                   /translation="MDDPGSTVQASMFFLTPDELHKQQRPYTFKFPPYNGCPQSNMTHE
FT                   KINGITVENMRGREDQFQLERNGFTILKVNTGLEYDDFFKQKGVTQYLRLMEGVLKARL
FT                   GANGTVYEYDQPTTVAHVDEIRRQYGKEADGLLKKRFQWINFWKPLRGPVNDWPLVLCD
FT                   SSLIDVRKDLAVADLLYPDLATENQVMYYRDGLKWYYLSDHEPSEIIVFKQMDSLNSAC
FT                   PGRWMSHKIKCLYIF"
FT   CDS_pept        join(complement(345071..345256),complement(344324..344510),
FT                   complement(343723..344067),complement(342621..343662),
FT                   complement(342106..342554),complement(341805..341996),
FT                   complement(341507..341709))
FT                   /codon_start=1
FT                   /gene_family="HOG000217352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262259"
FT                   /orf_name="AFUA_8G01380"
FT                   /product="NB-ARC and TPR domain protein "
FT                   /function="ATP binding"
FT                   /biological_process="apoptosis"
FT                   /protein_id="EAL85030.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="HOGENOM:HBG057485"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000051EA85"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB82"
FT                   /transl_table=1
FT                   /translation="MLPVREWSILLQQWTAFFDSTESRVNFFTYDYQITLDNTFSFRAL
FT                   LDKGHDLLAALNQHQQNLSGPEVSKIGAIREQQFALAGTHAELPRLQQLDGKPHYKVQE
FT                   WLRIVLSNNYRQAVERRLNPAGSSTTKEWQLIPILDGFHAPRRLAKLPCFMMDIPVRNN
FT                   AFFGRESIIEELDKYLLPPEKSSPFSLGDSHRRHVVLCGIGGIGKTSIAIEYVFSRKTK
FT                   FDAIFWIRSDEALKLEHDFCRIAVELGLQDANEPFNPVVCRELTKGWLENPIKVLDQEH
FT                   DIISQAEVQWLIVFDNADSPDLLQDYWPLSSNGSILVTSRDPLSKNSPSIAYRAIDLPP
FT                   LEDHEGAELLRRLSHVTDEEEVSVKIAVKLGGLPLAISQMAAVIRYQYLSFTEFYERYE
FT                   DEHDRRELHSFDAVIPRPEARGNIASIWAVEQLGNHAACLLEICAMLDPDRIQERLFSS
FT                   ELSALGWLEHFPKTSFAYSAARADLIKRSLITRDADKKEFRIHRVLQDSVLSKMSTEKM
FT                   LQTFSFSVDLVLAAWGSTPLVQRHVISLARSRDGLFPHALALRHMFERQYKAKNHGPGL
FT                   QIAKLMNEAGWYQHERGNSEDMKPFLTLALDICEQTPGPESAQLLADIHYGLAAAANET
FT                   NDGAACLSHTEQLLKLRLETSSSTGKNDIRLAIAHNEYGIALVMNNEYEKSIAAFKTSI
FT                   DVYRGLLDYWPSMDTNPRTNMSFTFWVMGDLDQAWQTLRDLLKLVECTTGLATFATTVA
FT                   NLRRARIGTREHSHSIKARLAIAITRLQISVIALLSIVYDAVKWSMLESVYLPELARTT
FT                   FLKAQLAMISGEVSEATDLFKKAKDMRCRIPHAPHKPDASLRESDFDRLVTFFSR"
FT   CDS_pept        join(351402..353175,353223..353287,353337..353561)
FT                   /codon_start=1
FT                   /gene_family="HOG000243980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055887"
FT                   /orf_name="AFUA_8G01390"
FT                   /product="Glycosyl hydrolase, putative "
FT                   /function="glucan 1,4-alpha-glucosidase activity "
FT                   /biological_process="polysaccharide metabolic process "
FT                   /protein_id="EAL85029.1"
FT                   /db_xref="GO:0004339"
FT                   /db_xref="GO:0005976"
FT                   /db_xref="HOGENOM:HBG057484"
FT                   /db_xref="HOGENOM:HBG553151"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI000051F679"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB83"
FT                   /transl_table=1
FT                   /translation="MERTNQLMMEGTTSPYTSIEDYGLVGDMHTCALISKTGSLDYMCW
FT                   PVFDSPSVFCRILDCTQGGHFSISPVPDIQPISKQRYRPYTNMLETRWINEQGVVSLLD
FT                   YLPISSHRSHPEWCICDDPIARNDPQRPCHSGVVRRVECVRGEMEMDFEIFPAFNYARD
FT                   RHTGHWIAPESSSGALRKYSFESETQKLDLTIHSGIDTSLEPADAISPVDLNLQEKEGP
FT                   KGPGLHARVRMIEGQSISFVLHNPETSLPEEGALRHYLDRLEKETLDFWVGWIAHCMFR
FT                   GHYREQVERSLLVLKLLTYKPTGAIVAAPTFSLPEYVGGSRNWDYRYSWLRDAAFVVYV
FT                   FLKNGYPLEAEAYINFIFDRVFPPVRDNECVADAPFLPIMVTIRGESDIPETELDHLEG
FT                   YKGSKPVRIGNAAATHIQLDIYGELMDSVYLYNKHGRPISYEQWVAIRRMMAHVIRVRN
FT                   EPDRSLWEVRGKEQNFVYSKIMLWVALDRAIRLTEKRSNLPCPDVDQWRRARDELYDEI
FT                   MTKGFNLKGKYFCMSYEDQDVLDAAVLIAPLVFFVAPNDPRFLSTLKKIMCAPAKGGLS
FT                   VANMVSRYDHTKVDDGIGGGEGAFVMVTFWLVEAMMRASKAMPYQKDDPLYPQLRKAAV
FT                   AHFDNMLSFANHLGMFSEEVAISGEQIGNTPQAFSHLACVSAAMNLGEQGER"
FT   CDS_pept        join(complement(354892..354927),complement(353934..354842))
FT                   /codon_start=1
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19055888"
FT                   /orf_name="AFUA_8G01400"
FT                   /product="Mitochondrial carrier protein (Pet8), putative "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85028.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057483"
FT                   /db_xref="HOGENOM:HBG333229"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051FDC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB84"
FT                   /transl_table=1
FT                   /translation="MSVDSSNKDVSFAAGIAAVGVELLTHPFDTLITRLQSPAYASTYQ
FT                   RANGRINPVLYRGLYQGFGPTIITSIPASVAFFTIYEATKSTLQPNEAIPSSKTRELAT
FT                   YAISSAVADLVACAITNPAEVLKQNAQVVHAQSEHSRSPLLSTVRHFSRHPTKLWAGYT
FT                   MLAAGHLPGTSLTFSMYEYLKSSWFEVPQGSSSDVRAHFKGSFYGGALASAAVSLLFVP
FT                   VDVVKTRMRLAAGTPIYARLPLKADIRPIPPSVKAEGISSANAVAVAKGILLKEGVQGL
FT                   FRGGALTCLAAGLGGGLFLGCYDALKVYFGGQG"
FT   CDS_pept        join(complement(356637..356792),complement(356215..356589),
FT                   complement(356109..356168),complement(355988..356057),
FT                   complement(355400..355935),complement(355245..355349))
FT                   /codon_start=1
FT                   /gene_family="HOG000169884" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI19902589"
FT                   /gene_name="chiB1"
FT                   /orf_name="AFUA_8G01410"
FT                   /product="Chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="EAL85027.1"
FT                   /db_xref="EMBL:AAO61686.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG741095"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="PDB:1W9P"
FT                   /db_xref="PDB:1W9U"
FT                   /db_xref="PDB:1W9V"
FT                   /db_xref="PDB:2A3A"
FT                   /db_xref="PDB:2A3B"
FT                   /db_xref="PDB:2A3C"
FT                   /db_xref="PDB:2A3E"
FT                   /db_xref="PDB:2IUZ"
FT                   /db_xref="PDB:3CH9"
FT                   /db_xref="PDB:3CHC"
FT                   /db_xref="PDB:3CHD"
FT                   /db_xref="PDB:3CHE"
FT                   /db_xref="PDB:3CHF"
FT                   /db_xref="UniParc:UPI000005F5EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q873X9"
FT                   /transl_table=1
FT                   /translation="MRFATSTIVKVALLLSSLCVDAAVMWNRDTSSTDLEARASSGYRS
FT                   VVYFVNWAIYGRNHNPQDLPVERLTHVLYAFANVRPETGEVYMTDSWADIEKHYPGDSW
FT                   SDTGNNVYGCIKQLYLLKKQNRNLKVLLSIGGWTYSPNFAPAASTDAGRKNFAKTAVKL
FT                   LQDLGFDGLDIDWEYPENDQQANDFVLLLKEVRTALDSYSAANAGGQHFLLTVASPAGP
FT                   DKIKVLHLKDMDQQLDFWNLMAYDYAGSFSSLSGHQANVYNDTSNPLSTPFNTQTALDL
FT                   YRAGGVPANKIVLGMPLYGRSFANTDGPGKPYNGVGQGSWENGVWDYKALPQAGATEHV
FT                   LPDIMASYSYDATNKFLISYDNPQVANLKSGYIKSLGLGGAMWWDSSSDKTGSDSLITT
FT                   VVNALGGTGVFEQSQNELDYPVSQYDNLRNGMQT"
FT   CDS_pept        join(complement(359542..359644),complement(358496..359463))
FT                   /codon_start=1
FT                   /gene_family="HOG000160969" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262260"
FT                   /orf_name="AFUA_8G01420"
FT                   /product="Quinone oxidoreductase, putative "
FT                   /EC_number="1.6.5.5"
FT                   /function="NADPH:quinone reductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85026.1"
FT                   /db_xref="GO:0003960"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057481"
FT                   /db_xref="HOGENOM:HBG325557"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniParc:UPI000051EA89"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB86"
FT                   /transl_table=1
FT                   /translation="MKEAIVNKEIKVEIKDVAVPKPGPDEVLIKVVVAGTNPKDWKLPS
FT                   WLPASNNTNTGDDIAGTVEAVGDNVFGFSKGDRAAAFHVMMTLHGAFAEYAIAPSNTVF
FT                   ALPSAVSYEEAATIPLAAFTSAVALFHQLRFPSPWDAEAAQDSNGKRPVIIYGASTAIG
FT                   AFAIKLAQAANIHPVIAVGSKNSEFVVPFLNPGKGDRIVDYTAYKTSDELAIALKDAIK
FT                   DAGVEDGRAYDAYDCVSENETYVTLSKVIAGPPDANGRKPRITHVLPVDESAADPSVEL
FT                   VRTSVAHVHKVPLFGTVWSAAFARGLRDGWLTAHPYEVVKGGLGGLEGALRGLKDGTVR
FT                   AKKMVIRIGETEGVAQ"
FT   CDS_pept        complement(362180..363289)
FT                   /codon_start=1
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750587"
FT                   /orf_name="AFUA_8G01430"
FT                   /product="Oxidoreductase, zinc-binding dehydrogenase
FT                   family, putative"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85025.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057480"
FT                   /db_xref="HOGENOM:HBG447528"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051ECB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB87"
FT                   /transl_table=1
FT                   /translation="MQSQKAVVTQSLGHAEFITNWPIPPLRNDDILVRTVAVALNPIDW
FT                   MLLETTPSPHAIMGHDYAGTVVAVGDSVRELFKVGDRVCGLVKGADNTRRESGTFAEYI
FT                   VAKAAIQMKIPDGVSFEDAATVGVGATTAGQCLFGPSCLKLQWPEAPNQIENRDTILVY
FT                   GGATSAGSWIIQFAKLYAHFLSSNDISLTVDRAGFTVLTTCSPNNFDLVRQYGADVVFD
FT                   YHDPVCARKIREHTSNTLRVVCDTVATQESVRICEAAIGDAGGLYHSLLPVQTTRADVQ
FT                   ATFANCCTMIGETFEYGPDRMVIPGMPAEFHFARKWAGIVSTLWSQRRIRTLVVEKREG
FT                   GLRKVLDGLEDLKNRSVRARKLVYLVSET"
FT   CDS_pept        complement(363722..364972)
FT                   /codon_start=1
FT                   /gene_family="HOG000217354" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207170"
FT                   /orf_name="AFUA_8G01440"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85024.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057479"
FT                   /db_xref="HOGENOM:HBG325556"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051ECB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB88"
FT                   /transl_table=1
FT                   /translation="MSLRKTSCRACVAAKRRCDHRVPSCSRCCKRSIACHYPYPPPQAK
FT                   GDRTTPLDDYVGSSLQLDPTLLSACGSSLKDSIQTTMISDRGDDPMWFPEGPPTSNQLW
FT                   NFPQGMSSWRPLPSSADGFASALPRLERRVLEFWPRVHDKETWGFCVRTFLGYIDHFLN
FT                   TGTMPLFGSLVDGPSDLPPLLREAYGVCAAYRTCKNAKKPFYSQLLNAAVNNMSQSTPT
FT                   QTDLRHQLGRIQALVLYYIIFITGGISDKQLLRHLDRMLAQGTADLERMELARRHAQDK
FT                   TQLDSHFSDSHLNDWVLCEGARRLVMISYLVRAVHSVIQFQRCDYIKYLVGLPVSTKSY
FT                   AELRWEEFIDEREQASVHPISGVISYDEFVSDWEQGGLVQVDEFRHLLLVACKGVASVQ
FT                   ERTPKEPVLTSDSFVHT"
FT   CDS_pept        join(365685..365749,365781..365839,365890..365944,
FT                   366006..366097,366170..366511,366605..366925,3
FT                   66985..367232)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262261"
FT                   /orf_name="AFUA_8G01450"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85023.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057478"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00005206E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB89"
FT                   /transl_table=1
FT                   /translation="MAVVLMATWEALSRWVVAATPHTMVSALVSGGPVSLVYGFILALI
FT                   GALATAASLGEMASMYPTAGGQYHFIAKLAPEQCRYMISWLVGWIGTFGWVAFTASAPF
FT                   LAATMIQGLVVLNYEEYQAKRWHGTLIYWALLAISAVVNIWGARLISLIENASSLIHLA
FT                   AFIAEFVVIWVCAPTKHSASFVFTLFRNESGWSSNGVAWSIGYDGAIHLSEEMTNAEVA
FT                   VPWCMLGSLAINGMLGFAFLLTVLFCMGDFEAALNTATGFPIIQIFYSITGSAAGSAAM
FT                   TSMLIIMAGLATIPLTASTARMLWSLTRDRAFPFSTYLSIIDKKTSLPVRSVFTTSGFL
FT                   VLLGLINIGSTTAFNAILSLAVLGLHMSYLIPTGFMLWRRLHTPEILAMGPGN"
FT   CDS_pept        complement(367339..367503)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262262"
FT                   /orf_name="AFUA_8G01460"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85022.1"
FT                   /db_xref="HOGENOM:HBG057477"
FT                   /db_xref="UniParc:UPI000051FDBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB90"
FT                   /transl_table=1
FT                   /translation="MISEQDQQLPSYQRRDLSHSCVCISITGPSYTFRPFHSQYVKLTI
FT                   STPPKISEA"
FT   CDS_pept        join(371272..372176,372234..372807)
FT                   /codon_start=1
FT                   /gene_family="HOG000234551" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262263"
FT                   /orf_name="AFUA_8G01470"
FT                   /product="Flavin containing amine oxidase, putative "
FT                   /EC_number="1.4.3.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85021.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057476"
FT                   /db_xref="HOGENOM:HBG431283"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI000051FB68"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB91"
FT                   /transl_table=1
FT                   /translation="MLFSKEGFLWTPVSTKEGLRTDAVIQSSVHIRQSYDVIVIGAGFA
FT                   GLIAARDLSQKHHLKVLIVEARDRIGGRTWTAQVLGEEMEMGGTWVHWAQPHLYAELHR
FT                   YGLHRNLKTSSGTYSPEKQFFKQAGRPVEEISLNKAAEALERVAQMFFTVDSTDSRGLM
FT                   PYPHDPLREPAKWKQYDHWTVKDRLDRLEGLPMWEKQLFESIISTFGSAPGKDIGFTEA
FT                   LRWFALGGHSMKGVFDLAGTYKLGNGGMTSLARAILDEFLGDILLNTAIKEIHQSSPGI
FT                   KVVTAEGQQLKAKTVISTIPLNCLGDVNFDPPLSPVREAAIAQGHINKGAKIHFKLKST
FT                   EAGWFVTTDPSGDSSYVFGFSDHNGTNSACQSGTWCIGFGYNGHLTDKNDHRHIIKKFQ
FT                   NDLRFSADIEAYATHDWMNDPYAKGAWACWGPSCASMYLEELQRAHGRVIFASADWANG
FT                   WRGFIDGAIERGQCAVQEVVKMLKEEYGTAQPHL"
FT   CDS_pept        374528..376246
FT                   /codon_start=1
FT                   /gene_family="HOG000217355" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262264"
FT                   /orf_name="AFUA_8G01480"
FT                   /product="Potassium channel, putative "
FT                   /function="potassium channel activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85020.1"
FT                   /db_xref="GO:0005267"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057474"
FT                   /db_xref="HOGENOM:HBG327288"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniParc:UPI000051ECB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB92"
FT                   /transl_table=1
FT                   /translation="MVRHALRLLHPNESLIRIRAVALKAVSLAFAVVAYLILLLTMVSK
FT                   HDPVKGFIVTVLCWCSSAATLLAVIGVIAREYAEVNPQQTLRYTQNYFYGTFAAGLYIL
FT                   VAVLLAIHTCSVRSVHLTHDERRTARSVHLTHDERRTVECTSIILRVGAFSVFLLAGAA
FT                   VYATIEGWTFMDALYWADYTLLTIGIGNIAPKTHLGRSLLFPYVSAGILNTGLVITSIT
FT                   SFTENIRELSIRFKMEEVHSGIQGRRPVDKCSSNSHSDREKQARETPAGSPYPNKDDLI
FT                   KLQRIKRDFYRRHRWMTLIFSGVALFFLWLVSAAIFRRSERSQKWTYFQALYFTYISLT
FT                   TIGYGDLYPTSNFGKTFFVFWSLLAVPVLTNLIAAMGQLGFEKLTYLLRYLWRLTSPRL
FT                   GRMNLDSQRGGTRNKSVQGPNLVIASNSHSPNLTNAGQLSNNIPGSSAYEKNGGGASLI
FT                   QAAQRSLLLGVEIGKLISTLQGSATTQIDLGSEWDRILPLLNPEDDGYGLLETTSPTTI
FT                   CSRGGTVLEILDSDMPATDKNKEILWMLKFLTEKVCSNLQEGLQTEESKRLGALS"
FT   CDS_pept        join(381181..381286,381344..381488,381531..381729,
FT                   381784..381907,381962..382078,382128..382181,
FT                   382233..383687,383705..383883)
FT                   /codon_start=1
FT                   /gene_family="HOG000020380" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207171"
FT                   /orf_name="AFUA_8G01490"
FT                   /product="Endoglucanase, putative "
FT                   /protein_id="EAL85019.1"
FT                   /db_xref="HOGENOM:HBG057473"
FT                   /db_xref="HOGENOM:HBG325552"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="UniParc:UPI000051F42F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB93"
FT                   /transl_table=1
FT                   /translation="MMHTMNVVLLAVGLLFDVAHAAVSQAYTWKNVVTGGGGGFVPGIV
FT                   FNPSAKGLAYARTDIGGAYRLNSDDTWTPLQDSVGNSNWHDWGVDALATDPIDTSRLYL
FT                   AVGMYTNEWDPNAGSIMRSTDQGNTWSETKLPFKVGGNMPGRGMGERLAVDPNKNSILY
FT                   YGARSGHGLWRSTDYGVTWSNVTSFIWTGTYFQDASSTYTSDPVGIAWVTFDSTSGSKG
FT                   SPTPRIFVGVADIGKSVFVSEDAGSTWSWVTGEPQYGFLPHKGVLSPAEKTLYISYSNG
FT                   AGPYDGTNGTVHKYNITSKVWTDISPTPMASTYYGYGGLSVDLQVPGTLMVAALNCWWP
FT                   DELIFRSVDSGATWSPIWAWNGYPNLDYYYSYDISNAPWLQDDTSTNQFPVRVGWMVEA
FT                   LAIDPFDSNHWLYGTGATIYGGHDLEKWDTVHNVTLKSLAVGIEEMAVLGLISPPGGPP
FT                   LLSAVGDVGGFYHADLDKAPAQSFHNPTYGTTNGIDYAGNKPSNLVRSGASDTLPTIAM
FT                   STDFGKTWSANYAASSTTPTGQVALSADADTVLLMNSNGAMVSKYSSTFSAVSSLPSGA
FT                   AIASDKSNNTVFYGGSAGSFYVSTDGATSFTKTASLGSSTAVNVIRAHPSIAGDVWATT
FT                   DTGLWHSTDYGKTFTKVGGGCTAGWSFGLGKASSTSSYAVIYGFFTIDGTTALFKTEDM
FT                   GTNWQMISDSSHGFGAASANVVNGDMSNYGRVFVGTNGRAEWKSPVSNSYRDYNKDDLD
FT                   KHQDVWYHDFSDNADHNQQDIYYNHQYVQNYDIVNCYRD"
FT   CDS_pept        384745..385890
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902590"
FT                   /orf_name="AFUA_8G01500"
FT                   /product="Pfs domain protein, putative "
FT                   /EC_number="2.4.2.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL85018.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG057472"
FT                   /db_xref="UniParc:UPI000051E5CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB94"
FT                   /transl_table=1
FT                   /translation="MFKHLNMVTSENDLISAVLSIAFQIYLTCSLITWFSLRDVTTSEC
FT                   PGSTNNFNVAIISASQQELTAVKALFDEDYGIVGDISGVHPLDTNAYVAGRIGNHKVIL
FT                   TQISKYGKVFAAKTSFWLSISFPQIRICLVVSTGAGVPCTKDGQEIRLGDVLVSEGIIE
FT                   YDLGKLLPGGVFLRKTGPLYDFPPPTGHIARLLNSVRRRQARDMLKERMSQHLNYLQAT
FT                   ISDLKATNYPSGEGNKLLPQLSLPCFPGSNSCVFNLEARNKNALFVAKCASLDSEPRVG
FT                   AWAWLDIPAIEYFRPNIHLGWLASGDRIMRSAESRDQIATQEGVIGFEWAGVGAWRQLP
FT                   TVVITGVGNYGDGYGTDPWPAYASASAASCAKAMLEVYNTL"
FT   CDS_pept        join(complement(386980..387106),complement(386535..386916),
FT                   complement(386248..386482))
FT                   /codon_start=1
FT                   /gene_family="HOG000169851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902591"
FT                   /orf_name="AFUA_8G01510"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85017.1"
FT                   /db_xref="HOGENOM:HBG057471"
FT                   /db_xref="HOGENOM:HBG590011"
FT                   /db_xref="UniParc:UPI00005206E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB95"
FT                   /transl_table=1
FT                   /translation="MGDADALPDYVLDPNAVLNDKAAAWRHGAPPDYSKTRAFYEETKQ
FT                   MTHEAGSLPDLVSSLVKNWEIEASFKTSLDDWRTIDHSKYTFSLNGGPPQTGDHMLWVG
FT                   TYNALLTSSAYYDPEHNDFSTSHKAFKRMMPTFAWEVLEVYSGPPVVIFKWRHWGYMKN
FT                   DYVGYNNRGEKVTVKAHGGLIDIQGIVIAKVNSSLQLEKIDVWFDPMDMFRQIAREEKI
FT                   EGENKEGVDAAGAAAGCPVMGHRSA"
FT   CDS_pept        join(389430..389577,389634..390331,390463..394258,
FT                   394323..394975)
FT                   /codon_start=1
FT                   /gene_family="HOG000169830" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262265"
FT                   /orf_name="AFUA_8G01520"
FT                   /product="Pectin methylesterase, putative "
FT                   /function="aspartyl esterase activity"
FT                   /function="pectinesterase activity"
FT                   /biological_process="cell wall modification"
FT                   /cellular_component="cell wall"
FT                   /protein_id="EAL85016.1"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0030599"
FT                   /db_xref="GO:0042545"
FT                   /db_xref="GO:0045330"
FT                   /db_xref="HOGENOM:HBG057470"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI0000520943"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB96"
FT                   /transl_table=1
FT                   /translation="MRFWHAWGLTGLATLAAALNATVGSTAAFTSTTVTAAPSTASTTT
FT                   LSSPTSSSVVVVATDSSGQFTAIGEAIAYAQRQGIPTVTVKAGTYTHAVTVSATPSVTI
FT                   IGETANENDYAQNQVTTSATNPLVISVNVLGITFSNVNFVNTATGSYGAATIRGSKNAF
FT                   YQCQFVSAGSLGITANLGLGIIANSYIEALDKVIYSYPTLYIYNTTVVPVGSSALVVYN
FT                   KGYTSGATLYNSTVVFDSCSVQQKAGTSNKNVYMAAANNGGGSVVIFRNTFLAGLIAAT
FT                   GSSSSAVATLTAVATSTAASTSSTTASVTPTAPTPSSTLVVSQNPTADQYANVSQAIAA
FT                   LPNDGQAYTIYIQAGTYTEQISITRAGKVTLRGETSFKNDYTQNLVTIQFSYGVLTSAG
FT                   QDENTPVIYAKKTDGSGLALYNIDSVTTYPQTKNTAALAADFYGSNMAAYGCSFIGYQD
FT                   SLLANKGVQVYSNCYIEGSVDFIWGFSTAYFHQCYIASNTAGAYIAAQSRSSSTAAGGY
FT                   VFDSCYVTYTNTYGTSLGQTYLCRPYSQYSIAVYMNSYLDKHINSAGWSIWSTSAPQTD
FT                   HVTFGEYNNSGPGAWSSSRASFATNLTADAASAYTLLSWIGDTSWLDMTAYNYVPSYSL
FT                   TGPSTSTNSSTTTPASTATPSATATATWGHPTSGTTPPAGAVIVSQGGSVNGSYSNLTD
FT                   ALAALPNDASTQIIFIYPGTYTEQVPSINRKGPVQTIGYQSGNPGKTYRTNQVTISFAR
FT                   GLSVSPLPTGHSDAETATLSTASNRIALYNIDIINSDNLDGSQSSYVTLAASIYGSQIG
FT                   FYGCSFIGWQDTLLTGSPAGYQYYESCYIEGAIDFIWGYSKAYFKGCTIGAKRAKSAIT
FT                   AQSRASSSAIGGYIFDECTFEAAPDATVDLTQTVYLGRPCSACALVVIKNSYLSDIIQP
FT                   AGWKIWSATDPRTDHITFAEFNNSGPGNWENNAAARQAFGNCTLLTSDTYTLEAVMEST
FT                   DWIDLTYWDAVTIPTGTPTTTATATATPIASPTPYGGTVPPVGAYIVSKTAIENITTYD
FT                   TIQSALNALPTSSKVAPTVFIYPGVYEEQLVLNRSGTTILIGYSTSTFDYNSNQVTIQY
FT                   NAAVDTQADQSNSDSATVYATGNYFQVININFVNDFGTTKNYASLGFAVKSSKYASLYG
FT                   CQVKGNQDALLINGYFFASNSYIEGNIDMIWGSGAGYFLKSAIAPNKDGINLTAHKRST
FT                   NTSAAGFVFDQCAIVPSTGAGTMSDISLGRPWNSLARVAYVDSYLDSCVTAAGWEQWSS
FT                   STPNTDGVVFGEYGNYGPGASTAQRASFATQLDGSGVSQFQLSSFFAVTSWIDFTHVSG
FT                   TPFVPGNIISTSVPVQSATPTSSTNVTPFTVTTTMTVTDKETLYTTLTSADKTSTTKYT
FT                   VTEDVGTTLSAAESFKTTTQKTTVTDTVIVTEPTVTSTKKVVVTSDVGVTITPAPSTST
FT                   STLKQTTTVVATTTQAPSTVTVKSTLTSSVATTVTAKAVTTTTTAVRTTTAITTFTPGT
FT                   AKVTLTATVTSGTGGTTTITAKANHKHPAKVKRSVIPRAGAAVTITDYTTLTTTAKTST
FT                   VKLPASTDIITVVTTKTTGKTTTLPASTSTITVLSTVTKGTTSTIPAVTSYVTQTSIST
FT                   IGKTTTRKAPTTIVTATLLATKTSTITIVGATQTVTSLKTTTIESTVSLPRRTLTVTKS
FT                   TVSTIHSTVTLATPTSTVVKTTTYRLKLSATFTSRATSTKTTTVKKTVTQTQTVTKTSK
FT                   GAGTCPTN"
FT   CDS_pept        join(complement(395525..395869),complement(395115..395453))
FT                   /codon_start=1
FT                   /gene_family="HOG000166324" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902592"
FT                   /orf_name="AFUA_8G01530"
FT                   /product="HHE domain protein"
FT                   /protein_id="EAL85015.1"
FT                   /db_xref="HOGENOM:HBG057469"
FT                   /db_xref="HOGENOM:HBG324792"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniParc:UPI000051F8E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB97"
FT                   /transl_table=1
FT                   /translation="MFPRCFASRATLTSRPSTLTPFPSTLIQNRTFAITSPTMTRLADA
FT                   IKDDHRELEEAYNKILSAKTSDEKTRWQNQFTWELARHSIGEELIVYPLMEKNLPNGKE
FT                   MADKDRAEHQIVKEHLYKFQSLSSEDAEFEPTLKSLWSNLGQHIKEEESDDLPSLEKTL
FT                   DQDDSEKHTKKFMRTKKFIPTRSHPSAPDKPPFETVAGLMAAPIDHLADLFRKFPEESK
FT                   SQLPP"
FT   CDS_pept        join(complement(397627..398548),complement(397472..397580),
FT                   complement(397237..397363))
FT                   /codon_start=1
FT                   /gene_family="HOG000048594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750588"
FT                   /orf_name="AFUA_8G01540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85014.1"
FT                   /db_xref="HOGENOM:HBG057468"
FT                   /db_xref="UniParc:UPI000051EF28"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB98"
FT                   /transl_table=1
FT                   /translation="MDGSRYQLVDSLYGPGTVGAWLLSLCAVLISWTLNTSSRRKDTIS
FT                   VDFITTLLLPFIAAGHAIFQITRLPAPVAEVITAQQVELQRYASALEAPLNICETFSVA
FT                   ALLLAVFCGPWWGSDPKWTRLGLVLIVGLLSWGTENIMFGLGTLKGVRAPEITLTRPYL
FT                   FFFTPIVASTWAFLALCLAVGAIVWIVSIGNNQATRRGLERRHLQRAPSRVFDESRPYK
FT                   PSQITQETRDYALHELQALEPMSRSIQMVTFVSILFLPFSLIASTFGFMTVDMKSLSST
FT                   SQNQFILIPNSNGPLSHLDQLLALVGDVKWDMFQNLLSRDDVPYDKRKFQVDKQQPWLS
FT                   TTLPWLGCERGIHVAMWDGSARRQRGASRVRGFKWRRYSCQMCLH"
FT   CDS_pept        join(complement(399882..400441),complement(399634..399826))
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262266"
FT                   /orf_name="AFUA_8G01550"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family superfamily "
FT                   /EC_number="1.1.1.100"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase
FT                   activity"
FT                   /function="binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85013.1"
FT                   /db_xref="GO:0004316"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057467"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051E5CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WB99"
FT                   /transl_table=1
FT                   /translation="MVRKVVVVTGSASGMGLATATSLASSGAHLALWDINSSKLKEIAK
FT                   SFKAQYSGKILAQTVDVSDRSAVKAALMEAQHHLGPINAIANFAGTGGHQLGVEPIWET
FT                   SDEEFEFITNLNIRGLFNILGEALTPGFLGELQSIVHIASMFGTRGYKNGAVFAASKHA
FT                   AVGMVKSAALEVGSRGIRVNCILPGPIDTPMFHQVRENAGLSSSASDTPIPRPGQPEEV
FT                   ASIAVFLLGDQSSYVTGAVWNVDGGANA"
FT   CDS_pept        join(complement(402657..402815),complement(402525..402603),
FT                   complement(402331..402471),complement(402170..402283),
FT                   complement(401927..402121),complement(401581..401876))
FT                   /codon_start=1
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902593"
FT                   /orf_name="AFUA_8G01560"
FT                   /product="Aldo-keto reductase (YakC), putative "
FT                   /EC_number="1.1.1.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85012.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057466"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000052093D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA0"
FT                   /transl_table=1
FT                   /translation="MVKTLPFGDIQVPSPGFGAMGLSFGLGTNLTFEEAEPVLLKAIEL
FT                   GCTFWDTAVVYQAGVNEKLLGDFIRKHNVRDKVFIASKCGFNVFGDRSVTNSPAHIKEY
FT                   IEGTIERLGFAPDLYYLHRIDPKTPLEESIPALDEIRKAGKTKYIGLSECSAATLRKAN
FT                   SIAKIDAVQAEYSAFETIHETDGLIDTCRELGVAYVAYSPLGHGWLVDDFQYKSPDDFA
FT                   PNDFRRTSPKFQGENFYKNRAIVEEIKKLAARKKCTTSQIALAWVAAQGFIAIPGTTKA
FT                   KRLEENWASREIELTEEEKQEMRRIIDVAKPHGNRYGPENQALVGH"
FT   CDS_pept        join(403911..404065,404121..404353,404523..405001)
FT                   /codon_start=1
FT                   /gene_family="HOG000005595" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750589"
FT                   /orf_name="AFUA_8G01570"
FT                   /product="ADP-ribosylglycohydrolase family protein "
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL85011.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG057465"
FT                   /db_xref="HOGENOM:HBG700104"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="UniParc:UPI000051F678"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA1"
FT                   /transl_table=1
FT                   /translation="METPAVQSRIKGSIFGVAVVDALGGPVEFQPRGSFIPVTHFIHND
FT                   TFDVPPGTWTDDTSMTLCLARSLIASKGNFIPQAAIRNYVKWHENGYLSATDECFDIGS
FT                   RTRQALMIWRRYFDRSPHIRENDPNALSNAALSSNATHPYPTCAECCQIYTRLIVRALN
FT                   GASKEDLAEEFARINFTDVKVKQRLDRYSSLTDWENTDEEHIKSSGYVLSTLEAALWAF
FT                   FTTSTFKSGAVKVVNLGDDADTVGAVYGGLAGSYYGLEEIPADWIASLQKKNVVEEIAS
FT                   GLCSLPE"
FT   CDS_pept        join(405654..405803,405948..406642,406732..406866,
FT                   406983..407154)
FT                   /codon_start=1
FT                   /gene_family="HOG000200289" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262267"
FT                   /orf_name="AFUA_8G01580"
FT                   /product="Aminotransferase, classes I and II family "
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="EAL85010.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG057463"
FT                   /db_xref="HOGENOM:HBG324870"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051EF23"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA2"
FT                   /transl_table=1
FT                   /translation="MLSARGETYAKAGLANSYLEALKTPYNKDNKQGVVSFRNAENVLS
FT                   HILLLVASRLDHSDLTYHEGPFGSRRLRAAMANHITTYFHPATPISPDHIIFANGVTSL
FT                   NALCALSLTDPGDGILLGQPIYGSFNGDLRVPSGCQLIYTSFHGDDQFSPDAVTRYEEA
FT                   FLQARETGVTARALLICNPHNPLGRCYPRETLEALLQFCQKYQLHLISDEVYALSVYDD
FT                   ADSTDGFVSVLSIDPVPLGVDPALIHVLYGMSKDFAASGLRLGCLISRNKRFLQAVLSM
FT                   SIAAAVLEDQGFVESFLQKSRRLLRSQRDLAARALDEAGIPYAQGAIVTSQDGWAAELA
FT                   LSRQLQQIGVEMSTGYAYHNEVPGWFRVIFSLDEESLKEGLSR"
FT   rRNA            407428..407543
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(408595..408624),complement(407696..408535))
FT                   /codon_start=1
FT                   /gene_family="HOG000048593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262268"
FT                   /orf_name="AFUA_8G01590"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85009.1"
FT                   /db_xref="HOGENOM:HBG057462"
FT                   /db_xref="HOGENOM:HBG325548"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051FFF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA3"
FT                   /transl_table=1
FT                   /translation="MEGPLRPFTDPASKASDRACPLDDKELDSLSDESLADLLNSAPIL
FT                   YGLGQTTVVRLSQNLVLKGGGNGLPCEAKVLQLVASRSNIRAPRVHRPLQVTDDTKYFG
FT                   TMGYIVMDYIDGEPLDGCWGDLSDEQKMDIAKQTAQMILEMQSLKLLEPGPIGGGPCRG
FT                   RFFTHYSAGPFKDASEFEGWFNHKLDICKKHNHAPQDLPPFKFTQFVLTHQDISPRNLI
FT                   LDRTGLVWLVDWADAGSYPPAFETAALSSQSQFVDFNEMVLSLLPRYPLEEQQLDSIGY
FT                   GLSIAALA"
FT   CDS_pept        complement(410711..411808)
FT                   /codon_start=1
FT                   /gene_family="HOG000217606" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262269"
FT                   /orf_name="AFUA_8G01600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85008.1"
FT                   /db_xref="HOGENOM:HBG057461"
FT                   /db_xref="UniParc:UPI000052046C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA4"
FT                   /transl_table=1
FT                   /translation="MAPFFVLTYILTCNSGNDPRSPFLAQALAALLVSVSPVLESLSFC
FT                   PVGYEEPKLLRLEAEADGEPLPIADYVFKHFLELVREKDMPFLQNLRAVRFLIDPNTCV
FT                   YRTSDYQPYDLFSSLNLVRRLPAMETVHVDAICDPDLPSVEPPPQSGNYTCISIQHSSL
FT                   HCPYLVYTIESAKRLEQFTYGIGGRFSRNGMLTSFHPECVFRALFAHRATLRQLDLDVE
FT                   GQTRQLDLVGLRYLKYTPEEEEEQGSHRDDPVYLYEWADELEKLPVKKEQIPSNVSVDA
FT                   WPLRSCLELKDLSLGIHILYIYARGYGGDQCGDQWGDHSVDDSFSLVDHLPPNLESLRI
FT                   YGYKKEMKPRLRGVPQNCLKTSLLS"
FT   CDS_pept        join(complement(413790..413933),complement(412635..412874))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207172"
FT                   /orf_name="AFUA_8G01610"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85007.1"
FT                   /db_xref="HOGENOM:HBG057460"
FT                   /db_xref="UniParc:UPI000051F683"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA5"
FT                   /transl_table=1
FT                   /translation="MKPTLAAFLVLAIGVLDCVATEPAEPSQTLAQSPTDADPWKWCQT
FT                   SITARGKEDAAADAGDDLVDDDLGPAEVGVDADVQACGEGHKRVPVQMDGLLSAPAGEG
FT                   EAGEDGSPPGIVGALHHFIASET"
FT   CDS_pept        415780..416730
FT                   /codon_start=1
FT                   /gene_family="HOG000048591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902594"
FT                   /orf_name="AFUA_8G01620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85006.1"
FT                   /db_xref="HOGENOM:HBG057459"
FT                   /db_xref="UniParc:UPI0000520477"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA6"
FT                   /transl_table=1
FT                   /translation="MIVNRSLLLYWILGCHLMAPSIAGNHYQDGSNLKYAVPDHKRVSI
FT                   IKIESDGISCPSGFKSASRQNIPGVGLTCLQIDRNMAGNSPVRENKATCCTKDYQDVFL
FT                   VSIAGHDTPRPRALYTLDAKTCCPSNQVQAETGVQQCKYEGKSLKVQYGELTHCCWDTA
FT                   RKDFHAHLKDYSVGIRVPLNNDTTLPLDNPVCKSVYIKAGIATARASNVQIDVFAELRC
FT                   GTFGNKSYKQTLTINFNRNQRKAGTFTFGFSVGNAVVDISSQLAETGPSSGHYDIKLHG
FT                   DVFGTAILGSVHVPFDHAISHNEYLDSYIGVNGVC"
FT   CDS_pept        complement(424867..426099)
FT                   /codon_start=1
FT                   /gene_family="HOG000241050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262270"
FT                   /orf_name="AFUA_8G01630"
FT                   /product="Pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /EC_number="1.6.99.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85005.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057458"
FT                   /db_xref="HOGENOM:HBG289292"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniParc:UPI000051E5DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA7"
FT                   /transl_table=1
FT                   /translation="MSSKIVIIGAGFAGVWSALSAKRLITCRSKESEVEIIVIAPEPVL
FT                   VMRPRLYESKASSLIHPLETLFEEAGIRFVPGVVKTIHTERRAVEVQCASGFESTIDYD
FT                   RLILAAGSSVVRPQGVAGIRQHAFDIDSLNSAVKLESHLNGLASLPASPGRDTVVVCGA
FT                   GFTGIELAAELPRRLGHIANARVILIRNADEVGPDFGSSPRSTITQALKDLGVEVRLGS
FT                   GVKAVDPDGVTLASGERIQTKTAIWTAGVRATPLTQQIPGPKDALARLYVDQYLRVSSV
FT                   DGVFATGDAACALADGKNQYSLMCCQHALQLGRVSGYNAAAELLGERLMGYTQAAYNCC
FT                   LDLGSWGALVTAGWERENIKISGDIAKRVKCYINQQLIYPPTDAHQALAFADPVGPDSD
FT                   QLFEHLVRVVG"
FT   rRNA            427204..427319
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        complement(430403..433447)
FT                   /codon_start=1
FT                   /gene_family="HOG000216790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262271"
FT                   /orf_name="AFUA_8G01640"
FT                   /product="NRPS-like enzyme, putative "
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /protein_id="EAL85004.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG057457"
FT                   /db_xref="HOGENOM:HBG325544"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000051FDBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA8"
FT                   /transl_table=1
FT                   /translation="MVFSEENQLDLGLGALFKAQVSENGAAVAVESDGHALSYADLHSK
FT                   ALYLAYQIQRLCPCDGTPVGILIPRGINHILGQVAVLYLGRSCVPLDFKLPDDHLNNML
FT                   HDIGTNLVICDQETTHRLPTFTHVLADHTIEAPGPSFEPLLKGPKSCSHILHTSGTTGK
FT                   PKAIEIFAEGLINILLDPSSFVKKGDRVGHITSVAFDASLVDIWGSLVNGATIVCIPME
FT                   TVLDPLELSRQIKSLKLNVMQITTSLLNITAYASPSAFSSLETLITGGEAINVQTIRTI
FT                   FEGGPPRRIINGYGPTECSVYTLWHPVSREEAQRGEIPVGKPFCNVQTCLVDENLIPVK
FT                   AGVIGELLIAGAGVAGGYIGEPEKTAKSFVSLPHLPLHSNRGPGHIYRTGDLMRMDEDG
FT                   VYYYIGRKDSQIKIRGQRVEIEALESNLVQLKAVSAAAVIKITPKGAGRNPFLVAFCVP
FT                   ISPCITAAAITKEYVERYTHHIVPRIEVVASLPLKTNGKTDRKELEHRYLAKITDSCMT
FT                   SRYAGKDIGNVEAKLKALCVDILSLPTEDIDPTDDFMAMGTNSLMVAILLARINRTFGV
FT                   SLGASKIYENPTLRSLTNLLETTQGHSTELTNEAEQELWLQDTQLGQHLRPLPGTVVDW
FT                   EDVSEGRVFLTGATGFVGAFFLAELLRMPTVKKVACLIRAKDQAAGRLRLENVLRKYQI
FT                   YSDLDKVVVLPGSFSEANLGLNRKDYDYYAEWASVVFHLGAKVSYVAPYSSHRMDNVVG
FT                   TCNILEFASHKRPKATHYTSTIAVYGPTGLVTGTKFVHEDERPASHLAALHYDMGYAQS
FT                   QWVAEAIAWNAIDNGLPVAIYRPGFVLGHSQTGVCNPDDFVGRVFASCMAMGRYPLLPN
FT                   QRKEFVPVDYIVHALLHISKSKDNLGHAYNLVHPDKTHAIDLCTSFNLLKTICPYPMHG
FT                   VTYTEWVQSLSLSPEDPLYPLVPMLKERVLGERTRWEVYENMVEYGRDNLHKAIKDAPD
FT                   ILACGPMDQLFSRYLRSWLPTSCAN"
FT   CDS_pept        437548..437727
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750590"
FT                   /orf_name="AFUA_8G01650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85003.1"
FT                   /db_xref="HOGENOM:HBG057456"
FT                   /db_xref="UniParc:UPI000051FFF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBA9"
FT                   /transl_table=1
FT                   /translation="MLLHNCRRSSALWNPRRPIFLRKEIEAPRRSSSYFLNFIILSLLN
FT                   PVEAATSSFVKKPA"
FT   CDS_pept        438322..438765
FT                   /codon_start=1
FT                   /gene_family="HOG000048590" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902595"
FT                   /orf_name="AFUA_8G01660"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85002.1"
FT                   /db_xref="HOGENOM:HBG057455"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051E5D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB0"
FT                   /transl_table=1
FT                   /translation="MLQSKITLHPAVQADALPLAKLHNAAFANDALLEAMYGPLTQNDP
FT                   PFANDLRQIIADDPHSRITKAIDTESGQIVAWSWWSIYPDAEAHASAAEVARERWTTPP
FT                   PTSLCPRLYLDFQDMKARMREKWIGGRAAASKLASLLQCLIWV"
FT   CDS_pept        complement(439266..441545)
FT                   /codon_start=1
FT                   /gene_family="HOG000218110" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI20750591"
FT                   /gene_name="katG"
FT                   /gene_synonym="CAT2"
FT                   /orf_name="AFUA_8G01670"
FT                   /product="Catalase-peroxidase "
FT                   /EC_number="1.11.1.6"
FT                   /EC_number="1.11.1.7"
FT                   /function="catalase activity"
FT                   /function="heme binding"
FT                   /biological_process="hydrogen peroxide catabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85001.1"
FT                   /db_xref="EMBL:AAM95780.1"
FT                   /db_xref="GO:0004096"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0042744"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG285610"
FT                   /db_xref="HSSP:1ITK"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI000019B4D3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Z7W6"
FT                   /transl_table=1
FT                   /translation="MTQDKCPFKEQSSQPNFAGGGTSNKDWWPDRLKLNILRQHTAVSN
FT                   PLDADFDYAAAFNSLDYEGLKKDLRALMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRV
FT                   FDGRGGAGQGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWADLLILTGNVALE
FT                   SMGFKTFGFAGGRPDTWEADEATYWGRETTWLGNDARYAKGFSGSDKRGSLIADEESHK
FT                   TTHSRELETPLAAAHMGLIYVNPEGPDGNPDPVAAAHDIRDTFGRMAMNDEETVALIAG
FT                   GHTFGKTHGAAPADNVGKEPEAAGLEAQGLGWANKHGSGKGPHTITSGLEVTWTKTPTQ
FT                   WNNNFLEYLFKFEWELTKSPAGAHQWVAKNADEIIPDAYDASKKHKPTMLTTDLSLRFD
FT                   PAYEKIARRFLEHPDQFADAFARAWFKLTHRDMGPRARYLGPEVPSEVLIWQDPIPAVN
FT                   HPLVDASDIAALKDEILASGVPPRSFISTAWAAASTFRGSDKRGGANGARIRLAPQRDW
FT                   EVNNQPWLREALSALEAVQSRFNARGDSKKVSLADLIVLAGCAAVEKAAQDAGHPIKVP
FT                   FVPGRMDASQEETDVQSFNHMEPFADGFRNFAKGPARPRAEHYLVDKAQLLNLSAPEMT
FT                   VLVGGLRVLNTNYDGSTHGVFTSRPGALTNDFFVHLLDMNTAWKDVGNGELFEGSDRKT
FT                   GGKKWTATRADLVFGSNAELRAIAEVYASNDGDMKFVKDFVAAWNKVMNLDRFDLKGKQ
FT                   TIPARL"
FT   CDS_pept        complement(444209..444568)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262272"
FT                   /orf_name="AFUA_8G01680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85000.1"
FT                   /db_xref="HOGENOM:HBG057452"
FT                   /db_xref="UniParc:UPI000052046B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB2"
FT                   /transl_table=1
FT                   /translation="MSQWHQPMEMADAPIPSHHAIIHPRKIFSASIIGFDLMATPGHVL
FT                   NVMECAANSCRTSQKLGGWSCDAIQGRDSGIDGLMWTPVVSARWLSVFWISGLCGITNK
FT                   VVEINQPWQDSQGSF"
FT   CDS_pept        join(444779..444922,444975..445078,445130..445256)
FT                   /codon_start=1
FT                   /gene_family="HOG000169808" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262273"
FT                   /orf_name="AFUA_8G01690"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84999.1"
FT                   /db_xref="HOGENOM:HBG057451"
FT                   /db_xref="HOGENOM:HBG325540"
FT                   /db_xref="InterPro:IPR021128"
FT                   /db_xref="UniParc:UPI000052046F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB3"
FT                   /transl_table=1
FT                   /translation="MVSTAITRPASLVVRFMQWSSAVIVMGITSYFINKWPHTQHTIYW
FT                   EVISTMSVVFFLPAFLSPFMPTRLSRFVLPIDVIFSYLWLTAFIFAAQDYNWHNCAVNA
FT                   PPGASCALKKANESFIFLAL"
FT   CDS_pept        join(446371..446892,446945..447129,447178..447862)
FT                   /codon_start=1
FT                   /gene_family="HOG000169797" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055889"
FT                   /orf_name="AFUA_8G01700"
FT                   /product="Haloalkane dehalogenase family protein "
FT                   /EC_number="3.-.-.-"
FT                   /function="hydrolase activity"
FT                   /protein_id="EAL84998.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG057450"
FT                   /db_xref="HOGENOM:HBG325539"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="UniParc:UPI000052046A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB4"
FT                   /transl_table=1
FT                   /translation="MTSAYSKVKELTTASIAQVLTVSGYLSAFLLSFTINRAFLASALL
FT                   PLYLLSLAYRVLPTIFRNAPRLLLPNWWKTLVKDAEQYRQRVDALAQSQLEGTYRFKDD
FT                   EILRTDRKGKGWMADMPWRDNVEEFSVCGATARYVHLKPSYRSIATDNKASHRPIVFLH
FT                   GNPSWSYMWRNVFPALVERGHEVYALDWLGHGRSDKITRPEAITFELHMRTLQQFFEST
FT                   GLDNTTIVAHDWGGCVALSTLSRLPTSACTSLFLLNSFFPLRISEISMHYALLHAIWFM
FT                   TTGILGGRTPESAVMRFMSPSISQNDVTGYAAPYRNIPSNAKSSIYRFSHMAPATPRIV
FT                   LRSLRYTWLWELVEGLAGPSNFDNLTAQARLSLRNEGVRSFWKSSDRAHQLEVAVVFGD
FT                   KDPLLKDYKDILVRGVDSRVMVDWAPYGIWLDGAGHYPAEEKPKAVGDLIARLARYREP
FT                   TVMQR"
FT   CDS_pept        449689..450192
FT                   /codon_start=1
FT                   /gene_family="HOG000169785" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262274"
FT                   /orf_name="AFUA_8G01710"
FT                   /product="Antigenic thaumatin domain protein, putative "
FT                   /protein_id="EAL84997.1"
FT                   /db_xref="HOGENOM:HBG057449"
FT                   /db_xref="HOGENOM:HBG325538"
FT                   /db_xref="UniParc:UPI000051F1A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB5"
FT                   /transl_table=1
FT                   /translation="MSFSKFFSLAAAFALTASALPLAPRAPSGGVQIVNNMGENVYLWS
FT                   VSDTSSDMQTIQPGSSYVETWRTNPNGGGVSIKISTAADLASVLQFEYTEAGETLFWDL
FT                   SSINLSPDSPLIAAGFGVSIDDASCPTASCAPGDVNCAESYQFPDDHNTRACGTGAAFT
FT                   LTLG"
FT   CDS_pept        join(complement(451732..452479),complement(451309..451682))
FT                   /codon_start=1
FT                   /gene_family="HOG000217357" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750592"
FT                   /orf_name="AFUA_8G01720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84996.2"
FT                   /db_xref="HOGENOM:HBG057448"
FT                   /db_xref="UniParc:UPI0000F51AE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB6"
FT                   /transl_table=1
FT                   /translation="MDYSGFLRAGTMSNDLYTLDPHGDVMLLFPGVSRASPPSPSLETS
FT                   FPTSVMTDASAVEQDTSDDNTTSDREALQHQPSTSEVSDASEEGHSVSSLIGMRVSSRH
FT                   LALASPVFMRMFNGNWHEAREIRSEGIVVLIMDIWDVDITLILMNILHGYAPQVPRKVD
FT                   LDTLAKIAVMVDYYQCRGAVEVFADIWVDGLKADMPKAFGKPVLQWICIAWVFRKPTEF
FT                   FAATRVTLVQSPGVVHAYGLPIPNRVIETINEAREQGIREALAAIDRLIDDLSSSTHRC
FT                   SFECSSILLGALIKFLRLSSLIFPDPRPPYDTLSIGSLTRSIILFARSPLWEARLSTKG
FT                   RPEWHSCRLGTLLDPVRRGLEPKMNGLKLEDFE"
FT   CDS_pept        join(complement(454476..454521),complement(453978..454413),
FT                   complement(453417..453909))
FT                   /codon_start=1
FT                   /gene_family="HOG000169763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207173"
FT                   /orf_name="AFUA_8G01730"
FT                   /product="Glycosyl transferase family protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL84995.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG057447"
FT                   /db_xref="HOGENOM:HBG325536"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI000051ECB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB7"
FT                   /transl_table=1
FT                   /translation="MRLSNGAHRTIAATKVWATLVTNTNYLPGLFTLEYSLRKVGSKYA
FT                   LVVLYTDSFPAEGHAAVNARGLPKQRVPHLLPTLAKEYTNDPRFHDTWTKLTAFSLVEY
FT                   ERVVLLDSDMLVMQNMDELMDMALDAPELEGSGSRVFAASHACVCNPLKKPHYPKNWIP
FT                   ANCAFTSQHATPDKAQTNGAPSDRGLGLCNSGLLVINPSKGVYDRIIDQLNSPATMNYT
FT                   FPDQDLLSDVFRGRWVGIPYIYNALKTLRRKGVHDTIWRDDKVKNVHYILSPKPWDEID
FT                   SAAEGQGIGRRRTASLDPTHEWWWRVTEERREDEKKSSVADAF"
FT   CDS_pept        join(complement(457592..457913),complement(457329..457527),
FT                   complement(457140..457283),complement(456963..457091),
FT                   complement(456372..456888),complement(456267..456321),
FT                   complement(455680..456206))
FT                   /codon_start=1
FT                   /gene_family="HOG000160947" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902596"
FT                   /orf_name="AFUA_8G01750"
FT                   /product="Acyl-CoA oxidase, putative "
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84993.2"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057445"
FT                   /db_xref="HOGENOM:HBG325535"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniParc:UPI0000F51AED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBB9"
FT                   /transl_table=1
FT                   /translation="MYLLSTKKSFAQPPPEYKSPLLAGRELWIAYPSTSTARRPDHNML
FT                   PSEPKAFDAGQPVHSGQALYKWVWQSPSPTLELAQSPCFRSPASFLTLEERTRFTYERA
FT                   KKICLAVDDILTLSPKFWKLQTEPIAAVDGGALTLISIQYNLFIDTVAPFAASRPDLQW
FT                   ILQRALSFDISADSKDGLRAQFMLTEVGHGLDARNLKTTATLLPDGSFELHSPSWAAAK
FT                   FMPPTTPRSGLPVVAVVIARLIVGGENYGVRPFLVPLGDGHEMALPPRAGAHPVDHALI
FT                   LFKRVVLPNSALLGSLEKPRNERDHFFATIHRVSAGTVFLSGASTPALQLAVYNAAQFS
FT                   LRRRVTGHDGNPMAVIKFCTQHLPILHAIAQYRVLQAFLVEAATTFRNRKVDPRVRHAI
FT                   ATVSKAVALQHFQKSIKALNDECGWHGYCGHNQILQLELEFRAVGTAEGDIRVLAIRLA
FT                   SELLIGRYQLPSPRDPNSAVARHEAALLTEAKYRLIEFGGVHRSEDFNRNILPLSLPMI
FT                   QAIGHRMALEAAKDANIDSNLCALYESGVILEDSAWYTEQGGISRRVQREMEAQAADTL
FT                   LPDLERLVYETGAGPYSSAPMTSERLWNTFVSELETYSGEAFLNIGASPVQANL"
FT   CDS_pept        join(460433..460794,460855..461122)
FT                   /codon_start=1
FT                   /gene_family="HOG000217358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262275"
FT                   /orf_name="AFUA_8G01760"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84992.1"
FT                   /db_xref="HOGENOM:HBG057444"
FT                   /db_xref="UniParc:UPI000051EA83"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC0"
FT                   /transl_table=1
FT                   /translation="MAMNTCWSIGYAQNCNSGIQHINIAFIPTFTPYSHRLHLLIIKSF
FT                   PSPQVQFCTMKLTTVSILAAVSSALAVPTNIKRDSYIQISDFWARAGPTSPGASMHFVV
FT                   TDPNYPEDTPTDCNLIWTYGHAAKEGARCNNGEYYIKFPNGAPDFNLFTLELQRVSGPI
FT                   AEDGHVLLSSNANGGAPGTKWICVNDPKPGVEISCSYDGVLQMQVA"
FT   CDS_pept        join(461720..462100,462232..462696)
FT                   /codon_start=1
FT                   /gene_family="HOG000217360" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262276"
FT                   /orf_name="AFUA_8G01770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84991.1"
FT                   /db_xref="HOGENOM:HBG057443"
FT                   /db_xref="UniParc:UPI000051F677"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC1"
FT                   /transl_table=1
FT                   /translation="MVRFSLLLLASAISLTATASWLKRDTLKPFQEGRFAPSNNASTSL
FT                   AYDNNLLPRYYDCLPGAHLCDAGQCCDFTCCSDGSCCGAAELCYNDVKPSKGPTYCCKI
FT                   YTEKECDTRCVPMMSECCGDGYYCKWGHTCSGSYDDDDDVGSGGDSGDYDSTTSSTSYD
FT                   ITTSYTSTEREVSTTSEYTTRTEERTTTSESSTRTRATDTDDVWETTETDSSTSTSTSS
FT                   RWTMTDFPTGLDFTPAQSFVPAPVPTGPVPLSGANKNSLSSLDMGLLVIVTGAGWYLAL
FT                   "
FT   CDS_pept        join(complement(466670..466824),complement(466002..466584),
FT                   complement(465732..465950))
FT                   /codon_start=1
FT                   /gene_family="HOG000256364" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207174"
FT                   /orf_name="AFUA_8G01780"
FT                   /product="Nitrilase, putative"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /biological_process="nitrogen compound metabolic process "
FT                   /protein_id="EAL84990.1"
FT                   /db_xref="GO:0006807"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG057441"
FT                   /db_xref="HOGENOM:HBG747812"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniParc:UPI000051F67F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC2"
FT                   /transl_table=1
FT                   /translation="MTKVRVGAVQAEPVWNDLQGSVAKTIKLIKEAGEKGINVLGFPEV
FT                   WIPGYLWSMWTNSPIDNVQLLHEYMANSLVRNSPEMDAIRAAVREAGIFIVLGYSERDA
FT                   GSIYMAQSFISPEGEIVHHRRKLKPTHVERSIWGDSQADSLKTVVDSPFGKIGGLNCWE
FT                   HLQPLLRYYEYEQGVQIHVASWPAMFPMTKSVPWGFCATGDGSKLASQFMAIEGQTFVL
FT                   ACTQILTKENLAKQNLVEEGIIQVPGGGFAMIFGPDGSPLVEAPPPGVECVLQADIDLQ
FT                   NIDYAKAIADPVGHYSRPDLLQLRVNKTAAKCVVDME"
FT   CDS_pept        join(467837..468013,468139..468228,468299..468749,
FT                   468814..469109)
FT                   /codon_start=1
FT                   /gene_family="HOG000217361" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262277"
FT                   /orf_name="AFUA_8G01790"
FT                   /product="Integral membrane protein, putative "
FT                   /protein_id="EAL84989.2"
FT                   /db_xref="HOGENOM:HBG057440"
FT                   /db_xref="UniParc:UPI0000F51AEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC3"
FT                   /transl_table=1
FT                   /translation="MKQPALVPGKTVESRVGEIFGISIAFTCTTVLIVALRIFTRLKYV
FT                   NQLRSDDYIILGSLLMDVIPETQFGLGYHINDLADPASFAGSLKLFYAAEIAYYVIVGV
FT                   TKISLLIFYLRIFTTSSFNFLRKLSYVLLVAISLLTVIYVVVCVFQCRPIALAWDKGMK
FT                   GTCINVTVFFYCHAGLNILADFCIYIMPMPLFWTVKRSAKERAALVGIFAVGGFVCLTG
FT                   IIRLTSLKTAMTSLDPSWDNEPSAIWSCIEADTGVICASLPSLKPLFADVLGRVPRTQS
FT                   YSRSNTSRNFGALTESQTGLHTHSRADVELSQNPRPYKIEHVVVRTVEFRVEHSDA"
FT   CDS_pept        join(471462..471515,471558..471722)
FT                   /codon_start=1
FT                   /gene_family="HOG000253042" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207175"
FT                   /orf_name="AFUA_8G01795"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27216.1"
FT                   /db_xref="UniParc:UPI0000F51AD3"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA48"
FT                   /transl_table=1
FT                   /translation="MQFSSLPFCRWRRLLLLNAMTMWQCQKLCLYCPSRDFFLLIDPYE
FT                   LVDGKLDCYVNFYLLEPCSIINGRVER"
FT   CDS_pept        471882..472814
FT                   /codon_start=1
FT                   /gene_family="HOG000157237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262278"
FT                   /orf_name="AFUA_8G01800"
FT                   /product="Thiosulfate sulfurtransferase, putative "
FT                   /EC_number="2.8.1.-"
FT                   /function="transferase activity"
FT                   /protein_id="EAL84988.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057439"
FT                   /db_xref="HOGENOM:HBG709927"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000051F41D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC4"
FT                   /transl_table=1
FT                   /translation="MTSPFSSTLVSPAEFHAAVNSPTNTRRIVPVAAGRRTVHTPAYHA
FT                   QHIPNSVYVPASTTQHQHANEHSFFDMDLIRDTTSPYPQMLPTAAHFASCVAALGITKD
FT                   DVLVIYDAVDVGIYSSPRVAWMFRFFGHQAAHVLNNFRVYVQLGYPVATGEMRPLPSVG
FT                   EYRVSPPDSDRVIAFEELRELVLGGGEGFQIVDSRIAGRFSGEEDEAVAGLSSGHMPRA
FT                   VNVPLAAMLEEGSSTFLPVEKLAEVFKRAGVDGRVPLVLTCNSGVTAAALDLALGETGF
FT                   KNARRIYDGSWMEWARRVDRPELIVKDVH"
FT   CDS_pept        join(complement(473784..474041),complement(472858..473736))
FT                   /codon_start=1
FT                   /gene_family="HOG000169741" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750593"
FT                   /orf_name="AFUA_8G01810"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84987.2"
FT                   /db_xref="HOGENOM:HBG057438"
FT                   /db_xref="HOGENOM:HBG554483"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0000F51ACC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC5"
FT                   /transl_table=1
FT                   /translation="MKYFALSSTLMMANLYLLAVVFSLVAVAVETPHRRTYFYVGGNYT
FT                   LNNDGEHIITNQMYVERLTPVDGPRRQYPIVFIHGADQTATNWLNKPDGDEGWASYSLS
FT                   QGYECYLLDHTSRGRSPWYSRNGQLRKYSAEHLQKYFTDTAKYNLWPQASLHTQWPGTG
FT                   VMGDPIFDSYYASTVPSLAENAAQEASMQPAGAALLDAIGKPVILVAHSQGGAMAWVTA
FT                   DRKPDLVHSIVSIEPSGPPFQNAIFGSGPARPYGLTDIPITYSPPVTDPDADFVKQTIT
FT                   SNSSAISDCVIQADDPPPRQLANLSKIRTLVVTAEASYHATHDWCTARFLKQAGVPTKH
FT                   LQLREVGIHGNGHMMFLEKNSDQVVRAIHNWIEDSTSS"
FT   CDS_pept        join(complement(475124..475280),complement(474739..474929),
FT                   complement(474383..474661))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262279"
FT                   /orf_name="AFUA_8G01820"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27215.1"
FT                   /db_xref="UniParc:UPI0000F51AD0"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA47"
FT                   /transl_table=1
FT                   /translation="MRGGIGFGLLCRNVEHYGSCNGGWTVIYSDDLDEEKELREKSKNC
FT                   NSFESIPTTTKNIAEEPLQSVERFKRWKKRTEACIFAHQAELASAKSTDESGQRVSSYG
FT                   EKRYGLRGTMSIELEKLRQEYKSKRENVEACQNWANESADTGFDRTRYHQISLQQAKGE
FT                   AVIYQKAYGAALADAKRLCPGRTFQPATGNVSLGRVDTVVSIRDQ"
FT   CDS_pept        join(476326..476385,476436..477086,477132..477914)
FT                   /codon_start=1
FT                   /gene_family="HOG000169730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902597"
FT                   /orf_name="AFUA_8G01830"
FT                   /product="Putative uncharacterized protein "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EBA27214.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51ADE"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA46"
FT                   /transl_table=1
FT                   /translation="MGGVRGKSQGCGTCRARKIACGQERPRCSQCLKSNRQCTGYQRDK
FT                   VFVLVQPDAKESARTTRQDVAKIGPNHFDQGPGLEIIMSCNIRQQLLDAFIRRCLHHPR
FT                   FRTRSWYRPWLFLLPDISTRSKALEFSTLAISSAAIGRKFNDSRLVHQSLRAYTRALRE
FT                   MQKALWGGSLIREDETLAACLVLSLYELLECPDNGADAYQNHCQGYLSLVKARGMDAHT
FT                   DGIGHDLFVGVRLQGILHAIGHRVPNFICEPAWCRDPWVSRPKRMADRIADCLARMPSI
FT                   LQRYDRLSSLHRKEILDSTYGLVQECLRIDQTLQDIYEDLRLQAEGPLYWPVLSPSFKN
FT                   SVQGQGWFPVIYDFPDLRTATLLMLYWASRAMLWATLSNLHDVIKLQGVHGSTPAFVEV
FT                   TSEKHDPSPSNDKEISSERNSPPLHDGQIYLRMARNVCQSLEYCLQEDMSLLGILAASI
FT                   PVIITVWAIRYRHNDEAELAWLMNASQKMRQGLRMWTYI"
FT   CDS_pept        join(478321..478459,478515..478653,478707..478968,
FT                   479022..479324)
FT                   /codon_start=1
FT                   /gene_family="HOG000169719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055890"
FT                   /orf_name="AFUA_8G01840"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84984.2"
FT                   /db_xref="HOGENOM:HBG057435"
FT                   /db_xref="UniParc:UPI0000F51AF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC8"
FT                   /transl_table=1
FT                   /translation="MLTDHSKVAIAQIVFYVPAIVAAAVLLFHRHGRPRQAWIILQIFC
FT                   LIRVACGIVTIVYENNPTNVGLYIAALILLTAGLLPLIAATLGLLRIIISYESKNKNKG
FT                   LQMPMGVSRFLFIAGIALVIAGGSLAGNYTDADSVNTGRTLTKAGYIVVAVFMAGLVLI
FT                   QGQFWRQYASLSRASQTVLKGMGLAVPFIVVRIAWLFLSIYHPDDKRWSNLSGDIGAFV
FT                   VMTALMEYIVVCIYIGTGFMIPATKGVTRTGDRGLELEHEPAGEGSSQYGKLHSLERA"
FT   CDS_pept        complement(479435..481156)
FT                   /codon_start=1
FT                   /gene_family="HOG000231892" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262280"
FT                   /orf_name="AFUA_8G01850"
FT                   /product="Phosphate-repressible phosphate permease,
FT                   putative"
FT                   /function="inorganic phosphate transmembrane transporter
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84983.1"
FT                   /db_xref="GO:0005315"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057434"
FT                   /db_xref="HOGENOM:HBG325527"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniParc:UPI0000520226"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBC9"
FT                   /transl_table=1
FT                   /translation="MIPAATAKYDWILALTSITFVFSAFGNGANDVANSYATSVAARTL
FT                   SMWQVGILAVCTEFIGAVALGARVTDTIKSGIISIDRFENKPGPLMLAMGCAEMGNAAW
FT                   LMLATGMGWPVSTTQTIVGALVGVGFAAQAPIHWEWTKGSVSQIAASWGIAPAIAAGFS
FT                   ALIFGILKYSVLERKDPFKWAMRLIPVYLAATGAILALFIVVEAPTAPSLEEFGAGKAV
FT                   GIILGVFFGCLLIGVVFFLPYFHRRLVKQDARVRVYHLPLGPWLLKDTCPLYFPGQGDK
FT                   FVTNYYEDAYGEVLAGAKAHLHTTEQQPQQSQPTDTKLLESTHDIERTADSAQSTPELK
FT                   PRKKHLGPHERFLHPVADLPWTHPRKWLGWIKFCLLQGVTRDVVTHDSALLRDIHSRAR
FT                   RYDDRVEHLWTYCQVVSAMMMSIAHGSNDVANAVGPWAAVYATYRAGAVDTEAPTPVWF
FT                   LVIAGLLLGLGFWFYGYNIVRALGNKITQMSPTRGFATELGAAITVLLASRLGLPVSTT
FT                   QCLTGAATGVALMNYDLGAVNWRQLGFIFSGWVLTLPSAGLIGGLLCLMALNTPHF"
FT   CDS_pept        complement(482255..483199)
FT                   /codon_start=1
FT                   /gene_family="HOG000169697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902598"
FT                   /orf_name="AFUA_8G01860"
FT                   /product="NmrA-like family protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84982.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG057433"
FT                   /db_xref="HOGENOM:HBG325526"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51AE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD0"
FT                   /transl_table=1
FT                   /translation="MSTPTVIVFGPTGRVGSAAALSAQKHNAKVILAMRDTTKSIPGLT
FT                   SEQETTGNFERVQVDLTSPESIHAAVTKTGAKHAFIYLAFGTADAMRASIEALRGAGIE
FT                   MVVFLSTISISLHGAADAVPPSDFIAFTHAQVEANLRDVFGDDYVAVRPAFFASNSLWW
FT                   KSGVLAGEVKQAYPEARFDFLAPEDIGSVAGRFLVKGLPAGGDGSKLKYVDLVGPEQMS
FT                   ITEAVGLIGKVVGKEVKITKIDEQEALQDMTKVNGLPEPVAKNILAQLRKQDESGGFFG
FT                   LPEAASGNVQKYTGRPSLRFHEWLDLNKEKFLA"
FT   CDS_pept        join(complement(486424..486545),complement(485999..486210),
FT                   complement(485946..485949),complement(485614..485869))
FT                   /codon_start=1
FT                   /gene_family="HOG000048589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262281"
FT                   /orf_name="AFUA_8G01870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84981.1"
FT                   /db_xref="HOGENOM:HBG057432"
FT                   /db_xref="UniParc:UPI00005206D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD1"
FT                   /transl_table=1
FT                   /translation="MNCTQEEKLTHSVDCGPKVNIISFVPFPALRCPILISSMKSLFDT
FT                   YLFMSFVEGQSLDTAWETYDSITRNQVTNQLKEYLHELRQISHRNYIGSVDFGPVTDPI
FT                   LESHHVKGPTSWRACFPMKSTGSCSCMGTYTFRISWSRMDTSVEFWTGSLAAGILSTGS
FT                   SQKPSMFGNGKTIGSKIWCRFLNRIILNTQSIPS"
FT   CDS_pept        join(complement(490683..490774),complement(490236..490416),
FT                   complement(489928..490002),complement(489713..489911),
FT                   complement(489542..489667),complement(489443..489493),
FT                   complement(489274..489394),complement(488690..489224),
FT                   complement(488211..488639))
FT                   /codon_start=1
FT                   /gene_family="HOG000182178" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055891"
FT                   /orf_name="AFUA_8G01890"
FT                   /product="Na+/H+ exchanger family protein, putative "
FT                   /function="solute:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84979.1"
FT                   /db_xref="GO:0015299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057928"
FT                   /db_xref="HOGENOM:HBG325731"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniParc:UPI00005206D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD3"
FT                   /transl_table=1
FT                   /translation="MTISSSSAGATKLIRFSINGLAIGLPVDAVVAVSCPRNGRVFLTV
FT                   MPSLRQATSVGQEHWRRISLLYWANVDRLEELAARSFLGKMGHNFMAVSCHITSQAVSQ
FT                   TCPVGGSPGLTMILIVISFFFFLSLAEWVSARVIQAGIIGQIAVGIIYGLPLADILEEH
FT                   WQDTFRVLGYVGLILVIFEGGLSTRLDLLKKNFILSLLGASVGVLFPIAFSYLLLYLGF
FT                   EYGPVETFIVGAALSATSLGTTFAVIKSAARSVDLAQTRVGAVLVSAAVIDDVAGLVLL
FT                   SIIANLGKLSGGGNVNLGWIIGRPIVASVAMAVLTPLVTKYVFARIFRRYIEHTFAQFD
FT                   HVSNIILMVLVLCAFIAIAAYAGTSVLFGAFLAGTFLTYIPSKHPSGPFVVMSREEGER
FT                   EAHKSPTFVHTFEVYLLDVQSYLMEPLFFASIGFAIPFVQLWTGTRIWRGVVFSLLMVA
FT                   AKFAVGIWLPLWKYIPLLWPPKRKELSKEGHGAQELQNDSPREKNGRSHVNTTWLSGLL
FT                   LGSAMVARGEIGLLIIEIGFNETSYVSEDAFITGVWAILLNTIIGPMAVGLLVKFYGKR
FT                   IGEGEWGLQEPEPLPGQDAEHRESEV"
FT   CDS_pept        join(492876..493188,493255..493778)
FT                   /codon_start=1
FT                   /gene_family="HOG000169674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262282"
FT                   /orf_name="AFUA_8G01900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84978.1"
FT                   /db_xref="HOGENOM:HBG057927"
FT                   /db_xref="UniParc:UPI000052022E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD4"
FT                   /transl_table=1
FT                   /translation="MLVSSTSASIAVVLLLTQWTGSTIAAQCYFSDGSKADSSFQPCFP
FT                   DQYNSPCCANNKPKGMANDLCLTSGLCLAQMQGFAGMIYQNGCTDQTGKSSQCQAICSG
FT                   STSGGIHLLPCPAKGTNKWCCSINGTDCCDNAATVSIGTIYGYTSISASSASSSTSTAT
FT                   GTGTIATTTVTTTAAAGNGTEVCSDSSSKATAVGAGIGAGLGTCLVATLFALWFQRRMY
FT                   QKKLQQTSGYAGYSPASMAYAQSGYSNPSSGVRRNVSELQSNQEVIHEADGQETRK"
FT   CDS_pept        join(494428..494778,494811..495020,495070..495792)
FT                   /codon_start=1
FT                   /gene_family="HOG000169663" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262283"
FT                   /orf_name="AFUA_8G01910"
FT                   /product="Histidine acid phosphatase, putative "
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="EAL84977.2"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="HOGENOM:HBG057926"
FT                   /db_xref="HOGENOM:HBG325729"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="UniParc:UPI0000F51AE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD5"
FT                   /transl_table=1
FT                   /translation="MALGSVTLADTNSNTFNPLHHLAGISPYFTPNDPQLDPSVPQGCN
FT                   VTRAAYLARHAAIYANDFDYERYLEPFIQKLQNTTQDWSKAGSLSFLSKWSAPITEAHL
FT                   EKITRVGLQGVNHTSKPQRMYGQQHRREPSRLHKDLSLDTPAMKRLKSNSPRSGEYKHA
FT                   AADSLTPYKSCPAYSSSYGSKQSSEFVSHYTKPIITRLQAQAPAFNFTSDDIVAMFELC
FT                   GYETVIRGSSPFCSLGLFTATEWLAFEYGNDLMYFHNTGYGRDLSPAIGFPWLNATRTI
FT                   LADDSASQDLYVSFTHRELPPTVLTALGLFNNSAYSGANDVNATMPTDAINYGRAWKSS
FT                   QILPFLTNIAIEKMVCDSYGYDDGVYYRVLVNEGPQPLVGCRDGPGESCSEEAFGRFVQ
FT                   QRGEWYGDFGKACGVDYENSTDVLSIYQ"
FT   CDS_pept        join(complement(496284..496362),complement(495924..496228))
FT                   /codon_start=1
FT                   /gene_family="HOG000169652" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750594"
FT                   /orf_name="AFUA_8G01920"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84976.2"
FT                   /db_xref="HOGENOM:HBG057925"
FT                   /db_xref="UniParc:UPI0000F51AD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD6"
FT                   /transl_table=1
FT                   /translation="MNIKANFRPTIAHLILIVVCLFTLTCTLYLYARHESSTHSTTAYC
FT                   TDCLHYAMSVDAKIRHAEEGGAENIRTNKQFFRYAVDVTCRGGLFVDKRCLDFRRGFLG
FT                   DAERYAVAVGEPYEACRGIGACR"
FT   CDS_pept        join(complement(500117..500185),complement(499922..500062),
FT                   complement(499762..499806),complement(499671..499706),
FT                   complement(499481..499599),complement(499400..499425),
FT                   complement(499309..499339),complement(498904..499258),
FT                   complement(498609..498851))
FT                   /codon_start=1
FT                   /gene_family="HOG000161754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262284"
FT                   /orf_name="AFUA_8G01930"
FT                   /product="Methyltransferase LaeA-like, putative "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL84975.2"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG057924"
FT                   /db_xref="HOGENOM:HBG326101"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI0000F51AE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD7"
FT                   /transl_table=1
FT                   /translation="MASPRPQSTTQPQHQTPSVIEPDDFDDADSAYTGSLVASLSQAPV
FT                   PQLTSLQSRRRQLHHQHHIKCHELHNGRRYHSYHEGEYVLPNDEQEQDRLDLSHHIYRI
FT                   LLKGELHAAPIKNPRRVLDIGTGTGIWAIDFADEHPESEVIGNDLSPIQPSWIPPNCRF
FT                   EIDDFELPWSYSQPFDYIHGRELEGAIRDHDTLFRQAYENLRPGGWLEMASMDVNSYSD
FT                   DGTHLKAVNMVEGVKNMHAASKKHGKDMTTAPTWKAKMEKAGFINVREDIYKLPQSPWP
FT                   KDPKLKELGRYHQVNMFEAVGPYSFALFTRYLGWSRAEIEVLVAGMRKELRDYQTYHLY
FT                   TNVRIVYGQRPETD"
FT   CDS_pept        join(502930..502986,503066..504409)
FT                   /codon_start=1
FT                   /gene_family="HOG000169563" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750595"
FT                   /orf_name="AFUA_8G01940"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84974.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057923"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD8"
FT                   /transl_table=1
FT                   /translation="MVGVPRSAGCRTCIQRRVKCDEGRPECRRCRDRNVKCPGYQRRVK
FT                   FYHQTPASLRNRKQKDSRHVAAPAVHALTPRASMDGNIVPSLVSTAIDTQMKEVFQYFV
FT                   MVSFPGLFSAWRNRVELNWLDFVRHHLDTSSHALIWSLRSLSVWHLGRAQNDHDKMLAS
FT                   RHFYGRGLQHLIYSLRDPRTATSNLTLMAAIHLGIYEMLDGLGEKSWLAHSRGIGKLFQ
FT                   LRGPQAHRDGFGRTLLVAYRPFLVADAIVSEEPCFLEEPGWQAIVHDAIAFERSAGKSC
FT                   PLSEIVELAFNEIVLCPGLFARTRAFVSQTGVKSEILRESLVARITRCRDRLVEFHGEM
FT                   QPLIVKYNKDNMLKWEEDTKSPIPTEYGPKVAKFAARGARSAIAVLNQLLVLIEADKNR
FT                   SFLDTKPPCRNTLWKLPAGSIASSESQEKQPTAYDAHEDDSPDRLDQLALSMGMLAIRS
FT                   GKPPAHQY"
FT   CDS_pept        join(complement(505918..506014),complement(505654..505868),
FT                   complement(505555..505615),complement(505376..505537),
FT                   complement(505322..505353))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262285"
FT                   /orf_name="AFUA_8G01950"
FT                   /product="Putative uncharacterized protein "
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84973.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG057922"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="UniParc:UPI0000F51ADF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBD9"
FT                   /transl_table=1
FT                   /translation="MRFTQLLIAAGTASLALAARLKSKTKRTSVFQFGSNESGAEFGSG
FT                   TIPGVPGKDCIWLNTTAIGIMKEAGTRVEHLPCAISHGASSTTSLEALMRCTWLVWSLY
FT                   TNYITSTGAYALIDPRTLADTENENTNRTSYGEFAYEYYLKVFGAIFSKVELYGNVDGE
FT                   GDCYGDCFEYELDNRVAQYWGQWGR"
FT   CDS_pept        507966..509495
FT                   /codon_start=1
FT                   /gene_family="HOG000169575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055892"
FT                   /orf_name="AFUA_8G01960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84972.1"
FT                   /db_xref="HOGENOM:HBG057921"
FT                   /db_xref="UniParc:UPI0000520476"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE0"
FT                   /transl_table=1
FT                   /translation="MSQQTDLQWHQVSPGRWERGIDEVEQFYTSLAKSYEGSRRNFFAI
FT                   TGFVSFSVKIDDGVSPEETREKVENALRKAWVHLRFDHPTIASWVEWDFDRKRCKKVYE
FT                   SSAGQETLQSWLETTFLTVSNGVSGLEWCNSDPPVPKLPTLFLIWPSPRVEALLQGDLV
FT                   LRVHHDIIDGVGTLMLFDNLFAHAARAYNRGSNYPLPCFGIEHGNLSPPFRVAAGLQPS
FT                   MSPEQAEKFESIMAYNAFMKQDRIEIASLPFKRGEHLPGKHQRVAVTLPAQQTVAILSA
FT                   CRRLGLSVTHAYHAAIVMAVRDLQERRDSERLVRYINYSLINERGHCLSPYDTPLHAAA
FT                   VYHSVSCRLLIVDTTVPSITDSSSPTEVNREEFLRVAKTVREFYHEMRRDKDHIQMIPS
FT                   WYTSNTIPYPHDDVTPPVPEPNESPSVSISSLGVVDNLVSPSHGAFELDTPWVTGEELG
FT                   TGLGLFLGTWKGVLTLTAAYNDAWHGKEEVVRLIDRCNVIVVQGLGVEQQI"
FT   CDS_pept        join(512612..512830,512885..513760)
FT                   /codon_start=1
FT                   /gene_family="HOG000193107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262286"
FT                   /gene_name="pgaB"
FT                   /gene_synonym="pecB"
FT                   /orf_name="AFUA_8G01970"
FT                   /product="Probable endopolygalacturonase B "
FT                   /EC_number="3.2.1.15"
FT                   /function="polygalacturonase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84971.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="HOGENOM:HBG057920"
FT                   /db_xref="HOGENOM:HBG324519"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000051F8DC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBE1"
FT                   /transl_table=1
FT                   /translation="MHFFQSSLVAATMGAALVAAAPAADLETRGSCTFTSTSALKSGKA
FT                   SCSTITLQNIAVPAGETLDLTGLKTGTTVVFDGTTTFGYKEWEGPLISASGTSITIKQN
FT                   PGAKIDCDGARWWDGKGGNGGKKKPKFFSAHKLNKSNITGLKVYNTPVHGFSIQSDHLT
FT                   IKDVLLDNSAGTKLGHNTDAFDVGSSTYITIDGATVYNQDDCLAVNSGEHITFTNGYCN
FT                   GGHGLSIGSVGGRSNNVVNDVTISNSQVINSQNGARIKTVYGATGSVTGVKFQDISLKG
FT                   ITKYGIVVQQDYENGKPTGKPTNGVKVSDITFEKVTGTVTSSATDIYILCGSGSCTNWT
FT                   WSGNSVTGGKKSSSCKNVPAGASC"
FT   sig_peptide     512612..512671
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBE1 "
FT   pro_peptide     512672..512698
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBE1 "
FT   mat_peptide     join(512699..512830,512885..513757)
FT                   /product="Probable endopolygalacturonase B "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBE1 "
FT   CDS_pept        514099..515379
FT                   /codon_start=1
FT                   /gene_family="HOG000169597" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055893"
FT                   /orf_name="AFUA_8G01980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84970.1"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI000051FDCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE2"
FT                   /transl_table=1
FT                   /translation="MSVLGSPHSLRSGMQGAFPSSSDRPNVLIMSCLNTSRIFAILFRP
FT                   PPSPPLSENSIMYLTQSLTLVSLATSTLAFQIPDSKPPSTKHTDDQTTSPVVRDIFQFP
FT                   DNGSFIDNIAVRPDGTLLLTRIDVPEVWAVDPQTGSGELAYSFAQQSSDSDSNSNSDIT
FT                   AVFGITEVEHDVFAVVAGKFALEGFAAEQGSFGVWKLDFNDNSNYDVLELPWWGEGKFP
FT                   LTRNTPSEVSKIVDIPEAKALGASTLYKPRHDARYLLISDSPDGMIWRVDLDSGEYAVA
FT                   LQDESMLPAPDAPPMGVNGIHVVGEYLHYVSVTKKEYRRVKIDENANAAGPFELITSEI
FT                   NPDSFDITDDGTAYFATNPENTIVKYTPEGEIVDFAGGKNSTVLPGPTCCALDKKGQTL
FT                   YVGTNGGLMAPVGGTYKEPGKIAAISL"
FT   CDS_pept        join(516577..516711,516787..516881,516954..518902,
FT                   518975..519213)
FT                   /codon_start=1
FT                   /gene_family="HOG000217363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262287"
FT                   /orf_name="AFUA_8G01990"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84969.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057918"
FT                   /db_xref="HOGENOM:HBG325722"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051FFF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE3"
FT                   /transl_table=1
FT                   /translation="MSGHPSEELSADYQLQSGGYFHYARSPLPTRVSSACERCRRHKTR
FT                   CDPFRPCSLCARAKVDCQPLPASQTRRDSTRKAKRILRSHERQRTASAAAADQPSEGFE
FT                   ATSKEAPPAGASNHDSRIATDSRVTQPAVDYGEAESTMGIVQKICELGRQHIDEQATSA
FT                   IPGYRASTSVAKRRTAALGQRLPISSILGQDLPPTEIMYSLLEDYFDAVHWFSLAIYEP
FT                   TFRRKLLSVADGFAYPSQKSFLLLLAVVLGMGAWYRSQRRTTDSTDNGDWQQLSANLLK
FT                   IVESHVVELMDQPSVTAAQICILFGSHHVYHGRPNLSFSLLGATIKISQAAGLHRELPR
FT                   GNFEDIEERKRVWWTIYTWDRFASITYGRPLGINDKDCNLNMPADTFENPYFVAPRSEQ
FT                   GYTVCYSTYQRELNRLYLMASTALEAIFGSRTSGSSEELAGDAYVALVKEATQNLRRWR
FT                   DELPEHLVLDLERDFPPDSGLSARAHALQSLSLQLTYDNILIVLHRPLLARQVDHLSTN
FT                   RHAASRSGGMDSPSCHPSGPSPPQRDPAFDAVSPNASVTSPVHWWNAALRTSRVTELPV
FT                   LAQLATDSHLVAFLAINLFNAAIVLAVMALSDPLSDTAQVVKRTITRILRLQDLLGKRS
FT                   ALSKQSTTVLKNVVTLLLRRESEAILAPITTNNQQEGHQSLVDSAPMSVEDTLRLPLDA
FT                   TLDFFDAPTRRPAWPDQSRAQRLNESLASVQFVVPSGNDDRSFNWYASGDTHQARGTIQ
FT                   DTIQPDNTWQQSAPNEWHDHSVSLGSMETASYGTSERGLYWLWDMSWNGTES"
FT   CDS_pept        join(complement(520512..520535),complement(520328..520456),
FT                   complement(519300..520253))
FT                   /codon_start=1
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16262288"
FT                   /orf_name="AFUA_8G02000"
FT                   /product="Sorbitol/xylitol dehydrogenase, putative "
FT                   /EC_number="1.1.1.14"
FT                   /function="L-iditol 2-dehydrogenase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84968.2"
FT                   /db_xref="GO:0003939"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057917"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51ACE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE4"
FT                   /transl_table=1
FT                   /translation="MTVATPNQAVNQAFVLHPGGSFHYEQRAVPTLGSDRDVLVRVVAT
FT                   GLCGSDVHYWQHGRIGRYVVESPIILGHESSGIVVECGSKSGFAVGDRVALEPGVACNT
FT                   CSHCRAGRYNLCREMRFAATPPYDGTLATYYLVPAECCYKLPPHISLRDGTLIEPLSVA
FT                   VHSCRLAGDMQGKAVVVFGAGPVGLLCVAVARAFGASTVLAVDVVPSRLGSALKYGATH
FT                   TYQMTPDSSEQNAEEILNKVELETGADVVLDATGAEPCLNCGIHILASGGTFVQVGLGK
FT                   PNPSLPVCQICDKEIVFKGSFRYGPGDYQTAIELLHSRRIRLDGLVTHEFPFTQAEDAF
FT                   QNVVSRAGIKSVIYGPGVDEHVAKATLT"
FT   CDS_pept        join(521544..521760,521816..522513,522575..522815,
FT                   522873..523336)
FT                   /codon_start=1
FT                   /gene_family="HOG000209091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750596"
FT                   /orf_name="AFUA_8G02010"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84967.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG057916"
FT                   /db_xref="HOGENOM:HBG332415"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051ECB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE5"
FT                   /transl_table=1
FT                   /translation="MSIRRTSATAHNAAIKDRSQAVAAQVAEQQGWLEKKLKPKKVTAR
FT                   YPFKGAPLLYATCAFGSLGDALFGYNSGIMSGLLVNPVFVSRFFKDYGGADGTTNAVNP
FT                   SITGISVACLQASAAVGALIAGRLGDIVGRKRCVRLGGFIYFFSAFIQIFAPDFATFIA
FT                   GRTIQGLGVGFLSMTVPIIQTEIAAPHRRGLMVGIEYTFLIAGYMLSCWVDYGFNFLLP
FT                   GHMSWQGPFIVQIILSFILLAMSFFLPETPRWLAKNGFMQESLQTVADLHSGGDTEAEH
FT                   VQRVFLEIQEAVIYETNLGKSSWTEMFTRYRKRTIVGITVQMFAQLNGINIISFYLPST
FT                   LASAGFDNRKSLLYTAANALPYTAATIVTWWLADKWGRKPLLILGGLAMAVLLGIVCAF
FT                   TQANLDITVKANGQYAFVMLYNIVYGFTWGPMPWLLPAEIFPLRGRSKGMALATTSNWI
FT                   FNFIIGMVSPDAFAGIHGYFYVVIAGFCLFSAGLVYFYYVETANHTLEEIAVLFGDQAF
FT                   ADGDGAVMEVADVKNDHGKELV"
FT   CDS_pept        join(526063..526661,526762..528028,528088..528375)
FT                   /codon_start=1
FT                   /gene_family="HOG000169630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262289"
FT                   /orf_name="AFUA_8G02020"
FT                   /product="Glycosyltransferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL84966.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057915"
FT                   /db_xref="HOGENOM:HBG325721"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000051ECB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE6"
FT                   /transl_table=1
FT                   /translation="MSTKTKMLARENGSIGERIYVPENLLASVTATDDQGHCNRQSYSS
FT                   SEEDSPVGEIHVAKKRASTISWSEHGGYQATTRHGHLSRVFTIEEGQEDVCISEYSKTN
FT                   DDPSTPSSGSISREYPVDVSYNAASSQEHQGCQYTHASFHPRTHNRFSYRNSLPVGQAL
FT                   RSTPRDIRKGSVRSLYNRAALVKIKHQRRYWRRLLFERKQSSRAAGRLSLASSCCKSSS
FT                   DAKKVRFNEPNDSQADDDSYSYTPLLITFEDTFPGPEFFHQRRIAPHPTDTALLIPCYR
FT                   SATIIGRTLEAALQIFPASHIYVIANGNSSQPLDNTEEICRSYGVNHIWSPVGSKIIAI
FT                   FIGCYAVKDFQNVLLIDDDCILPPNFPVVVSRLNEEVRCIGYTIKSVGPDSSRGSYCQQ
FT                   AQDLEYKLSGLTRCFAGRIGSATFPHGAISLWERTFLKRTLHNHPGFSISEDWFLGDSC
FT                   RRLGGRIQMCSAVFVETTTPASVLFGEINEARGGFGEPTVFRQRFLRWNFFVANGLWYN
FT                   LSYLFTSWKLGRWEFATKLLVIQEVRTSDLYSVGDSVLTGQIYETLLYILTPFTLPISF
FT                   IVRPEFCTVLLMSTLGLYLLHVIIFNEVHLRLKNERIGWKVVLGYYMPYKLLMTFTNVA
FT                   SCYWSLVKYARYFARRHPKLIEDHKAVGMVLKLEDMTGRMGGIPEGQGLRRSMTVRTVD
FT                   VDAAVNNRDFLIAELPAERYPSG"
FT   CDS_pept        complement(528654..529730)
FT                   /codon_start=1
FT                   /gene_family="HOG000169641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262290"
FT                   /orf_name="AFUA_8G02030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84965.1"
FT                   /db_xref="HOGENOM:HBG057914"
FT                   /db_xref="UniParc:UPI000051FFED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE7"
FT                   /transl_table=1
FT                   /translation="MHLPKLFASGLVLLVVPSAVTARRGGGGGGIDTDTSSDGDGGSSS
FT                   APGGTSTIGGGSTSCGPTTEILYKSDLVPMNSYNWTSKGASNSGTNPTTYDGSYFQGEA
FT                   FLHWQFTAGRPCQNSSGTVRMLGYAWVGPQPPYPTGPTNPIIIGFKAWQTNDALENITF
FT                   SYDFLHDGLYCPTAPDLVKIQTSNGWTDYQASTDIPRADRARAHDVFDLDLALDAERPD
FT                   SVRFNGSMVPGLKPPPTYTVEVLLPASACNRQSRLSLGYGEELNMSGSLTNTTLELSLA
FT                   GVGKGSYASGSGIMLRAMFNITFSGTFDSGNSTRAVAIKPDTQPMVFWVDNGAMMHGCL
FT                   SWMLKLMFIGWVAWFVCC"
FT   CDS_pept        join(530708..530867,530921..531300,531353..531997)
FT                   /codon_start=1
FT                   /gene_family="HOG000169552" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262291"
FT                   /orf_name="AFUA_8G02040"
FT                   /product="Glycosyl transferase, putative "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="EAL84964.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG057913"
FT                   /db_xref="HOGENOM:HBG325719"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000051F1A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE8"
FT                   /transl_table=1
FT                   /translation="MGPQRFKRQFIVAILLAASIIWLMRSFEHEDADVARTMPLLQKYI
FT                   HPPSGKGGAWYIPPSWLENATTAPESIVDAAKLASDKAQAPERQITLSSIPMIVHQTWK
FT                   TTDPQTWPPPIRQSTESWLRAVEQDQMAYFLWDDEGINQFIKHFEPGLETQFYALGSNV
FT                   ERTDVFRILVSKWIGGVYGDMDTEPLRKPKSWINASDTQPWRDPDTGAVYRSTKPVRAI
FT                   VGLEADCPPGSDLYWRMGYTHPVQLTQWAFAWAPGHPILQMFLDRFSAAMQERSNQAVD
FT                   PLVLTGPVAFTEAVQSWLVATTGLRWNALTGLHDGGRSKVVEDVLVLPITGFSPGRGRY
FT                   GNMGSKPVTDPSARLRHRAQGSWRKFDLLVEYGKFCRTVFGRCRNWTKVPHTSF"
FT   CDS_pept        complement(532017..533837)
FT                   /codon_start=1
FT                   /gene_family="HOG000162772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262292"
FT                   /orf_name="AFUA_8G02050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84963.1"
FT                   /db_xref="HOGENOM:HBG057912"
FT                   /db_xref="InterPro:IPR021047"
FT                   /db_xref="UniParc:UPI000051EA7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBE9"
FT                   /transl_table=1
FT                   /translation="MNHSTARVLPFGRSRLHTIPDITRYTITDPLGPLALHLARKTHQL
FT                   LQSLMSFKLALPNVSGCANPAAQNPSAYRTLSFDFDGVAHITDCLGCPAVARPPKRIPS
FT                   KLRLNRSFSVQKLRGGRVQPPTMAWLRVEFRLLVSRLLPFPSSGYSVLPQSSRSGRAVS
FT                   FAQSPRAACRCLTLLVRIGLVVLLCNIILTPIFWPSYTHLPPCYENLQTIASNSDTPGR
FT                   GNTHNEKVFIAAILYDRTGELAGGPWGDALVQLIDLLGPDNVFLSLYENNSGPKGQQAL
FT                   EALAQRIQSNKSIVVDVDEHTAFDAFPRVTLPDGHKRIKRIDYLATLRNRALRPLDEPN
FT                   HLTYDKLLYLNDVYFHPADALQLLFCTNAHPPRTAPAYRAACAVDFSNPFKFYDSYATR
FT                   DLAGYGIGLPFFPWFTSAGHGRSREDVLAGRDAVRVRSCWGGMVAFDASYFQRANPVRF
FT                   RADDEVFWDASECCLVHADVQDAPEDVDAIPATGVYMNPFVRVAYTTRTLAWLGTTRRF
FT                   EGLYVRVHDLLNRAVGLPRENPRRTEVPGSKVKREVWVPEEGLQNGGSFRLVEVTAGND
FT                   GFCGRRGMEVVVEDRRPGQDGFEAVPLPSR"
FT   CDS_pept        533910..534965
FT                   /codon_start=1
FT                   /gene_family="HOG000169541" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19055894"
FT                   /orf_name="AFUA_8G02060"
FT                   /product="Glycan biosynthesis protein (PigL), putative "
FT                   /protein_id="EAL84962.1"
FT                   /db_xref="HOGENOM:HBG057911"
FT                   /db_xref="HOGENOM:HBG627717"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI000051F686"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF0"
FT                   /transl_table=1
FT                   /translation="MKLVWIAQRLGRQGQRRKVARIASSLFFIVALTALCLYILLAYFL
FT                   ANDPRLVPVAFQTARSILLVTAHPDDETLFFSPSITYRRDDPHVQRALLVISSGGLDIH
FT                   SYRLMLTCLGNYEGIGERRQQEIHDSCSVLGIVPDRCVVLDDAALQDNPRKWWNEELIK
FT                   DLVASHVQKWNADLVCCMLFPALHSTLDTDFRDHHLRRWRRLGAYQSQSRQRWRSVRSP
FT                   SSSIPNAAEPSRTYITSTPNAPPAYTLQSTFLIRKYSSLLDLIPTAIPFSWRILKAILT
FT                   SPASSPADGVHDLSPPEAYNDKVLLVSPWQTYLVSRAAFAQHASQYSWDRSFYLVLSRY
FT                   MWCNNLNKLVV"
FT   CDS_pept        join(complement(535716..536184),complement(535440..535671),
FT                   complement(535064..535391))
FT                   /codon_start=1
FT                   /gene_family="HOG000169530" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207423"
FT                   /orf_name="AFUA_8G02070"
FT                   /product="Glycosyl transferase, putative "
FT                   /function="transferase activity"
FT                   /protein_id="EAL84961.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057910"
FT                   /db_xref="HOGENOM:HBG325717"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000051F8DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF1"
FT                   /transl_table=1
FT                   /translation="MARNRIRLLLILLLALSIGGLFSSSLRQLYYLLRLPFVWKASSAA
FT                   SIISQEHDQFDVTFAAFEANYSTAELGRPALIPPILHHIHLGSRPPREEWLEARELCLK
FT                   HHASWSTFVWNEESAEKLVREDFPHLYEMWKGYPYMIQRVDALRYMILHKHGGVILDYD
FT                   LACKRSLEPLRQFDFVAPAAHPAGLSIGMMLASTGNPYVKALVDNLPLYNRRWLYLPYV
FT                   TVMFSTGCHYASTIYTLQSNRSSLRILSGPPDAPRLHKLNGQVNTPLFRHLGSSSWHNR
FT                   DARLISLFKNLDQRALFAALVFGLFALTTMILCCVQRGRGCGRASDEEQSTAVSKSLTK
FT                   NA"
FT   CDS_pept        537178..537243
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207424"
FT                   /orf_name="AFUA_8G02080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84960.1"
FT                   /db_xref="HOGENOM:HBG057908"
FT                   /db_xref="UniParc:UPI000051F8E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF2"
FT                   /transl_table=1
FT                   /translation="MTELGVWTVQLNKDSDQRQGL"
FT   CDS_pept        join(537804..537887,538020..539000)
FT                   /codon_start=1
FT                   /gene_family="HOG000169519" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263287"
FT                   /orf_name="AFUA_8G02090"
FT                   /product="Nucleotide-sugar transporter, putative "
FT                   /function="sugar:hydrogen symporter activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84959.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005351"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057907"
FT                   /db_xref="InterPro:IPR007271"
FT                   /db_xref="UniParc:UPI000051EF1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF3"
FT                   /transl_table=1
FT                   /translation="MLRVMNIYRFSLTGHTKAQVSTLAGILLLQHKIQSQSTTEDKHFD
FT                   PLAGILLSELLKLTVSLLCIAHTAEEPQSLLATLKTNHEEATLPALLYTAASFAQSIGA
FT                   SFLPLLQYLTLSQTKLILTPLLATFLLNQRFTLQHWTSTLTMTAGIILAQTGANAAAET
FT                   QPRTAANPNIHAHPLLPGILAMLLSGSCVALGSLSIERSLKRAANNNTTTTAKGSAFFI
FT                   RNAQLAAHSLLFALLSFLWKEKCRIDGSRFLEGFNRLVWVFVVLQASGGFLVAWCVRAT
FT                   SSVTKNYAQGMGFAIAAAGPLVVESKDVDGKVSDLLQRGVFGECIADAEVGSFLSGLCL
FT                   YWGRSLGRPSQGRV"
FT   CDS_pept        join(complement(541586..541721),complement(539244..541528))
FT                   /codon_start=1
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056129"
FT                   /orf_name="AFUA_8G02100"
FT                   /product="Beta-glucosidase, putative "
FT                   /EC_number="3.2.1.21"
FT                   /function="beta-glucosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84958.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008422"
FT                   /db_xref="HOGENOM:HBG057906"
FT                   /db_xref="HOGENOM:HBG749096"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="UniParc:UPI000051F8E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF4"
FT                   /transl_table=1
FT                   /translation="MKLTVPLLAAALQLAGIAAGQEDAAIAANLEKFWSYGRSEPVYPS
FT                   PETQGLGDWKEAYAKAKALVARMTDEQKNNLTYGYKSTTNGCSGNSGGAPGVGFPGLCL
FT                   QDAGNGVRGTDMVNGYASGVHVGAAWNRDLAYERAHYMGAEFRRKGVNVALGPVVGPLG
FT                   RTARGGRNWEGFSNDPYLAGSLTGETIRGLQESVIACVKHFIGNEQETNRNPPMLWEGS
FT                   YNQSVSSNLDDKTMHELYLWPFQDAIKAGAGSVMCSYNRINNSYGCQNSKALNGLLKGE
FT                   LGFQGFVVTDWDAQHSGVAAADAGLDMAMPDSVYWENGTLALAVKNGSLAQSRLDDMAT
FT                   RILASWYKYAEIEHPGHGIPVDLRKPHELTDARDPKSRSTIFQSAVEGHVLVKNTGNAL
FT                   PLHKPKFLSLFGYDGIAATGNTMDNVTFGRWVFGLSNTLNYPNGSAIDTKIQRDMFLSS
FT                   YDPAAEGPGVALNGTLITGGGSGATTPSYIDAPFDAFQRQAREDGTFLAWDFASQKPIV
FT                   NPASEACIVFVNELASEGWDRPYLADPYSDVLVESVASQCSNTMVVIHNAGVRLVDRWI
FT                   ENDNITAVIYAHLPGQDTGGALVEIMYGKQSPSGRLPYTVAKNASDYGKVLHPVVPAGD
FT                   RDLWYPQDNFTEGVYIDYRAFEANNITPRYEFGFGLTYSNFSYSALEVELVPGANIDYL
FT                   PPGSAIAEGGLPSLWDVVATVNCTVANTGAVEAAEVAQLYVGIPGAPAKQLRGFNKQSI
FT                   KPHKKKHFTFDLTRRDLSTWDVEKQTWGLQSGSYPIYVGKSVRDIQLTGTLQI"
FT   CDS_pept        join(complement(545347..545496),complement(544768..545187))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263288"
FT                   /orf_name="AFUA_8G02110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84957.1"
FT                   /db_xref="HOGENOM:HBG057905"
FT                   /db_xref="UniParc:UPI000051EA82"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF5"
FT                   /transl_table=1
FT                   /translation="MHHAFIPDNLRALNHREVINEKSVALPRGRDILLLETDAPQLSHC
FT                   AYLDDSLEIYCGRPQTRTPENQTLAVDPLFLRIISQGLPIQEICCVNHAAVSRAPKISY
FT                   KYVNVDVLIHFTRILVADLRQGDSQGLRDDVHEYLSGTTKEERVCSQWSRIAREDDLVA
FT                   GFDARHECDWTSLECCGGSVSHLTRA"
FT   CDS_pept        join(547523..547652,547705..547782,547837..547940)
FT                   /codon_start=1
FT                   /gene_family="HOG000169497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750838"
FT                   /orf_name="AFUA_8G02120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84956.1"
FT                   /db_xref="HOGENOM:HBG057904"
FT                   /db_xref="HOGENOM:HBG331553"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniParc:UPI000051E5D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF6"
FT                   /transl_table=1
FT                   /translation="MGFSRSSRSSSDRNGSISSRESYKKATLSSKADPNQALNEAQPIN
FT                   QAVSGTPMFSLRSMQHRDKDGNIITDPDRSNPTRPRLERPLDTIRSFEAAIEARRREM"
FT   CDS_pept        join(549164..549241,549288..549325,549373..549398,
FT                   549446..550207,550252..550961)
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902864"
FT                   /orf_name="AFUA_8G02130"
FT                   /product="1,3-beta-glucanosyltransferase, putative "
FT                   /function="cation binding"
FT                   /function="transferase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84955.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG057903"
FT                   /db_xref="HOGENOM:HBG737647"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F676"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF7"
FT                   /transl_table=1
FT                   /translation="MKFSHALLGAGLLGTVLADIDPIIIKGSKFFYSSNDTQFYIRGIA
FT                   YQQDYSSNGTTDGSSTYIDPLSDATLCKRDVPIFRELNTNTIRVYAIDPTANHTECMQM
FT                   LADAGIYVISDLSDPSQSIDRSDPSWETTLYNRYTSVIDALAPYNNTLGFFAGNEVSNT
FT                   VGTTDASAFVKAAVRDMKAYIKEKGYRSMGVGYATNDDSSIRVNMADYFNCEDSDESID
FT                   FWGYNIYSWCGDSSYTESGYSVRTEEFRNYSVPVFFAEYGCNEVTPRKFTEIEALFGDK
FT                   MNDVWSGGIVYMYFQEANNYGLVSAVDSTSVSTMADFKYYSSQINNNANPSGTNKASYT
FT                   PTNTALQSCPTVNSQWLASASPLPPTPNEQLCTCMSNAASCVVKDSVSSDDYGDLFSLI
FT                   CGYTDCTGIARNATTGSYGAYGMCTPKQQLNFLLNKYYSEQSSASSACNFGGSATVTSA
FT                   TKATGACSSLMKEAGTAGTGTVTSKPTGTADSSGSSASSTSSSGTAVALTRGSAVTVGS
FT                   FELGVYAITALLTAVGMVML"
FT   CDS_pept        join(551886..552232,552297..554409)
FT                   /codon_start=1
FT                   /gene_family="HOG000217364" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263289"
FT                   /orf_name="AFUA_8G02140"
FT                   /product="Ankyrin repeat protein"
FT                   /protein_id="EAL84954.1"
FT                   /db_xref="HOGENOM:HBG057902"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00005206E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF8"
FT                   /transl_table=1
FT                   /translation="MTISNTGHDLNRICLVLDEIIPTWKAHSSILMTHPSASFGMWPCV
FT                   QCNLENIRVTLQQLRQELEPVAESGQKKRSLFKVYAKAWKLGLHSRAIIAYRGRLEPHR
FT                   KALRVGATMMNMCVRLQLNASAQEKQSFLVVLDMEIKDLEAAVQSLKKLSFVSSGEIAE
FT                   RQNMIVAMEGLISSAKSFYTFMSVAPSAPTVNQEDGHGSAPPPSYAQAMAPDDGAESED
FT                   SAPWPSPFNVAAREGNLEEIKRLVAAGEDILATGEIGQSPAYSAAVSGNTEILEYLIEH
FT                   GADYTSGNENGFTPLNAAATFGHPDAVLALLHHGADPNVPSVDGQSPIYSAAKLGQLGS
FT                   VKVLVEHGVNISDTTHPKQWTPLNVAANSGHLHIVKYLLDQGADFNLPTTSGWTPLASA
FT                   ASEGHAEIVETLIKRGADVNAIIGEVGATPLYCAAKDGHTDVVRILLDHGADTSQASAN
FT                   KWTPLNAAASEGHLAVVELLLAKGADVTTPDRTGWAPLNSAAAAGHFEIAVALVKHGAD
FT                   HAVADSRGHTPLYSAALHGHHAIVDLLLEAGASINVTNKDKWTPLHAASARGHLQVVQS
FT                   LIACGANSATRNMDGWSPLNSAACNGHLEVVKLLLRHGAAVDSRSDDGWSPLTAAAGNG
FT                   HTAVVEALLDRKTDIETRNDIGWTSLGIAAREGYPETVKVLLARGADKNATNINGWTAL
FT                   HGAVEKDQLEVVTLLLAQGLDISAKSNTGWTPLNIAASNGRATIAQFLLASGADPNTPQ
FT                   DDGWTPLHVATNENHIEVVRALLRAGADCHAKNQNGKTALDLARSKGYTVMEELLLGAG
FT                   VKRLGFE"
FT   CDS_pept        join(complement(556870..557016),complement(556694..556802),
FT                   complement(556269..556599),complement(556073..556226),
FT                   complement(555309..555974))
FT                   /codon_start=1
FT                   /gene_family="HOG000217370" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750839"
FT                   /orf_name="AFUA_8G02150"
FT                   /product="Acetylornithine aminotransferase, putative "
FT                   /EC_number="2.6.1.11"
FT                   /function="N2-acetyl-L-ornithine:2-oxoglutarate 5-
FT                   aminotransferase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /protein_id="EAL84953.1"
FT                   /db_xref="GO:0003992"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG057901"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051ECB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBF9"
FT                   /transl_table=1
FT                   /translation="MTREDQREGKVVRLSSKTKELLEIDSKHSAGGIFPLPVFIKSGKD
FT                   SILKDADGKEIIDFICMLSATNLGQCHPKLLQAMTTSMQTITLTNIATKVGDWAEFTRD
FT                   MCARFGYDKMVGMVSGTEGADAAVKFARKWGIKRKGIPPRDVLVLGVSDNYHGVGSGIW
FT                   PIMNDMGQASGKYIAFSVLTCSLTPALSLPTDQLWHHQRESSKYEPDDWGAPEVWMPGR
FT                   RRASPCWQSRTCGRNNHGVYPREKTEELNFAIGVRQLCKRYNILFIADEVRMGSGKTGK
FT                   FLCSNWMGPENKPDMVVMGKSITGGAYPASYIFGNHEVMDLIGGYEPVATFGMAPAAIA
FT                   ATRATLEIIDEEKLVDRATWIGQVWKKETAGWSMPWLDYTTNRGADLGLYLKRTGNPRL
FT                   TTRRLSMLCLHKGIFTYPDGDRVRMGVALNIPEADLLRGMAILKEALLELDDYDEIETG
FT                   PPMKGVIPEM"
FT   CDS_pept        join(558221..559096,559125..559781)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056130"
FT                   /orf_name="AFUA_8G02160"
FT                   /product="Aldehyde dehydrogenase family protein "
FT                   /EC_number="1.2.1.16"
FT                   /function="succinate-semialdehyde dehydrogenase [NAD(P)+]
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84952.1"
FT                   /db_xref="GO:0009013"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057900"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000520946"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG0"
FT                   /transl_table=1
FT                   /translation="MIFVLAPLCRHSMACVHQIACLTHDLANVFLQNFFNIINGETVSS
FT                   AVTQHGINPANKEPNPPVPVASPAELDKAVAAAQVAFEQWSPFPLEDRRKALFAYSDAL
FT                   NAEKDGFTSLLTKEQGKPLSQAAMEVEMAVAWIKGLASLEIPEVVLENSSERKIVQRFT
FT                   PIGVAAAIVPWNFPVLLAIGKVVSALITGNSIIVKPSPFTPYTALKLTELAIPFVPPGV
FT                   FQALSGDDQLGPWMTRHPGILKVSFTGSTLTGKRIALAGAETFKQCTLELGGNDPAIIC
FT                   KDVDLDALVPKGDQNLGQVEDKLLMLDPTRVAPLCFLNSSQVCMMIKRLYVHESIYEAF
FT                   RDKLAAHVKTLPVGNGVQPDVFLGPVQTEMQYNKARDLLSSISAEGLRPALGGTVEESA
FT                   GYFIHPTIVDNPPDTARVVTEEAFAPILPLLKWQTEEEVIARANADPAGLGGSVWSRDL
FT                   DQAQRLASRLECGSVWINSHFAVAPHVPFGGRKESGSGVEWGVDGLKAYCNP"
FT   CDS_pept        join(560903..561493,561565..562362)
FT                   /codon_start=1
FT                   /gene_family="HOG000217369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263290"
FT                   /orf_name="AFUA_8G02170"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84951.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057899"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000F51ADB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG1"
FT                   /transl_table=1
FT                   /translation="MPRQRSKGCIPCKIRRKKCDERKPTCVACVRNVLLCAWDSESPPS
FT                   QPHNSSSRGLKAKSPRLGRHQLAPKRMSSDLALSAAPNLIHPQLAHPKTNFLYSFFYAR
FT                   AAQTLSIRDREGNPFVHVLMPMAATSDIVFQAMLAFSGVVYEQQHSSNLATTTWEHYAQ
FT                   AIRSLKHALTLYVDHQVDRGAELVATVLLLLALEVSRADSDGHSFRHLRACRELVSGAF
FT                   AHCPDPQLLGFLAEYYLYNLSVLPSSLIDELDPIEEDIDFAFRILLNNSIPATGVLCGC
FT                   APEMFRTISKATAISRRLHDEFTSDAGPSVECLLERDNLYNYVQSWLPEHADEENTTIA
FT                   RVYQTALLVLLLQAEPGASDTVAMDALVSNLISLLRMIPVESHTTTVLAWPLATVAPCV
FT                   KSGTDQAFILQYLGAVVQKYRFGNHRQTEQLLRLIWSRRDLAEQGPYCIPRAMEVQGCR
FT                   FLLC"
FT   CDS_pept        join(563485..563543,563607..563640,563712..563781,
FT                   563843..563915,564027..564055,564192..564256,
FT                   564325..564396,564453..564567,564629..564683,
FT                   564786..564820,564893..564921,564977..565009,
FT                   565064..565088,565152..565353,565420..565497,
FT                   565571..565699,565780..565927,565987..566065,5
FT                   66130..566284)
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263291"
FT                   /orf_name="AFUA_8G02180"
FT                   /product="GABA permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84950.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057897"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F51ACB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG2"
FT                   /transl_table=1
FT                   /translation="MSSESGSSSGAQLAKNFSRISLLGLAFITLNSWTAFSSALPLSLT
FT                   SGGPTSIIWGLLTAGVCTLCIAASLAEFLSAYPTAAGRYRWVAVSWDDYERVLSWFTAW
FT                   ANVAAWICLCATASLFGSQLVTNTVILVHPDFNFLRWHVFLIYVGFNLIAFLVNAFWNS
FT                   ILSALNRAALIWSLCGFSIIFVTVLACAFVFTSFINKTGWPDGLAWLLGLLQGGLCLVG
FT                   VDAVAHMIEEIPTPTVDGPLIMVACVAIGLATSLIFIVALLFVSRDIDTIITSGAGPLL
FT                   QIFLDATNSKVGSICLLLFPIGCLLLGVIAITTTSSRMIYALARDSGLPFSPIWTTVHA
FT                   RLKTPVNALVLNAAAVFCCGCIFLGSSSAFNALSAAAVICFDISYCLPILIHCLRGRKL
FT                   LPARPWILHPAIGWIVNLVSIAYISFTTVLFMFPPARPVTGSTMNYAIAATGVFALLSA
FT                   IYWFVRGRKHFMQVLVTAEMAIPEARPSSCPIKSDV"
FT   CDS_pept        join(complement(567309..567504),complement(566915..567252))
FT                   /codon_start=1
FT                   /gene_family="HOG000217368" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902865"
FT                   /orf_name="AFUA_8G02190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84949.1"
FT                   /db_xref="HOGENOM:HBG057896"
FT                   /db_xref="UniParc:UPI000051FB67"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG3"
FT                   /transl_table=1
FT                   /translation="MSFIPTTLYYASAAIHAVSIPGHVLFGIREVDPAIATIPPSEKHA
FT                   LGKATATTAWDMVNALLAASALLNIQWSRVGVRTLEEKAIIWTTVLAGTFTGWRYFKVR
FT                   SYAGLGCLWVAPWLTAGAMVYEKLGSAPLSRGHSGHLPIGSVVFHRFRAPSAICVLRWK
FT                   SKYHTGFASEISGI"
FT   CDS_pept        join(570700..571040,571138..572443)
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263292"
FT                   /orf_name="AFUA_8G02200"
FT                   /product="Proline permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84948.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057895"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051F8E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG4"
FT                   /transl_table=1
FT                   /translation="MLAAMEKKAVLDDRQDTDAGSIVPFPQTQRGLTSRHVQLMAIGGS
FT                   IGTGLFVGIGAYLRDAGPLSLLLGYLVWGIAFILPINLSVGEMCAYLPIRGSIFELAAR
FT                   YVDPAFGFAMGWVYFYAGLMLVCTEYSAVAFIMDYWQIDVNPAAWVAMAMVICLALNLV
FT                   AVKYYGEAEFIMASTKILLLLGLIFLTFITMVGGNPKHDVYGFRHWTNGVMYEYYTDGA
FT                   TGRFLGFFSVMVYAAFTIAGPDLPALAAGEIQHPRRTIPRVVKMTFWRIVGFYVVGVLG
FT                   VGIICDSHDARLMSAIEEGASGSAASPWVIGIENLGIPVLPDLINVLILLSGWSCGNAY
FT                   LYSSSRTLYSLARDGQAPKFLTKCTKDGVPIYCVLAVTLLSCVTFLVADNASINVFYWF
FT                   VDLTTIGLVLTYTSMACTFLGWYRALRAQGIDRKSYLPWISPLQPYMAIVAVILGFSTA
FT                   LFNGYAVFKPFDAQGFVTSYFGLAFFVVMFAFWKVVKRTKWVDPATADIYTGKAEIDEE
FT                   CRIWEDGTWDEKHKAELAQMNIIRRMWERMW"
FT   CDS_pept        join(complement(573757..573891),complement(572974..573706),
FT                   complement(572582..572904))
FT                   /codon_start=1
FT                   /gene_family="HOG000165073" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263293"
FT                   /orf_name="AFUA_8G02210"
FT                   /product="Alpha-ketoglutarate-dependent taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /function="taurine dioxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84947.1"
FT                   /db_xref="GO:0000908"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057894"
FT                   /db_xref="HOGENOM:HBG327259"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI000051FFEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG5"
FT                   /transl_table=1
FT                   /translation="MAPSIAEEQPHRADIVVPVKASPAAAEKPKIRRIIDEEGGTTTAS
FT                   YPHYLPVWDHSEKYPPLEPFTHSDPGLRADPSFPDLLKPGTKIQNLTPTIGSEVTGVQL
FT                   SSLSAAGKDQLALLVAQRRVVVFRDQDFAGLPIADALEFGSHFGRHHIHPTSGQPEGYP
FT                   EIHLVHRHNSQGELDAFFADRNSTVAWHSDVTYEAQPPGTTFLYILDSPEVGGDTVFVD
FT                   QVEAYRRLSPAIKERLHGLKAVHSGFEQAEFSRQRGGVVRRDPVKHEHPIVRTHPVTGE
FT                   KALFVNGGFTRSIVGLKKEESDALLGFLLNHVGRGIDYQARIKWAPKTVVVWDVSHPTL
FT                   SSPLDDQTLMREEPRHGTFCAGRLDDGGASSFGADYPPGRAALRDAIRSGGVVLSR"
FT   CDS_pept        576270..576845
FT                   /codon_start=1
FT                   /gene_family="HOG000217366" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056131"
FT                   /orf_name="AFUA_8G02220"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84946.1"
FT                   /db_xref="HOGENOM:HBG057893"
FT                   /db_xref="UniParc:UPI000051FFEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG6"
FT                   /transl_table=1
FT                   /translation="MAQPQAGYWTLPIIASYLSEVNPANNPYQERIDHLWSNILNHYFP
FT                   LRDGFGTEREALVKPPRRFATNVAITNVRPLGMHKVVLVEAKTFPRNTDIGWFSVYPWA
FT                   DVESILQSFMKKAPDTFGNVQTMYGIVAVGDRVRFYTMNSQNNTGGILTPFPVGGPQPL
FT                   LSVHTDAHSIHAILTAISLEIRTGWNTY"
FT   CDS_pept        join(complement(578990..579083),complement(577658..578898),
FT                   complement(577476..577604))
FT                   /codon_start=1
FT                   /gene_family="HOG000048588" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263294"
FT                   /orf_name="AFUA_8G02240"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL84945.2"
FT                   /db_xref="HOGENOM:HBG057892"
FT                   /db_xref="UniParc:UPI0000F51AD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG7"
FT                   /transl_table=1
FT                   /translation="MFSAAKLRGQLEPAFCMVCGLSEGRNRWLKAMTNPRQDPWYRSLV
FT                   SEIQNGTDVYLFHEQPCWDHLLEHFGTDKLHLASLFEALERLPLPRDYTFPSYASLPGR
FT                   IGLENWVGTKDDAHEFPILPGRFPLPSLDELMRLTKGPPKHSPIVAQKPVNHPMDGFGR
FT                   LSFDILVIISSMLPTKEALDLRLVTRAAIPLFASSQFWKTRFAIDRERGFLLPIVRKFS
FT                   PPQGDHGIDWRLLYHCTARLNCSDWFEIEILAWETLRWLRDTASAIRHESPRPPDFRGS
FT                   PALQHYHNTVRRNTFIESVEITSSLCTIAISVHQEAGEVSITGIEFIFDDGRPSAMLGY
FT                   ATPGARQMTREKYARKQRRGPFDAHIVWPYPGVRVTMDVVGLRGIVYLKDANGIHGIAI
FT                   YHGGEDFDEVDDTLHVGLDAHGHNDEELVAYSVSLDKVEKVIAVVDNRKMIDLGISGTT
FT                   TKRSEYFVDEWDDVVDRYKQDNAFLLKSM"
FT   CDS_pept        join(579643..579886,579948..580119,580169..580406)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750840"
FT                   /orf_name="AFUA_8G02230"
FT                   /product="Serine-leucine-rich repeat protein "
FT                   /protein_id="EAL84944.1"
FT                   /db_xref="HOGENOM:HBG057891"
FT                   /db_xref="UniParc:UPI000051F1A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG8"
FT                   /transl_table=1
FT                   /translation="MFLRICVSYRLIKKKSSYINSNNNRHNNNNSNSNSNSNSNSNSNS
FT                   NSNSNSNSNSNSNSNSNSNSNSNSNSNSNNNGMNCETSHHQQRGVLPNGSTACQPPPCP
FT                   APEGQEGHQEEEEDGEDGFIHQDSGKTIIATTYVYRSSRKRRRGRRSGTCAQAHQGQRT
FT                   PQSHQGGGGGGKGKEEQGGKEEQRGQGGQGPGLCLGYEIQGKHNNDGLSMKHER"
FT   mobile_element  complement(582358..584088)
FT                   /mobile_element_type="transposon:LINE transposon family"
FT   CDS_pept        588907..589254
FT                   /codon_start=1
FT                   /gene_family="HOG000169341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263295"
FT                   /orf_name="AFUA_8G02250"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84943.1"
FT                   /db_xref="HOGENOM:HBG057888"
FT                   /db_xref="UniParc:UPI0000520945"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBG9"
FT                   /transl_table=1
FT                   /translation="MVPLHPSPQPAASANQLPTLHSATADRRSASYTSPANDHESSPAK
FT                   YVSPRSNIDIQIREYHNSIKATLTALLNDQRVRKNPDGSKCVQSFLLEAERNLRKEKRK
FT                   SIGSRPPDEKL"
FT   mobile_element  complement(594713..595684)
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   mobile_element  complement(595630..596814)
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   mobile_element  complement(595729..596661)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  600960..601595
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  602032..602340
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  603055..603498
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   rRNA            complement(605307..605422)
FT                   /gene_name="8S_rRNA"
FT   CDS_pept        join(complement(607133..607272),complement(606651..607069),
FT                   complement(606461..606601),complement(606197..606411),
FT                   complement(605932..606129),complement(605603..605881))
FT                   /codon_start=1
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902866"
FT                   /orf_name="AFUA_8G02260"
FT                   /product="Neutral amino acid permease "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84942.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057879"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000051E83A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH0"
FT                   /transl_table=1
FT                   /translation="MKAESQTQAQKPEDMDQKKEEPMPPVRQDAFGDEEFAEVKYKVLK
FT                   WWQGGLLMVAETISLGILSLPAAVGTVGLAPGLAILISMGILASYNGYVIGQIKLRFPH
FT                   ITSMSDAGEVLLGPFGRELLNAAQILLLIFIMASHILTFTVAFNVMTGHATCSIVFGVV
FT                   GAVISCLLSLPRTLEKVSWLSLVSFVSIFAAVMVTMVSIGIIKPTSTWAVAKHTDLVTA
FT                   FGGVTNMVFAYASHNSFFTFIAELRDPREFPKALALLQSIDISLYVVAAVVIYYFAGDG
FT                   VTSPALGSAGPLISKAAYGIALPTIVIAGVINGHIAAKAIYLRMFSGTDRIHKRDWIAV
FT                   GSWIGIMAVLWTISWIIAEAIPVFNDLIGLIAALFLSWFTFGLPGVFWLYMNKGIWFLS
FT                   RRKLFLTVVNVASVCIGLVVVSIYILGSPTVLGLIDQCALGLYASGVSINHNPAGSVFS
FT                   CGARS"
FT   CDS_pept        608288..609178
FT                   /codon_start=1
FT                   /gene_family="HOG000173604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056132"
FT                   /orf_name="AFUA_8G02270"
FT                   /product="Dihydrodipicolinate synthetase family protein "
FT                   /EC_number="4.2.1.-"
FT                   /function="lyase activity"
FT                   /protein_id="EAL84941.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG057872"
FT                   /db_xref="HOGENOM:HBG358848"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniParc:UPI000051F422"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH1"
FT                   /transl_table=1
FT                   /translation="MPDLHGILVALITPFTDDQKHIDAACLKAHIDRLIAAGIHGLVPG
FT                   GSTGEFTTMTTAERKELTELCIKFAAGRVPVVVGTGSTSTAEALELATHAASVGAAALM
FT                   VVPPFYDPVSLEQLTELMAEIHTASGLPIMYYNIPSASGLKLTPGEIAGLSKVGVKYLK
FT                   DTSGDAPAFTELVFGLSDKITAFNGYDTLTFYGLAAGCPGGVWGAANFIPELAVELYET
FT                   VSVKKDLKRGRELWTKIWPICKFLESHNYAAAVKAGVELTGQETGGLRKPFKSLGPELQ
FT                   AELKQLLIDAGVSTV"
FT   CDS_pept        join(complement(611532..611766),complement(610465..611468),
FT                   complement(609359..610405))
FT                   /codon_start=1
FT                   /gene_family="HOG000048587" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263296"
FT                   /orf_name="AFUA_8G02280"
FT                   /product="C6 transcription factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84940.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057863"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI000051EF1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH2"
FT                   /transl_table=1
FT                   /translation="MTPITSTFILPRRTHALGACRTCRRRHVKCDQKRPSCRTCRSLGV
FT                   TCERPPSKVRWMHNSNIEESADDQRETRRHLYTEQSRLSMTSSLRSRLVSGSINASLAE
FT                   IDLRTRDIDNPPTGDIVVGPFAVLGLPTPESPRGDKVVHLQAQQDGPDSVSVESEGQPT
FT                   QPVSPPNMEDSSEPIGQLTTFSQASFLADPVCHFDDFLHWSDLLGCSPDALGWNSAPIT
FT                   DDMDLGTNIGSFGAEFETDPMSFDGPENVGSFPLAPDGDDSMQTTGPTEMASTLLYAAS
FT                   LAEAPFLFKHFHDNVIPQTMPMPLGKKSPWKILNVPAAMMTYSDLTILGSQNINHARQA
FT                   NLYGLLACSAIHLSMYPSAPSTEAAQHWQGTADHLFEQAREHMQLSIKYETQEPKKAKY
FT                   KDQLMAICCLTEYAILSGQQHYARGFLINAEYILRMRGLPKLRISPKARLLHHVYTWLR
FT                   LVGESTYVLHDYQPSASFIEALHSNFRPRQPDSRNQSRSEADQKIPQLDDFLRLEAHHS
FT                   DSDLNIDDPKDQETGLHDIHLQDSRNFSDTLYKQIYGIPETWLTLISQTTRLANVMETF
FT                   RVARQSQRKASLEAWEILHRRSEHLENMICSFVLRHNRRVRSKHLDSSKPHEAMLRALN
FT                   AALLIFFYRRVRQVHPAVLDDYVDNVITALADFQKAVPAEHPMSPATAWPMFIAGCEAL
FT                   TASKRDAVLEFFNRAESICRFPIFKTAREILTDVWNQQDQHLETNRRDPIPTWINIVRQ
FT                   KNLWPLFC"
FT   CDS_pept        join(complement(613387..613412),complement(613127..613332),
FT                   complement(613008..613079),complement(612502..612956),
FT                   complement(612180..612437))
FT                   /codon_start=1
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263297"
FT                   /orf_name="AFUA_8G02290"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL84939.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG057854"
FT                   /db_xref="HOGENOM:HBG532399"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000052022C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH3"
FT                   /transl_table=1
FT                   /translation="MATPARIFLTGASGYIGGDVLYALRSAHPEYSISALVRDADKAAN
FT                   LSHADPNIRVVCGDLDSTSLIEEEARQADVIVHTASSSHIESVMAIARGLAQRSDPGYW
FT                   LQISGASVLSITDIVHGTYGEGSDGIFGDVDDVDVVREIIRDNATRRAVDNFILNLSGP
FT                   RTALVFAPIIYGRGRGIIKQRSVQIPELARVAIETGRAIQVGKGESTWSNVHISDVSDL
FT                   FVKLVEMAVQKKTDEHMWNQEGLYFPGNSMLSFKMISQLLAQTAHRLGLIKSPLVSEIG
FT                   HEEANKLSPHGGVLWGTNARQNSQRARQLLGWCPKGRSLESDIPDTVEEEAKRLVKI"
FT   CDS_pept        join(613796..613893,614028..614365,614417..614569,
FT                   614620..614694,614754..615138,615186..615261)
FT                   /codon_start=1
FT                   /gene_family="HOG000217463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263298"
FT                   /orf_name="AFUA_8G02300"
FT                   /product="FMN-dependent dehydrogenase family protein "
FT                   /EC_number="1.1.-.-"
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84938.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057845"
FT                   /db_xref="HOGENOM:HBG517781"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000520468"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH4"
FT                   /transl_table=1
FT                   /translation="MAHRGETLHNEVSCIADLKALGSSKLPKMVRGELRENEAAFDRYK
FT                   ILPRVLRNVDNVDTTTEILGTKVSLPFGFSPAASQKLAHPDGELAASRAAAKYGICMGL
FT                   SSYSNYSLEDVAAQGTGNPYVMQMCVLRDRSITIQLLERAQKAGYKALFLSVDVPVLGK
FT                   RLNEYRNSYTLPEDMNWPNILSCGADTSNRTDYDPSLDWETTIPWLRKHTSLQIWLKGI
FT                   CSPADVELAIHYGVDGIVISNHGGRQLDGIPATLDALRLCAPIARGRIPLAIDGGIRRG
FT                   SDIFKALALGASYCFVGRIPIWGLAVSFVLWHVAMIGLANYIQYNGQEGVELAIRILQQ
FT                   ELKITMALAGCTSISDINESYLSVLNANGQLAKL"
FT   CDS_pept        join(615581..615652,615665..615912,615976..616175,
FT                   616221..617407)
FT                   /codon_start=1
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263299"
FT                   /orf_name="AFUA_8G02310"
FT                   /product="Aldehyde dehydrogenase ALDH "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84937.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057838"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051F8DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH5"
FT                   /transl_table=1
FT                   /translation="MSNVRIGRTFLTGICTVPVYPLHLACRSASPLSPVRRLILESQRP
FT                   LTVNLIIHHTISHRSTIRTMGDLFVDIRTPNNHAYRQPTGLFIGGEVVAASSGQTITSI
FT                   DPATDKPIATVHAASAEDVDRAVKAARAALVHPSWKQLPATGRGILLAKLADLMEQKRE
FT                   LLASIDAWDNGKPYHVALEEDLTEAITTIRYYSGWADKIAGQTISTTSSKFAYTIRQPI
FT                   GVVGQIIPWNYPLSMATWKLGPALACGNTVVLKPAEQTPLSALVLAELITEAGFPPGVV
FT                   NIVNGYGREAGAALASHPLVDKIAFTGSTQTAREIMKMAAGTLKDITLETGGKSPLLVF
FT                   PDADMEQAVKWSHFGIMSNQGQICTATSRIYVHQDVFHSFLERFKQAVETTSKIGDQWD
FT                   ESTFQGPQVTRTQYERILSHIETAKKEGGTVVMGGGAYVPEGDRNKDGYFVQPTVFTGT
FT                   TDSMAIVREEVFGPVVIIEPFATEEEAIRRANDTIYGLGAAVFTRDLERAHRVAAEIDS
FT                   GMVWINSSQDCDPRVPFGGVKQSGIGRELGEAGLAAYSRIKAVHVNMGSKL"
FT   CDS_pept        join(618528..618641,618697..619473)
FT                   /codon_start=1
FT                   /gene_family="HOG000169319" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263300"
FT                   /orf_name="AFUA_8G02315"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27213.1"
FT                   /db_xref="HOGENOM:HBG324175"
FT                   /db_xref="UniParc:UPI0000F51AE6"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA45"
FT                   /transl_table=1
FT                   /translation="MGSIVSLASSVWQSLTFWKALAIAFALLNLKTLPLVWHIRVYRYF
FT                   FQYGYLTTPAVEQPPKPSSDILKPKSILTRAPIMEIDVNMHKSNSTYFSDLDVSRTALV
FT                   NSLLMKGSAFLEKRLQKQGKRGLLHFVLGGVYTSFKREIPAYMKYEVQSHIASYDEKWI
FT                   YIVTYFLQPRTGKKASAETDEDRRKRLLAVSISKYVLKKGRYTVPPNDAFEAAGYRPLR
FT                   APAANGTANGTVNENGSLTQRKESKSGHTWDDNSEWEQLQKEIRKGKEMVQPFVDQEEK
FT                   LLDDYMEKMKLPAFA"
FT   CDS_pept        620482..622290
FT                   /codon_start=1
FT                   /gene_family="HOG000169352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263301"
FT                   /orf_name="AFUA_8G02320"
FT                   /product="Capsule polysaccharide synthase Cps1, putative "
FT                   /protein_id="EBA27212.1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI0000F51AE8"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA44"
FT                   /transl_table=1
FT                   /translation="MYELLAFITLPWVIAHPRLFMAVAAATTYFMHSTGRTFHNVRANM
FT                   ASQVTGILPEDLRRDDVLSNRMTVVFLHLFVFRYLRLIVHLISFWLFYHPTPVPKNPAL
FT                   SPSDCTIILPTVDPKNRDFEECITSCLRNTPGAIIIVTVGDQLTKLTKDIIAPYKRIFP
FT                   NTEISVRTADEANKRRQVAHGLRYVKTKITVLLDDHVVWPTERFLPTILAPFEDPKVGI
FT                   VGTNKRVRRTDTGFNIRSFWNMLGALYLERHNFEIRATNAIDNGVFVVSGRTSAHRSEI
FT                   LKDPKFIAEFTNERFFFGLFGPLNADDDNFITRWDVRHGWKVKIQYCPDAMIETTLGTY
FT                   PKFLSQCLRWVRTTWRSNSASLFTDRTVWYTQPWCVYAVYWTSFVNFALFYDGALAYTL
FT                   LKSPLGTADNLKYLAAWIFCTKMVKLTPYFLREPQDLVMLPGYFAFAYFHSLIKLYAGL
FT                   TFWETNWGGRNLSAVNTQTGGGPEGDDDDDDDDDDADDSSDDSIDGGVQLPPTPPSSRR
FT                   RKTAGSSRAGSGGNASGSNRVQSRASTVDTKTPRKMQTQAMMRESSSSRSSTSSSTSSK
FT                   WQRCPGCRKLHSDSGTVCQVRDVWGR"
FT   CDS_pept        join(622698..622755,623000..623314,623641..624128,
FT                   624165..624497)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750841"
FT                   /orf_name="AFUA_8G02330"
FT                   /product="Endoglucanase, putative "
FT                   /protein_id="EAL84935.1"
FT                   /db_xref="HOGENOM:HBG057822"
FT                   /db_xref="UniParc:UPI000051EA81"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH7"
FT                   /transl_table=1
FT                   /translation="MRTSRSLLRINSHLVCGAIRLAVLCASRAAARTAEHAYEFKSVTI
FT                   TGGGYITGIVGHPTKKDLLYALTDIGSTYRWEQELNKWIPVTDLVGPEDENLLGTESVA
FT                   TDIFIWRKAGSRVPITLRSSFHSGQPMQWRARIFLAKRATSTDSGPMISTPRSRCSASL
FT                   FLEPEHNLGVMTIDASGKYVISPSVQAETPPANDSGPYASNDGGKTWASPHGLTMQTPY
FT                   ISSDRVQPKTFYAFSGGVWYVSTDGGFSYDAVDATKLGLPAHTGAVPVVSADRAGEIGL
FT                   ALGSNGRINHKGTVADLITVGAAAPGSVKPALFIRGSTGHPKKSGYRVYQSDDNASTWD
FT                   GVDDDDHCYGEFDLIQEDPRVYGRVYLGTGGRGLLYADIGPHDQARRGMYQEQEVFD"
FT   CDS_pept        join(complement(624857..625055),complement(624577..624839))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263302"
FT                   /orf_name="AFUA_8G02335"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27211.1"
FT                   /db_xref="UniParc:UPI0000F51AD1"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA43"
FT                   /transl_table=1
FT                   /translation="MGRVTATSGKATLGERISDWAFVEMNDVAIEKSFRPNHMFPVRGY
FT                   QQPSRCKAGGEPLTNFDPLIEDGAHDGNYYRPSPWDAGDALLQDCTSYGHVGNKNDLSA
FT                   ATIEEYIIVSRGLNTTEHTQASFVVVGDSRSHVIDKDQRTSQARAPSTR"
FT   CDS_pept        join(complement(626492..626573),complement(626244..626428))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207425"
FT                   /orf_name="AFUA_8G02340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27210.1"
FT                   /db_xref="UniParc:UPI0000F51AEF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA42"
FT                   /transl_table=1
FT                   /translation="MKITAVVALALAAVVAASPVAEPKLVEPPLQAPARATVPLWRRAP
FT                   APSLVLRALVAIPPAITPSTLLAFVTIARERKSKMWKELDVGS"
FT   CDS_pept        join(631460..632089,632152..637026)
FT                   /codon_start=1
FT                   /gene_family="HOG000217372" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263303"
FT                   /orf_name="AFUA_8G02350"
FT                   /product="PKS-like enzyme, putative "
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="EAL84933.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG057808"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI000051E5D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBH9"
FT                   /transl_table=1
FT                   /translation="MASTLPSTVVCGSQTSPPSRDCLQRIQADLKDPKLKELAKAVDEL
FT                   PEFWSHLVEVKPVLSQVNDAPLKKLKDWAKDESVLNIPEGLPNILLAPLTVIIHLVQYL
FT                   RFAHSLDANDSQEDQHHRILQSTSKGGFQGLCTGFLSAAALACSRTRSDIWCNATVALR
FT                   LATCVGAYVDLDRLTYDNTDVHTCMIIHWEDNCGKDQVTEVLKGYPGVYISVELDNRSI
FT                   TVTAKQSQVSLLRGDLAARGAKLTRIPIYGRYHSRTHAEILQDLLEICSNDESLRFPII
FT                   SAPIVPLRNNTTGGLITSAEKLHELALKCMLTEPADWYSTMSETVSSLMLQPVINEHPL
FT                   ILELGHVSCLPRSLTASANIRAFTPLLTLTASPNEPDASRYDYPEHSIAVIGAACKFTG
FT                   AETMQQFWELIRAGGTMVGELPEGRIALDKKSLRKPPREEPLRGNFLSRAGHFDHGLFG
FT                   LSQREARYMDPQQRIALQVAYHAVESSEYFRSGIKDKNVGCYVGVGGSDYDHNVCSHAP
FT                   TAFSFTGTARAFVSGRISHHFGWTGPSMTIDTACSSSAVAIHQACKDIRMGECRMALAG
FT                   GVNIISCPNMQQNLAAARFLSPTGGPCRPFDAFADGYCRGEGCGFVMLKKLSCAVADKD
FT                   EILGVIVGSAANHCDGNDAITVPKSHSQIDLYRKALSLAAMQPKDITYVEAHGTGTSRG
FT                   DPVECRSIRQVFGGERPTLHFGSVKANVGHTEAASGIAGLLKVLLMIRNQRIPPQANFT
FT                   QLNSSIPPLEPDNLSITTNELEWKATFRAACVNNYGAAGNNTAVIVCEPPRLKPSAGNN
FT                   HILSGYPFLITGQSGRSLKMYCTALGEWLENTDAPLSDIAFSVTRRQNRTLRRRITFAA
FT                   RSLKDMKNILGQQARLDQQSSPSPKPKPVVLVFAGQTGNVVYLHKDAYEGSSLLRSHID
FT                   ECDKILREMGLRGLIAFLFDQQPIEDVVLLHCLFFSLQYACAAAWLDAGLPVQRVIGHS
FT                   IGQFTAMCISGVTTLADTLKIVAGRARLIQQKWAKERGCMLAIEVDRQGALELARSVPG
FT                   HKIEVACFNGARNHVLVGTEVAIQTLEAKTSCKTRRLKTTHGFHSELVDHWLDDYMALA
FT                   QSITYATPIIPIETCSEGGSWKEFTPEMLPRHSREAVYFFDAISRVDKELGPCTWVEGG
FT                   VGSKGIALVKCALGTNTSGHSFHRLQLDSSEPLASLTDTTIQMWDEGVDVQFWLYHDTE
FT                   KITFDSCDVPAYQFDETEFWLLRSDQARQSDLQRGRVISDRYKPLVYLLRDEGFRGEPR
FT                   KLHFGVNQYHPDFDRYLHGREVLGEVLCPVSVFVELAAKAAAICGGRECSTAATQVQVL
FT                   NLEIHNPLGHAPGARVGLRLKRIGSCKWGFSVISDKDVQSICHATGVISLRQERHGKLE
FT                   IGPQWSVIQRVIGYSHIQDVLDDSSAISLKEGIIYKVLEKVAEYKPCHRAIKSMTIKGT
FT                   AAVAQLEMPAISRDSSEITVSDPLVMDQFALIAEVLALCRDDCKRDDVFICSGLSELVT
FT                   FKSLQSGLGPWTVYTQQTPCGPRELLSDTFVFDSTSKQLIIGLLGARFVRITASSLNGI
FT                   VKRANLNSQTSELSVETDAVNHPASVAYPPSNNNDTSDILSILSHLLHEITGLPPSEIS
FT                   ASTPLMEASVDSLAATELENRIQEEFHLHRPISLYERQFNVGTLCQEIQTQRDDRLARA
FT                   SRTTTATRNTSFSLGRRTSSTESLPDDAEARFISKSAAVLAQLSRMLSESFNITESILP
FT                   GTELRSLGLDSLVAVELEYDLQQAFGLKVDLMQLSPELTVGGLARLILASESQTSGHIA
FT                   SSMMDCRQTTEGKSQMYLG"
FT   CDS_pept        join(complement(638966..639335),complement(637967..638843),
FT                   complement(637383..637911))
FT                   /codon_start=1
FT                   /gene_family="HOG000217373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263304"
FT                   /orf_name="AFUA_8G02360"
FT                   /product="TRI7-like toxin biosynthesis protein, putative "
FT                   /protein_id="EAL84932.1"
FT                   /db_xref="HOGENOM:HBG057798"
FT                   /db_xref="UniParc:UPI000051F8E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI0"
FT                   /transl_table=1
FT                   /translation="MCMDRLVESYPTGDPGDACRILGPIAIMQADLEEISEFGLQTSIF
FT                   GRPTPISRLHHTVSSLHHFESGHWVSTYKSRPAAFFFTSGDFHSDQFNKAIAGRRDFVR
FT                   SCRRGHAERNYSGFSLADGTIIWTLKYVPLAASRCLIFLRVIRMQKFSDQVKEMPRRER
FT                   RVLETLLYALPFLLAQNLVPAILILKTKKNAVLRYLWIFWSVFVFYQWLQIPISHGESG
FT                   TYVAKVGVQLFIVILQGFNLVLINPLDRDELLQTKVTGPRDDLLRQVYKVARLFTYLRG
FT                   VRTPWQVKGIPSHPAYLELQPKTPISRSAFLVRQAAIVAWLYLYLNCANSLADRNSSPL
FT                   SKPIYGLGYLRVSREEWRTRIMTSLMFWFAFLRAAVDIDYRTASILSVGVGLDAPEDWP
FT                   PLFGRANQAYTLRNFWGTYWHQMFRWPFTATSNYLARELMALPRPSLLERYTNIFFVFL
FT                   VSGVMHVMSDLLMGISMSQSASILFFCSMAVGVMIEDAVQAAWTRVSDSHRPGGASTVD
FT                   SDGYAVPCWHKLVGFIWVCVWLSLTTPAWLCPLQMSKEKSLFLVNIPELVGTRKAIAIT
FT                   VGGGLLVKYTFRGEL"
FT   CDS_pept        join(complement(640859..641154),complement(640530..640804),
FT                   complement(640101..640471),complement(639555..640040))
FT                   /codon_start=1
FT                   /gene_family="HOG000181620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263305"
FT                   /orf_name="AFUA_8G02380"
FT                   /product="FAD-dependent monooxygenase, putative "
FT                   /EC_number="1.14.13.1"
FT                   /function="salicylate 1-monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EBA27209.1"
FT                   /db_xref="GO:0018658"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG325225"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="UniParc:UPI0000F51AD6"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA41"
FT                   /transl_table=1
FT                   /translation="MTAKPPFKVIIVGGSIAGLTLAHCLSKAGIDYIVLEKRKHIAPQE
FT                   GASIGILPHGGRILEQLGLFYLVEEQIEPLHTAHQYFPDGFAHTTKAPQVIYERFGLPL
FT                   AFLERRRMLRALYDTLPDSSQVLVNKAVTSVEREVSDLMRVTTYDGSVYRGNLVVGADG
FT                   VHSRVRAEMWRLATSQSPGVFPEHEMSAMAVEYACIFGISSSVPKLQPGEQVASFNNGR
FT                   SYLTFPGKNGRVFWFLLLKLDRKYSYSNAPRFSSTDAEKRAERFADDHIWAGVNFRDLW
FT                   KSKEVFSFVNLEEYLFQQWHWERIVCIGDSMHKMTPNTGQGANCAIEDAAALVNRLHRA
FT                   LKATPDGSSLSSGDIDDLLGEFNRARSRRVREIYQGSRMVVRLQARQNLFLKLLGRYYL
FT                   PYRGEVAADAASKIIAPAEHLDFLPLATRSATGWHQFKPGQSKTLLIPFLYPVVAFSLC
FT                   VLAWIGNDYLRNGVVFA"
FT   CDS_pept        join(complement(642327..642838),complement(642051..642252))
FT                   /codon_start=1
FT                   /gene_family="HOG000217374" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263306"
FT                   /orf_name="AFUA_8G02390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84929.1"
FT                   /db_xref="HOGENOM:HBG057771"
FT                   /db_xref="UniParc:UPI000051F19F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI3"
FT                   /transl_table=1
FT                   /translation="MDAYSSFPAEFEAVRPIYNVLVATAGMMWLINYIVTVRQIFRDRV
FT                   RAIPLVSLCCNIAWEFTVVLVYRRPYLLFEIFCAMWLLVNMVIVYGSVKVSMEKQRSSS
FT                   LVHKHLPLIVPLAILGCISGYYALAKTIGTPKTIHGGGTFASFVMTVDCLCQLLQRGST
FT                   HGASWTMWLTRVLGSYAAIVGEFLKAGFWPQQWGWYDNALMRWCTGMAVTMDILYACIF
FT                   WYMGQAEEAAKGRKA"
FT   CDS_pept        join(643737..643943,644005..644159,644212..644538,
FT                   644586..644970)
FT                   /codon_start=1
FT                   /gene_family="HOG000169461" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263307"
FT                   /orf_name="AFUA_8G02400"
FT                   /product="Geranylgeranyl pyrophosphate synthetase AtmG,
FT                   putative"
FT                   /EC_number="2.5.1.-"
FT                   /function="transferase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="EAL84928.1"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057762"
FT                   /db_xref="HOGENOM:HBG397395"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniParc:UPI000051FFF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI4"
FT                   /transl_table=1
FT                   /translation="MVSIPATSLYGLGRQQPFQDLSKSLLTHLNLFTPQEAQSQAVPGT
FT                   RTETEPTGSSPSDLQEQRKLADDKIIWAPLDYLCSFPGKDIRGKLISAFNQWLQIPEDK
FT                   LDVIKRVVGLLHSASLLIDDIQDSSKLRRGFPVAHSIFGIAQTINSANFAYFWAQQELK
FT                   KLGKPEAMVIFTEEMLRLHRGQGLDLYWRDSLTCPTEEEYLEMVANKTGGLFRLAIKLM
FT                   QMESHNTEDCVPLVDLLGIIFQIRDDYQNLQSDLYAKNKGFGEDITEGKFSYPIIHSIR
FT                   SDPSNFQLMNILKQKTEDEDVKRYAVRIIESTGSFDHCRKKLENLTAEAREILKDFGDL
FT                   GNTDGLKGILDFLELKG"
FT   CDS_pept        join(646179..646612,646719..647316)
FT                   /codon_start=1
FT                   /gene_family="HOG000217375" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263308"
FT                   /orf_name="AFUA_8G02410"
FT                   /product="UbiA prenyltransferase family protein "
FT                   /EC_number="2.5.1.-"
FT                   /function="prenyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84927.1"
FT                   /db_xref="GO:0004659"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057753"
FT                   /db_xref="HOGENOM:HBG325040"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniParc:UPI000051F42E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI5"
FT                   /transl_table=1
FT                   /translation="MCKMYKVVETDASPGQRSVLQLVKDLLILSRFHKYNPWLAVFSGG
FT                   VSLPILIGNSHPLTSGVSVWATLLAGANQIATHPASISADHIVKQTLLCLICGYIFCGA
FT                   GMVWNDWIDRNIDKNVARTKNRPLAAGRVTATEGFIWMMVHVAAMIPVTISTILYPFGK
FT                   RQLCRRLYIYPQYFLGFSLAWPGAIGWMAIKGRQIPFTQSISESLPLSITVFTWTLYLN
FT                   TAYSYQDVVDDSKMNVNSAYVAAGSRIHMFLVILAGLVLGSLYLQLRAQNSGWLWASWM
FT                   CVWALSFVHQLLRFDAKKPESGGPLHKENFALGVWTIVACAAELGLSSGMADQFFSNRV
FT                   FRR"
FT   tRNA            complement(647970..648049)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(648227..648440,648494..649068)
FT                   /codon_start=1
FT                   /gene_family="HOG000169464" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263309"
FT                   /orf_name="AFUA_8G02420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84926.1"
FT                   /db_xref="HOGENOM:HBG057745"
FT                   /db_xref="HOGENOM:HBG325680"
FT                   /db_xref="UniParc:UPI000052047A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI6"
FT                   /transl_table=1
FT                   /translation="MTANQTSSSSSSSSSLSTRISLRWPPDPAFENTDTIVLSLMGWYV
FT                   DLRVDKSTGKIDWAIAGQRIVESQEPLRVLFTHAIDSHNAFEAVDCGTFTQLPNGDDLE
FT                   TGSMPRWDLPGKPVREYEEVWRELAFREGPEGPGRGVSWVLEARGDVQGVSGQDASTVT
FT                   RMFIARIWGTYVALRQEQMHSGGDSEAEIKDGGEVSARREEWDSTSGWKTKYVLGPDAD
FT                   KLPSMTTIGTGDGDWSIGSEVLLSDQPYIVRACERIDQEY"
FT   CDS_pept        join(complement(650128..650304),complement(649462..650073),
FT                   complement(649112..649408))
FT                   /codon_start=1
FT                   /gene_family="HOG000294667" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263310"
FT                   /orf_name="AFUA_8G02430"
FT                   /product="Zinc-binding alcohol dehydrogenase, putative "
FT                   /EC_number="1.1.-.-"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84925.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057738"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FFF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI7"
FT                   /transl_table=1
FT                   /translation="MAATDYKFEGWLGLDKNAAEGNMVWKEFTPKAWEETDIDIKITHS
FT                   GICGSDLHTLRSGWGPTMYPCCVGHEIVGIAVRVGSKAEGGIKVGDRVGVGAQNDSCLG
FT                   RKGDCEECASGMEQYCKHGMVGTYNGVHYNGDKSYGGYALYHRAPSHFVIKIPDAIPSA
FT                   EAAPMMCGGITLYSPLKHYGCGPGKKVGVVGIGGLGHFGILFAKALGADKVVAISRKAN
FT                   KREDALKLGADEYIATDDEPDWAKTHNRSLDLIVSTVSSSKMPIVQYCSLLRTNGAFVQ
FT                   MGAPEDGALQIPAHALIGRRIRMGGSLIGSPSEIREMLQLAAEKGVHPWIQERPMKDAN
FT                   QAVVDMNDGKARYRYVLVNDQ"
FT   CDS_pept        join(complement(654914..655067),complement(654188..654868),
FT                   complement(654067..654140))
FT                   /codon_start=1
FT                   /gene_family="HOG000162289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750842"
FT                   /orf_name="AFUA_8G02440"
FT                   /product="C-4 methyl sterol oxidase, putative "
FT                   /EC_number="1.-.-.-"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84924.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057732"
FT                   /db_xref="HOGENOM:HBG325679"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI000052046E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI8"
FT                   /transl_table=1
FT                   /translation="MDSLNSSYPQSAMATYSDLLDLAAQQQPHLSGLERLWWAHYAYWD
FT                   NNIVATATGIITFLAHEIIYFSRCLPWIIADSLPSIFLKYKIQDQKPPPSAAEQWACTK
FT                   YILLIHFVVELPLIVLFHPMMELCGLSFTIPFPDLRTLTAQIIIFFLLEDTYHYWLHRA
FT                   MHWGPLYRSIHRIHHQYAAPFGLTAEYASPWETLLLGLGTIGPPLLLALMDCNVHLVTV
FT                   LAWVTLRQFQAIDSHSGYDFPWSLRRILPFWGGADWHDDHHRYFWGNYSSSFRHWDVLM
FT                   GTVAGPEAREKRRAEREKRQA"
FT   tRNA            complement(655396..655475)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        join(complement(656258..656427),complement(655728..656208))
FT                   /codon_start=1
FT                   /gene_family="HOG000169475" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263311"
FT                   /orf_name="AFUA_8G02450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84923.1"
FT                   /db_xref="HOGENOM:HBG057722"
FT                   /db_xref="UniParc:UPI000051E5D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBI9"
FT                   /transl_table=1
FT                   /translation="MNNSPFPPFLQDPLPLLSTMRHFIFTLLALATTSALAQDPGPSPT
FT                   ASVGCKPHGDHWHCDGPATGAATATTELSLAPSPTESVGCEPHGDHWHCDGPASATAVP
FT                   TATSDDHDHDHDHDHDDDHDDHGTATPTVPSPTASVGCKPHNDHWHCDGPRETGSPSAS
FT                   VNEASASTLVSTTSSTTASATGAQQSGGAGSLGVELTGAVGLALAVAAAAFHV"
FT   CDS_pept        join(657431..657870,658094..658517,658571..659047)
FT                   /codon_start=1
FT                   /gene_family="HOG000169486" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263312"
FT                   /orf_name="AFUA_8G02460"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL84922.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057716"
FT                   /db_xref="HOGENOM:HBG328272"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F41C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ0"
FT                   /transl_table=1
FT                   /translation="MLDESRHDQCEETPLLGHDHAPESGHSTRARWVLIVLSLGIIAVN
FT                   FGSYLAMAPQIQIFEYIICQKLHPEIALLTPQEQIDARCKSPDVQGELALVNGWKETLD
FT                   ALPGIFLALPFGLMADQAGRKKVLMLSLIGLIIEEVVVRIIGKANIFFLIYASTQVAEI
FT                   VASPLSAWLMSRTPWLPYFLGVLFMLCGLCASITVPETLPKSTKLSEPDTEDDEADDDA
FT                   PRTVRYRLKAVLHHARHQIMHHSRFIFADRNIGCISIALLAANVAIQSLVITLQYVSKR
FT                   FSWSMAEASFLISLKGITNLSALLLILPAASKALDRFLPPLRRDLRISIGSILTIVVGH
FT                   VVMALAASPTIFIVGLSTSSLGTGFFPALRSVATALVHEAEIGLLGTTIALTQSIGGIA
FT                   AGPMMAGTFKLSMKLHGIWLGLPYISATALVLVACWATLMIRVPRSV"
FT   CDS_pept        join(659819..659961,660011..660242,660286..660765)
FT                   /codon_start=1
FT                   /gene_family="HOG000221402" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263313"
FT                   /orf_name="AFUA_8G02470"
FT                   /product="Trihydroxytoluene oxygenase "
FT                   /EC_number="1.13.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84921.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057711"
FT                   /db_xref="HOGENOM:HBG373473"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI000051F675"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ1"
FT                   /transl_table=1
FT                   /translation="MKVVKKTDKEVWYRGYGTDPYVYYACKGPKKEFLGGTFEVESHQD
FT                   LERAANLPTGSPIQEMRDAPGGGFMVTVKDPEGFPINLVYGQSPAAPGEYPPKLVVNYE
FT                   SDKPRVRHFQRFVPGPAAVHKLGHFGLCVRNFQDMVTFYTTTFNLVPSDFLYVEKDGNK
FT                   KNVALFAHIDRGADYVDHHSFFMSTNPTSHVHHCSFEVHDFDTQNLGHQWLAHKGYEPV
FT                   WGVGRHILGSQLFDYWWDTTGNMIEHYADGDLVNEETPVGYGPAGDESLAVWGPQVPKW
FT                   FLD"
FT   CDS_pept        join(661810..661978,662032..662279,662331..662424,
FT                   662497..662548,662582..662726)
FT                   /codon_start=1
FT                   /gene_family="HOG000169286" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263314"
FT                   /orf_name="AFUA_8G02480"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84920.1"
FT                   /db_xref="HOGENOM:HBG057701"
FT                   /db_xref="HOGENOM:HBG325674"
FT                   /db_xref="UniParc:UPI000051FDC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ2"
FT                   /transl_table=1
FT                   /translation="MAVIWGLDLHEIQWNKFKGAKMFNRAYHLRRTKMIVYQMAMIFCV
FT                   ISESVGTAALSDYLDQQDAIQQQHPEAKVHNNDFIGAASYNIFVGVSVATIFGAAFFFD
FT                   LFWPERHESKSVRLAWKISGVVVSVMMLASALTMTIITATHSAQITGTDDDSARKFWAE
FT                   AAKKPALPIASVVFAWPGWVATVARRLLMQDSTVILFVSHKHDDKLGPKSNYGRETESV
FT                   PAILETGEKTTTA"
FT   CDS_pept        join(664785..665092,665154..665571)
FT                   /codon_start=1
FT                   /gene_family="HOG000217378" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263315"
FT                   /orf_name="AFUA_8G02490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84919.1"
FT                   /db_xref="HOGENOM:HBG057694"
FT                   /db_xref="HOGENOM:HBG325673"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="UniParc:UPI000052022B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ3"
FT                   /transl_table=1
FT                   /translation="METDQTKQRRSPEQPGLEVAIPDGLIPKYERDAPLYYAGDGSEAP
FT                   IPVETEVGQGLEVKGAKDAPRTICGFRRRHFWIAVVVAVVVIAVAAGVGGSVANKNSGS
FT                   SVPTSTATAASTSTSASTSATSSATSCPANGTTITVQQRDYIRLCDTDLCSDKGGCASV
FT                   TISNDDLVNFKTNSLEQCIQRCVSYNIMIKGAPCKGVSWDEKAPSSTNRTHRCFLKNDT
FT                   SIRKTAPSGWTILSAVAVE"
FT   tRNA            complement(665780..665850)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        join(complement(666534..667080),complement(666129..666478))
FT                   /codon_start=1
FT                   /gene_family="HOG000125753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263316"
FT                   /orf_name="AFUA_8G02500"
FT                   /product="Glutathione S-transferase "
FT                   /function="transferase activity"
FT                   /protein_id="EAL84918.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057684"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000051F1A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ4"
FT                   /transl_table=1
FT                   /translation="MSTDYTLDSYTLHSSTDLQLLSALHNDGYSRYQNHAILVAHDSTA
FT                   RNARNVLTRTRLEKSRAQRIVWLLEELNIPYEIKTFKRKADMTAPDELKKIQPLGKSPV
FT                   ITITTPNCPEPLVLAESAVIIEYLCTHFGGEKLIPQRYAAGKQGQVGGETEAWMRYQYF
FT                   MHYTEGSLTPFLVMKVVMNSVRNAPVPFFIKPVTRMIASKVEGAFINPNIHTHLAFLED
FT                   QLKTAPGGGPFLCGDQITSADIQLSYSVIAALSRQPSLRSQYPGVAAYADRLQAIESYK
FT                   RGVAKIERIEGTFTASL"
FT   CDS_pept        join(668886..668954,669007..669067,669118..669209,
FT                   669259..669470,669527..669614,669664..669808,
FT                   669912..670047,670107..670197,670291..670791)
FT                   /codon_start=1
FT                   /gene_family="HOG000169275" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750843"
FT                   /orf_name="AFUA_8G02510"
FT                   /product="Glycosyl hydrolase family 43 protein "
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL84917.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG057683"
FT                   /db_xref="HOGENOM:HBG325670"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="UniParc:UPI00005206D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ5"
FT                   /transl_table=1
FT                   /translation="MLLISRLVAALALAGTAIASLQIIPGGTWTASGTNQHVQAHGGGI
FT                   IQVGSTYYWIGENKLNGSAFQSINCYSSENLVEWTYVGELLSRQSSGDLGPNRVVERPK
FT                   VLYNEATRKYVMWMHIDDSSYKEAKTGVATSSSVCGKYTYLGSFQPLGQQSRDMGLFKD
FT                   DDGSAYLLTEDRPNGLRINRLTSDYTNVTSTVHLFPEHIEAPAMYKKNGVYFMFGSQLT
FT                   ATNDNKYTTSTSISGPWSSWANFAPSGSNTFNSQTTFILGVGDTVMYMGDRWVPSNLMA
FT                   STYIWLPLTISGTTATLQNQVNWILPLQGIWTPGPTETNPEAESSTNALSNGARVISCS
FT                   GCSGGMAVGWIGGPSDGTLRIVGVESSASTRSTIRVKYENGDSSQRYALVSVNGKTQVL
FT                   AFLPSGGSPASSTLHADLQSGSGNTVTFSAYAQGYGGLFSSPTDLVMAADMEVGPDVDR
FT                   LMVPKT"
FT   CDS_pept        join(complement(672783..673073),complement(672708..672732),
FT                   complement(671173..672653))
FT                   /codon_start=1
FT                   /gene_family="HOG000169239" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263317"
FT                   /orf_name="AFUA_8G02520"
FT                   /product="Arylsulfatase, putative "
FT                   /EC_number="3.1.6.1"
FT                   /function="arylsulfatase activity"
FT                   /biological_process="phenol-containing compound metabolic
FT                   process"
FT                   /protein_id="EAL84916.1"
FT                   /db_xref="GO:0004065"
FT                   /db_xref="GO:0018958"
FT                   /db_xref="HOGENOM:HBG057677"
FT                   /db_xref="HOGENOM:HBG408046"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012083"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI000051FDC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ6"
FT                   /transl_table=1
FT                   /translation="MRVPDVIALAGLLAVSGATSSGQETLLMPRKQATQPNVLFIMSDD
FT                   QDLELNSPAFTPYIQKHIRDKGVEFTNHFVTTSLCCPSRVSLWTGRQAHNTNVTDVSPP
FT                   WGGYPKFVSQGFNEAWLPVWLQEAGYNTYYTGKLMNGHTTSNYNSPFPKGWNGSDFLLD
FT                   PYTYAYLNSTYQRNREPPKNYAGQYTTDVITEKALGFLNDALSSDRPFFLAVAPIAPHS
FT                   NIEPSALGTGGAKGTLMTAPIPAERHKDLFPDAKVPRTANFNPKVPTGGGWVQHLPLAN
FT                   QTVIDYQDHFYRQRLRALQALDEMVDALITRLEESGHAENTYIIYTADNGFHIGQHRLP
FT                   PGKSSGYEEDIHVPFYIRGPGIPRGKTDDSVTTHIDLAPTFFQLAGIPLREDFDGTPMP
FT                   VAKGIKGIAHEHVAVEFWGKSPLEGDYGALGELASPFLNSSLTATAPGGSFSMPNNTYK
FT                   SARIVGNGYSLYYSVWCNDDHELYDMIQDPYQVNNLYATANATSPRLLGRDLSNVISRL
FT                   DALLMVLKSCKGDSCITPWDVIHPDGSVKDLRDALDPKYDQFYRAQPKVSYSACEKGYI
FT                   LSSEGPQNGLVYRDGLSWEAWT"
FT   tRNA            complement(673206..673276)
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        complement(674424..676112)
FT                   /codon_start=1
FT                   /gene_family="HOG000169228" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263318"
FT                   /orf_name="AFUA_8G02530"
FT                   /product="Extracellular lipase, putative "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /protein_id="EAL84915.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="HOGENOM:HBG057668"
FT                   /db_xref="HOGENOM:HBG326885"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000052022A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ7"
FT                   /transl_table=1
FT                   /translation="MHLLRVVLPLLSLSPAGLAAPASPAAPTVTIASPAATIVGSSGKV
FT                   EKFNAIPFAQPPTGPLRLKPPQPIQKPLGTIDGTGSAKSCPQFFFSTDNSEFPGSVAGL
FT                   LANLPLFQTVTNAGEDCLTLNVARPSGTAPGAKLPVLVWIYGGGFELGATATYDATSLV
FT                   ASSIDLGMPIVFVAMNYRTGGFGFLPGKEILADGAANLGLLDQRLALQWVADNIAAFGG
FT                   DPDKVTIWGESAGSISVFDHMILYDGDNTYKGKPLFRGGIMNSGSVIPADPVDGVKGQQ
FT                   VYDAVVDYAGCSSAADTLECLRGLDYTDFLNAANAVPGILSYHSVALSYLPRPDGKAIT
FT                   ASPDILVKTGKYAAVPIIIGDQEDEGTLFALFQSNITTTKQVVDYLAKYYFFGATRDQL
FT                   EELVATYPDVTTDGSPFRTGIFNNWYPQFKRLAALLGDLTFTLTRRAYLKYVTELHPSL
FT                   PCWSYLSSYDYGTPIMGTFHGSDILQVFYGILPNYASRAFHTYYFSFVYDLDPNSRRGS
FT                   LMEWPRWNDDQQLMQVFNNRGALLADDFRNDTYNFILENVDSFHI"
FT   CDS_pept        join(complement(680216..680358),complement(679992..680148))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263319"
FT                   /orf_name="AFUA_8G02540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84914.1"
FT                   /db_xref="HOGENOM:HBG057663"
FT                   /db_xref="UniParc:UPI000051FB62"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ8"
FT                   /transl_table=1
FT                   /translation="MGMSGRELIEAKDKWEKLAMGARPFHVVCDSIEALEDRSRDGDIL
FT                   GGWAGGGTMVVAWLGLGWGLAGKLECNLTAWLSENRPMNRGTGYQTIRGLAACQ"
FT   CDS_pept        join(680833..681151,681197..681313,681368..681590,
FT                   681657..682234,682298..682989)
FT                   /codon_start=1
FT                   /gene_family="HOG000161421" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056133"
FT                   /orf_name="AFUA_8G02550"
FT                   /product="MFS peptide transporter, putative "
FT                   /function="transporter activity"
FT                   /biological_process="oligopeptide transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL84913.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0006857"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057654"
FT                   /db_xref="HOGENOM:HBG323814"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="UniParc:UPI000051F8D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBJ9"
FT                   /transl_table=1
FT                   /translation="MNVSDPVEVAEVARARASAQDAQIDEKTDHKLSLTPSIEEVPPAS
FT                   KEAGVSSAAYEDDHSHLQRQFPSDDDFKHLRRIAGDIPWTAYTVAFVELCERFSYYGTT
FT                   AVFVNFIQRPLPEGSTTGAGYDHSNPGALGMGQQASTGLTLFNAFWSYVMPLAGAYMAD
FT                   QYWGRFRTIMFSIAAALLGHIILIVSALPPVIAHPNGAIACFSIGLLIMGVGTGGFKSN
FT                   ISPLIAEQYREEVPYIKTLKNGNRVIVDPAATISRIYLYFYMMINIGSILGQVSMVYAE
FT                   KYVGFWLSYFLPTVMYLGCPIVLFFCRNKYHLVKPTGSVYTQAIRLWKLAMKGRWSLNP
FT                   ARMYVSPFAVVCWWHFTDPRSWKKNPKPFWDSVKPSALGRDRPQWMTFDDEWVDEVSRG
FT                   LKACKVFLWYPLYWLAYNQMINNLTSQAATMRLGGVPNDIINNLNPLSLIIFIPIMDKL
FT                   IYPGLRRMGIKFTPLKRITAGFFFAGSGMICATVTQYYIYKIGPCGKEANYCLDELNQH
FT                   SDISVWVQTLTYVLGGISEIFASVTSLEYAFTKAPKNMRSLVQAVALFMNAFSSALGQA
FT                   LVSLSEDPLLVWNYTVVAILAFVGGIGFWLTNYKLDKQEDALNNLPASRYGGDNPDPKL
FT                   DEESVRQ"
FT   CDS_pept        join(complement(684399..684489),complement(683770..684339),
FT                   complement(683587..683701),complement(683318..683525),
FT                   complement(683165..683263))
FT                   /codon_start=1
FT                   /gene_family="HOG000071679" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056134"
FT                   /orf_name="AFUA_8G02560"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase,
FT                   putative"
FT                   /EC_number="1.2.1.12"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84912.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057644"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI000051E836"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK0"
FT                   /transl_table=1
FT                   /translation="MAPSINDFPHSTSSPQSPVCKIGINGFGRIGRNVLRAALNRPDLQ
FT                   IVAINHTCTTIDDLIHLIRYDSSMGNLPPSIPIHALSDTLLSINGHQIALTSERTLQNL
FT                   DWAALGAEYVIECTGKFTKHAQALEHVTHGRAKRVIISAPSADAPTFVFGVNSDEYTAD
FT                   EARRVISCASCTTNCVTPVLKVLQGQFGIAQGFLTTVHAATRSQSVLDGYSRKNRRLGR
FT                   SVFDNIIPTTTGAAKAIATVLPALSGKVTGVSIRVPTPNVSMIDLTVSTEKPTSLAEVL
FT                   AVFRRAAKGELAGVLAVSEEELVSSDYLGNPHSAIIDAPACLELNPQFFKIMAWYDNEW
FT                   GYSNRLLDLARHVASQELGA"
FT   CDS_pept        complement(685464..686924)
FT                   /codon_start=1
FT                   /gene_family="HOG000143616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750844"
FT                   /orf_name="AFUA_8G02570"
FT                   /product="Flavin-binding monooxygenase, putative "
FT                   /function="NADP or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84911.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057637"
FT                   /db_xref="HOGENOM:HBG289327"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000051E841"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK1"
FT                   /transl_table=1
FT                   /translation="MDYDIIIVGAGISGINAAYRIQSQLPSHRYAILEARNAIGGTWDL
FT                   FKYPGIRSDSDLFTFGFSWNPWNQDTPIAEGASISKYMRDTAAQYGIDKHIHFQHRLLA
FT                   ADWSSADNVWKLAVDHEGESKSYTARFVIFGTGYYNYHEPLAADVPGLSQFQGQVIHPQ
FT                   FWPQDLDYTDKKVVIIGSGATAVTLLPKMAEKAAKVTMLQRSPTYILALPNRQSSILSW
FT                   ILPNTVNRKLQRLRWIFTSRLFFLFCQTFPWMARLLLKLSVVRQLPKNIPHDPHFKPRY
FT                   NPWDQRLCICPDGDFFKSLHTGRADVKTDTIRQVTTSGIELNSGDFLDADIIVTATGLK
FT                   LQIAGGTSITVDGEKQRVPDKYLWNGVMLQDLPNASFVIGYTNASWTLGADATALFVCR
FT                   LLKWMEQHHKIAAVPRLNPMLAKQMQPRRLLNLNSTYVTAAEKDLPKAADRGPWQPRDN
FT                   YLSDLMFAKYGRLDEGLEWVDGGWKKQQ"
FT   CDS_pept        join(687771..687973,688025..688170,688223..688806,
FT                   688856..688996)
FT                   /codon_start=1
FT                   /gene_family="HOG000169196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056135"
FT                   /orf_name="AFUA_8G02590"
FT                   /product="Lipase/thioesterase family protein "
FT                   /protein_id="EAL84910.1"
FT                   /db_xref="HOGENOM:HBG057635"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniParc:UPI000051F41B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK2"
FT                   /transl_table=1
FT                   /translation="MAFNKAIKLTLWEKLDFFPALVSIWITAIWAILTGLRRESNQPKT
FT                   LFLHIGYAVFRKATTRLSIKQMQYVLPPTNKMYETYVKKTKRMSHTIDLGKGSYGHWIG
FT                   DAKADNVLIWYHGGGFALPANMGYFKFFANLVDHAATHNKSLAIFSLTYTLAPQATYPT
FT                   QLRQAVDCLRYILANTSHQPSRIFLGGDSAGGNLVGGVLSHLAHPHPQIDPLNVSENLA
FT                   GAVMIAPWTLMDTDFPDRKIDSSGDLITPAVAGPWARAYLGTATRDVYTDLSKAESDWY
FT                   STFPVANVLICAGGNEILLPIIQDFAEKFKAGFPSSELFVGHREGHVAPIYNLELGDTT
FT                   ETEQGKRVKEWLSKRLF"
FT   CDS_pept        join(complement(689976..690309),complement(689531..689924),
FT                   complement(689205..689481))
FT                   /codon_start=1
FT                   /gene_family="HOG000169185" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207426"
FT                   /orf_name="AFUA_8G02600"
FT                   /product="Short-chain dehydrogenase/reductase 2, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84909.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057628"
FT                   /db_xref="HOGENOM:HBG329148"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051FDC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK3"
FT                   /transl_table=1
FT                   /translation="MSLESALSIARQYAQSSLAQLPESAQNALLNPLVQKALTAALVYG
FT                   ALRQTNRLLSQWSINNWQRAHPWQGDRELVLVSGGCSGIGKQIMEDLSRKGIRVVILDI
FT                   NEPNFQLPRNVHFFKADITNSESIRAVAEKIRQKLGDPTVLVNNAGVGYDGTILDEPEA
FT                   KIRQTFEVNTISHFLMVREFLPSMIRQNHGHVITIASMASFVALGEMVDYCCTKASALA
FT                   FHEGLTQELRYWYQARKVRTSVIHPLWVRTPMIQQLTDAGNQFKQPVMTPQVVSDAVVK
FT                   QILTQSSGQVILPTSHSAASMVRAFPQWLQETVRGIASGSLRRLREHQAAQKL"
FT   CDS_pept        join(691189..691386,691435..691880,691933..692317,
FT                   692374..692988)
FT                   /codon_start=1
FT                   /gene_family="HOG000169440" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207427"
FT                   /orf_name="AFUA_8G02610"
FT                   /product="Cytochrome P450 monooxygenase, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84908.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057619"
FT                   /db_xref="HOGENOM:HBG325657"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="UniParc:UPI0000520223"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK4"
FT                   /transl_table=1
FT                   /translation="MADTLLAIASVSLAEGYFLQRSVLKEYSFHSVCLGAVGVNLALKI
FT                   FWDFIIYPFFITANRHLPTVKGTFVNGKVIFDNPRGRLPLQWMKTIPNEGLIHFRDVFN
FT                   RSHLLPTTHQALLDIMSTNTYDFEKPWRAREFLARIIGFGLILSEGAAHKKQRKALTPA
FT                   FNIKNIRSLYSLMWEKTGLFLDELEKEIRQNPMEGTSPEDGVGKVEMSMWASRLTLDII
FT                   GPAAMGRDFRSLHNPENKVADSFLAILEPTKEKMAFLAINFILPQWFARRLPWRLNNVI
FT                   DTETGFLRDLCKDIVREKRNTIVSSNMTAKELEADILGTMMVGGDFTDDELVDQMLTFL
FT                   AAGHETTASALTWACYLLTLHPDVQERLRTEIREHIPSGNHPISWSDLESMPLLNGVCQ
FT                   EVLRLYPTVPITIREAVRDTTIAGKHVPKGTRILICPYAINRSPEFWGDNGEEFLPERW
FT                   IDHDKNGQKVVNHNGGASTNYAQITFLHGQRSCIGKDFARAELRCAVAGVVGRFKFEMQ
FT                   DPKQEIHIAGAVTTKPVEGMHLKMSRVDEW"
FT   CDS_pept        join(complement(694965..695141),complement(694827..694915),
FT                   complement(694481..694771),complement(694086..694421),
FT                   complement(693935..694000),complement(693100..693916))
FT                   /codon_start=1
FT                   /gene_family="HOG000182212" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263320"
FT                   /orf_name="AFUA_8G02620"
FT                   /product="CobW domain protein"
FT                   /protein_id="EAL84907.1"
FT                   /db_xref="HOGENOM:HBG057608"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000051EF22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK5"
FT                   /transl_table=1
FT                   /translation="MLPAWSNFIPESGSKGTVDFNEMVINSGTDSLSYPAPAQPEAEEK
FT                   PTRQIPVTLLSGFLGSGKTTLLEHILQSPDHGLRIAVVVNDMSKLNIDAALITHHRVSQ
FT                   TKEKLIQLQNGCICCTLRGDLLSELAHLARQKEVQYVVIESTGISEPMQVAETFTAEFS
FT                   SAMLQADQEMLVDEDSRKVLTEIVNLGGLHTLARLDTTVTVVDAFNLLSNFDTAEFLSD
FT                   RYGSKDIIPEDERTISDLMVDQIEFADVLIINKIETVDENTRARIRRLLKTLNPEAKVL
FT                   ETSYSRVDVKEILDTGREWLRSRRPWSLSPLPSIQHQGRYGINNFVYTARRPFHPRRLF
FT                   TLLHDKFILLQNNEADEGDEDEDEKEAADEGEEEGEEEDDHMEMDEDEDENDGDDDDDD
FT                   ESISDFEQPDPSEILKNKRNHPAFSSILRSKGFFWLATRPFQFGEWSQAGGMLTMGCGG
FT                   PWFAEVPDEAWPEDPDVRKSIENDFREPPLGDRRQEIVFIGEGINTELITKLLDECLVD
FT                   DDDMSRWTKIMNNKRLSYRQKEEKLGKLWEDGWEAWPEFGIVDEDEEDNNEGGKKKHKH
FT                   YTSEYQGRVHSHSHK"
FT   CDS_pept        join(complement(696923..697486),complement(696691..696864),
FT                   complement(696392..696637),complement(695907..696341))
FT                   /codon_start=1
FT                   /gene_family="HOG000217379" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207428"
FT                   /gene_name="pgxB"
FT                   /orf_name="AFUA_8G02630"
FT                   /product="Probable exopolygalacturonase B "
FT                   /EC_number="3.2.1.67"
FT                   /function="galacturan 1,4-alpha-galacturonidase activity "
FT                   /function="polygalacturonase activity"
FT                   /biological_process="cellular cell wall organization "
FT                   /biological_process="pectin catabolic process"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL84906.1"
FT                   /db_xref="GO:0004650"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0045490"
FT                   /db_xref="GO:0047911"
FT                   /db_xref="HOGENOM:HBG057597"
FT                   /db_xref="HOGENOM:HBG332070"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniParc:UPI000052046D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBK6"
FT                   /transl_table=1
FT                   /translation="MKFFALAALFASTVNSIAVDGLIPGARVIPANDVVALKKAGAYHQ
FT                   KHHHRRTVIIRSSSSDEDDVSADFLWGIKRANHGGRLLLQNGKKYVIGKKLDLTFLKDI
FT                   EVQLDGELKVLWPKILDPVLAGVNTIEKFTNDVPYWQANNFYYDFQKSISFWRWGGEDI
FT                   KIFGSGVLNGNGQRWYNEFAGQEILDPNNKYYRPILFVTENATRVSVEGITQLNSPCWT
FT                   NFFVRTKDISFDNVFIHAYSTNASALPKNTDGFDTLNVDGLTVTNTRVDIGDDCLSPKP
FT                   NTTNVFVKNLWCNGTHGASMGSIGQYPGVLDIIENVWIENVTLLNGENGARLKAWAGPD
FT                   VGYGRINNVTYKNIHVENTDNPIVLDQCYFNINATQCAAYPSRVNFTNIVFEDIYGTSS
FT                   GKRGKVVADLTCSPNAVCSGIRLKNIHLTSPAGSPPVIVCDGIQGDIGVECQSSSNSTT
FT                   RRSVDLARSLKYRA"
FT   CDS_pept        join(complement(700427..701008),complement(698638..700110))
FT                   /codon_start=1
FT                   /gene_family="HOG000169163" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263321"
FT                   /orf_name="AFUA_8G02640"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84905.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057586"
FT                   /db_xref="HOGENOM:HBG325630"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051F42D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK7"
FT                   /transl_table=1
FT                   /translation="MEQSRSSPKPVARRRRPPLSCTVCRRRKLKCDRELPCGQCTKSKT
FT                   PDQCIYVGPQAGSLSSVRRAESRDTTANDRTRASTDCGSPVYNGVYVFDSKHQRFPTRV
FT                   TKPKSHSDEVQELRTQVLTLENALAKASSIQTPDTLGAVPSIVSELGPRTAGDEHYISE
FT                   DIRSLPCAFFRGKKSNTRFCGRSHSFLALSFYEEYWIAPQHPDMVFLAKLLLLMAASSC
FT                   FYGPTKKINDKDTLASTAIHWIEAVQTWSATTIGTRNTNFDMLQIHCLLLIARQAIASD
FT                   GDTIWISSGSLIRLAMAMGLHRNPLRFQKLSRFWAEMRRRLWATILELDLQSSMDGGMP
FT                   PAIDLEEYDCDPPSNYDDADLVESMTEDPPPKDPDIVTRSSFQVLLSRSLPVRVHIAKL
FT                   VNRLRFTISYDEALLLSEELMRSLNDALELFPSDGYPSHIPGVENPAFTKSYFIFLIRR
FT                   HLLALHRPFCLSIMRTPKFSYSRKICLDSALDILSLLEPSLDVAEAEPQPHLGHLTGGM
FT                   FREELLNAAVMVCVELVLQADEYSRSKSMLPGQSSVLSSLNDMAESQQAVLVRAIENTL
FT                   NVFGSRIAPGGRGCKPYFFLSLTLASVKARLNGEDPFVAMDQVVTNVIRDYHLLMSGMP
FT                   WADVRKQDENSTKDVSDCRFITQRLFTDTQLDQYSYTWAHCRYAVRSAL"
FT   CDS_pept        join(complement(706030..706586),complement(704637..705963),
FT                   complement(704369..704578),complement(703699..704311),
FT                   complement(703159..703637),complement(702309..703099),
FT                   complement(701851..702235))
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263322"
FT                   /orf_name="AFUA_8G02650"
FT                   /product="ABC multidrug transporter, putative "
FT                   /EC_number="3.6.3.-"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84904.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG057575"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00005206D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK8"
FT                   /transl_table=1
FT                   /translation="MISHLLENVFFLVRSEGLLVTTRLLRSKRLSGMPAHLPQHLGGTP
FT                   IDTSYEVGTQTEVALKSRVVSSPGDEDAIAEIHHTLTGRSHQGIDQYPEPHSSFDSFLE
FT                   AELRAGRRKPSLGVCFQSITTWGAGEAHTTVKTLGTALWRTLTLQDIYEWTIQPLFSPR
FT                   KPQDGRPLIRDFSGVARTGEIMLVLGRPGAGCSTFLRTVAGYHSSFLGVTGHIDYSGLT
FT                   LEHVTKHYRGEVVYVPEDDAHFPTLNVQQTLEFALQSKTPKRYRERIPRYLEIYGRVFG
FT                   MSHTMKTLVGNEYIRGVSGGERKRISIIESLATDSSVMCWDNSTRGLDASSALDYVRSL
FT                   RIMTDTCGKATILTLYQASDAIFDLVDKVLLIDEGRMLYQGPAQEAKGYFEYLGYQCAE
FT                   MQTVSDFLTSITIPERRRFRPGWENRSPKGAIELEDAFRKSAAFHQILEDIRNYEEKQA
FT                   GIQGLRTSQSDCDRRSLKAFKSTVQAEKSRFVSAKSPYTISLFRQVVLCGKRQMWQVKG
FT                   HISPLLIKLISCVIYGLLIGSMFYELPENTDGMYSRGGVIFYSSILLAWLQMSELEEAM
FT                   QGRDILSRQKKFAFVRPSAVCLARVLADLVLVFHLVLLFLIVVYFLAGLKASAGSFWID
FT                   FLFIYLCTICLTAQFRLFAAASPNFEVALRYSGVSVLFCIVFGGYVLSVDKMMNNVPWV
FT                   GWIAYTTPALYTYEAMMAAEFHDTKFSCAPGAVIPSGYTYNNIAYQTCGISGSQPGTTM
FT                   VDGDHYLAVHYGFYYRNVWRNFGILCLFTLVYIAATCWLSEAFDWEPGSTGPTQYRKRA
FT                   KSSKRNLKSDQDEENGPVQGLGSAPPPAQPPCQQPVQAVKGTSSTFTWKNLELEVQCGK
FT                   ETRKLLDDVNGYCRPGTLTALVGASGAGKSTLLTVLTQRQASGTLSGTISVDGRPVDES
FT                   FKRNIGYCPQMDVHDETSTIREALEFSALLRQPVSVRKEDKLSYVDTVLHTLELVDFQN
FT                   AIIGSLDIEKKRRVTIGVELCAKPELLLFLDEPTSGLGSQGASSIVSLLRRLADQGLAI
FT                   LCTIHQANQEQFEQFDKVLALSPGGRTYYFGEIGISGCCIFDYFKKYGDQPKKITNAAD
FT                   YLIEVVVGGMRDTDHEVDWADIWNRSAEADALQKEISNIHRARSQITESCDSTKQTHSM
FT                   PPLYCQIGLLTQRTLRQYWRSPEYPYSRLYASFFHALINGLTYLQTGNSSTDLQSKAFS
FT                   CFLVLMLVPEFINAISMRFILNRDIWKTREGPSGVYSWVAFCTAQIISEIPYAILSGVV
FT                   FYVLYYFLVGLPLGFPAGYTFVMFFLFFLFATSWGQWIAALSADSLVAATLMPFFIIMC
FT                   ELFNGILQPHKNMPVFWKYTMYYVTPFTYWIGGVLTSVLRGMPVVCNQDELVVFESPPN
FT                   TTCGEYAMPWLSSTGSGYLSNPDGSGHCGYCKYSRGDDVSLIWLGMSQRGC"
FT   CDS_pept        join(709895..710163,710398..710975,711047..711675)
FT                   /codon_start=1
FT                   /gene_family="HOG000169152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056136"
FT                   /orf_name="AFUA_8G02660"
FT                   /product="Chromate ion transporter, putative "
FT                   /function="chromate transmembrane transporter activity "
FT                   /protein_id="EAL84903.1"
FT                   /db_xref="GO:0015109"
FT                   /db_xref="HOGENOM:HBG057564"
FT                   /db_xref="HOGENOM:HBG325611"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniParc:UPI000051EF1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBK9"
FT                   /transl_table=1
FT                   /translation="MHLPPPFSRYLSSLRALNQRVQETAASEQRKSLSSRLSDVFLRTW
FT                   HLGFTSFGGPPVHFQIFHEKFVQGKGGQEKWVDEQTVSAETSEDVLPGAVGMYALSLGV
FT                   QKMNDVLPEIAYAFLSGLNASTVGIIALAAVQLAEKAIKDKLTRILVIFGACAGLCYNA
FT                   LWYFPLLIVLGGLSVVVWDGWMSQYIRKTRAKWRRRNSHPEEARQENGAPNEMELQVQQ
FT                   DSQMRSTPSNQGTVRSRKAGQAASLPETVSDAQTESLEVNSSLDHIIRIRVGVTVCVVF
FT                   FASFIAIMVARGVINFPPLALDLFGNMYLAGTIIFGGGPVVIPLLRSYVVDPGWVSGRD
FT                   FLIGLALIQAFPGPNFNFAVFLGALTLQKSQFPTIFGAFLGYLGIFMPGLTLAVAVQSF
FT                   WRVLRRRKWVVDWLRGVNAAAVGLVFTAVYRLWEIGYLTPKASNGQSLALEPWWVVVAT
FT                   VTYAENAWFKVPPAIAIIIGGILGLCWYGAVGR"
FT   CDS_pept        join(complement(712051..712527),complement(711814..712008))
FT                   /codon_start=1
FT                   /gene_family="HOG000169141" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263323"
FT                   /orf_name="AFUA_8G02670"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL84902.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057553"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniParc:UPI000051F42C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL0"
FT                   /transl_table=1
FT                   /translation="MEWLEKYLIIRGGRCKPTNIEAPKYEWPDSPVEPVGPCREAFNVQ
FT                   RNLFVDLEKLCTLAEKCRDTAIVNAIESRFLRKHAKHLKNLGDLLQQVTRVSKQPGLGL
FT                   YHLDAELRHNNGCIPWMSMNDPDTIEEGIRAVTKKIGGGLALQTHHEGTKLASKESTFA
FT                   GVGLRLKKRDKSGPKVEVNQTPCSPCFGCWDSICITMSQKLEQTANSKGLCVATKGFSI
FT                   M"
FT   CDS_pept        714058..714465
FT                   /codon_start=1
FT                   /gene_family="HOG000169130" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263324"
FT                   /orf_name="AFUA_8G02680"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84901.1"
FT                   /db_xref="HOGENOM:HBG057542"
FT                   /db_xref="UniParc:UPI000051E5D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL1"
FT                   /transl_table=1
FT                   /translation="MLYNALIRTHHITSRKKVSALKRAADTHNCFVLLRSGGCPGIMYV
FT                   ESRDMNSVESWVDVVRNLRYKDFQLVSRPGAIIRDDQPGESKPDRRPQSSDIPTLPHVG
FT                   LSEVESVKEFGSIMEQRGIWQWWRKGMGYLS"
FT   CDS_pept        join(complement(716026..716497),complement(715260..715942))
FT                   /codon_start=1
FT                   /gene_family="HOG000169118" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207429"
FT                   /gene_name="gnt1"
FT                   /orf_name="AFUA_8G02690"
FT                   /product="Glucose N-acetyltransferase 1 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="EAL84900.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057530"
FT                   /db_xref="HOGENOM:HBG325591"
FT                   /db_xref="UniParc:UPI000051FB65"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBL2"
FT                   /transl_table=1
FT                   /translation="MGNKKATLLPYRRDSASSEADFFDIPDEPCLAIAKRQLRRIRTWI
FT                   FFAVFIILILWFRREAPSPAPVSHIDYNKVDWSRYAYSQYATSSAYLCNAVMVFEALER
FT                   LGSRADRVLFYPEDWDLFVADDHDRDSQLLVLAKEKYKALLVPISAEMIKAGGGSGESW
FT                   DKSIAKLLAFGETEYDRVIHIDSDVTVLQSMDELFFLPPAKVAMPRAYWALPDTKTLSS
FT                   LLIVIEPSYREFKALMESAQPALHGQVEVDSNETQRYDMELLNNRYADSALVLPHRQYG
FT                   LVTGEFRKKDHRSFFGNDYETWDPDKVLAEAKLVHFSDWPLPKPWVLSNQKLLAEILPK
FT                   CDFKPGTMQERGCRDREVWKSLYEDFRRRRKVCPKIRTIHTEYG"
FT   CDS_pept        join(complement(717265..719433),complement(716955..717203))
FT                   /codon_start=1
FT                   /gene_family="HOG000169107" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750845"
FT                   /orf_name="AFUA_8G02700"
FT                   /product="Repressor protein"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /function="ATP binding"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL84899.2"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057519"
FT                   /db_xref="HOGENOM:HBG325583"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51AF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL3"
FT                   /transl_table=1
FT                   /translation="MMPPSSSVNIPRRFDRDASLVLVGIRGCGKRSLGFVAATALKRRF
FT                   ITEDHYFKEVTGLTRHEYLKRHGSQEFQRRDIDVLKKMLDNHQTQCVIECGLGSLTRPI
FT                   QEHLRLYLAKNPIVYLLRDMDRIQSLLGLEHQAVKLLCEGDPLHRTCSNFEYYNIEDCS
FT                   SVEPQVDGEAADRRSVNYSFKLREAKEDFTRFVRFVTGADVDQPGYDSPFVLLETPPEL
FT                   RSFTHAIFVRSSDLIEGVVDLAELESGGDAIELCIDCWGSSMARTISKQVSLLRRNART
FT                   PIILSVDTTVSGIGSGDLTSAQISELYFNVLEHGLRLAVEYLAVDLGQNQSLLNQVIRN
FT                   RGRTKIIGHYIFEPSSCVTWEDEECLSLYLEAEKLGCQIVRILRVATEREDNAAVGKFI
FT                   NKIQSLPGSHPPVIAYNIGSLGRTSQVFNSILTSVTHPAIKRRTDNGRDPIITSRDAIQ
FT                   ALFQSYTLDPLQFYILGGNVAYSLSPAMHNAAFRHCGMRHTYSIPESPSLAALDRLGRD
FT                   PHFGGASIVQPWRVQVFQKLASKSRHAEAIGAVNTIMPLRARADGTMFPLQEQASRRNQ
FT                   AGPVLGWYGENTDWVSIMTCISRHLSPRNTISPLKSAGLVIGAGGMARAAIYAMLRLGC
FT                   RNIFIYNRTLSRAEGVALHFNSWAASQVGSTQVVRVLKSLEDEWPLDTCPPCLIASCVP
FT                   ADPDRDEPPANFEMPTQWLGSPTGGVILEFAYKPLDTPLLRQMRRFRRETGRPWILVGG
FT                   LELVSEQAVAQFELLTGRKAPRRLMTLEALQNYVGEDGPLDEKEIQARLGYT"
FT   CDS_pept        join(723363..723440,723563..726148)
FT                   /codon_start=1
FT                   /gene_family="HOG000169096" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263325"
FT                   /orf_name="AFUA_8G02710"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84898.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057508"
FT                   /db_xref="HOGENOM:HBG325577"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000051E835"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL4"
FT                   /transl_table=1
FT                   /translation="MDESPDPKIPRRKRVSRACDRCRSKKDKCDGLRPSCSACRASGQT
FT                   CSYDPHAKKRGLPEGYVRGLEKLWALSICNIDGFEDTMLALLGTTPDSAGRRDKLLSMW
FT                   MDDSASETLHESWKTSRLYGTLEKMLSHSDMSSSHGSSKRPRDDNDTGALDSTSGWGFR
FT                   LDCSSTPLAHDAPRVVRLSSSQNVKRPRLSQLGDGVSVSQTTGRPQPLKLPPQTSQLLD
FT                   TYFAVTHSWFPIVAKHNILRASYLYASAPLSVESMSPGSGDHAALWAVLSYTVSHSRTN
FT                   ARDGAFEALATTKEYYTIARGLIPSETARYELGHVQALLLLTLVNIGLEDWTAAWLLSG
FT                   QAVRMAISMNLGTLAGMSHSDELRQGKAVFLGCFVVDSLLSFRIARRPCMHPRDLTGVG
FT                   LLEEDGLEEWNSWADVLPSTGTARGRTPRRGPLLTLSCFNRLVELASVLNRIARDAVGL
FT                   PNVHTFAQQLVLELKQWDDRLPLGCRLIGPESIYPERHSSLLPHQSYLGLTYVATLLWL
FT                   YLRIVPQELDLHRSQRPAIEGAKKLLFRALPMITQHLENFPTCTLPPIFEFSLRTIAEQ
FT                   ASVLQSKTESDTFPFARWAEALIQRTQEIGSAWPLYRSLNTAIEKLYRLGNVPGPSLSF
FT                   QPSCEDSFSRNRHALSDTVSKIATTMGAAPGTRNPPDGSRTHSDIRGFQPGAGDSDSTS
FT                   TILGISIPVDTQYMTPKDTTMDTDDLSMLDISFQQQTGGDSSNFGKSNSTNELGAALLP
FT                   SAQTHPHPPTPDSSSSNPIIHGKSNVHDRSQQPGPNSSRDLGISITDGQTTPGDIDAIF
FT                   KDLAYLDTTDWATSREAGLKDFGFLDDSTFHAFCHDPDRLVGSQPLLHPPSIADIWPPP
FT                   GFFPETFQESTDDVES"
FT   CDS_pept        join(complement(728536..729167),complement(727430..728450))
FT                   /codon_start=1
FT                   /gene_family="HOG000169085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750846"
FT                   /orf_name="AFUA_8G02720"
FT                   /product="Protein phosphatase type 1 complex subunit
FT                   Hex2/Reg1, putative"
FT                   /protein_id="EAL84897.1"
FT                   /db_xref="HOGENOM:HBG057497"
FT                   /db_xref="HOGENOM:HBG325568"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI0000520479"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL5"
FT                   /transl_table=1
FT                   /translation="MIAVVPVSREHLSQPPLNLQRRAMAQTYYLDSPDIATFKNPLQHY
FT                   SQRDCPSPITSSAPSSVPPSPHFAPVTEEQLLPTPATLSSLSLSVSNDSDDEIILPSYD
FT                   SSHFNDLNEIVSAVASDQASESFLTGPPCLHVHTPAADDTSVEEEPTRHVDYLSHEWKE
FT                   EDIWASWKYVVCRRDIYSNGARLENASWRTWAKLKNNLGTVSPETLNWLKDCDVTWLYG
FT                   PLKSCTKFTKASPSISPPPSCLETPSLYADRKPILKKRTASETILQRSLSQHTLLQHAG
FT                   AILKAQEAAFYRTRPSASGPELEPCLNTSSANFPDVPLSYASTRESSGVASPSGRRRIH
FT                   FNNEVVQCIAIDAKGADDDGDYYDEEEKEEWPLGSEDDVLSNEGIVLMGQLPPQESGSH
FT                   KSTPRGSFSSENKIIAPLPPTTLKCRGDTPEPPSDSMIGRWTGYFSKSTVASTSSVPSD
FT                   PAFSFFLDGEDDHLDFCWQPSQSQGVADGNQPWFVNPVDEEVDHQHQRSDSSSSKFLDE
FT                   GETSNASIFDRVVDTVNTARDIAHVIWNVGWRR"
FT   CDS_pept        join(732891..732954,733040..733059,733182..733269,
FT                   733335..733747)
FT                   /codon_start=1
FT                   /gene_family="HOG000237611" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263326"
FT                   /gene_name="tma22"
FT                   /orf_name="AFUA_8G02730"
FT                   /product="Translation machinery-associated protein 22 "
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL84896.2"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG057486"
FT                   /db_xref="HOGENOM:HBG436297"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="UniParc:UPI0000F51AC9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WBL6"
FT                   /transl_table=1
FT                   /translation="MSEVAQNSPAEVQAKKVVYCGVCTLPPEYCEFGGTAKKCEEWLKD
FT                   NHAELYQRLYSEEALSSNLSELSVSVRERAAKDAAKKEAKAAAAEARDAERKAAAKVQI
FT                   KRVERNKRKHVTVITGLEVHGLENKKVAKELGKKFATGSSVTKSPAGVEEITVQGDVSE
FT                   DVKEWLLELYGKEIPESNIELVEDKKKKTSG"
FT   CDS_pept        join(complement(734667..734953),complement(733901..734621))
FT                   /codon_start=1
FT                   /gene_family="HOG000169074" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056137"
FT                   /orf_name="AFUA_8G02740"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84895.1"
FT                   /db_xref="HOGENOM:HBG057475"
FT                   /db_xref="UniParc:UPI00005206D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL7"
FT                   /transl_table=1
FT                   /translation="MNHPVAPADAKGSLPTWTGVQGSDEADHKLLKPTTRETARSRWGS
FT                   DFTVDWVSGNGKGTILDERHNNQRTNFLMANDVRSLSDLELVKSRRQPGEDKWLRHLRS
FT                   ALSTVGTLATDITRRLDYTYYSLLEKVAALTSTFASFQELSDSASTIFDDIERETSVLD
FT                   GDIRRQIADLKDFQPQMRKIERLEERMRSGKKKADALGKRLEAIRNRIDLWEEKEVEWQ
FT                   TRVGRRLRVFWVIVALSVLVFLVVLISQKSSAICIPLFESSVPVEMGDRRASALAIRLP
FT                   EPASGEVWSRDDSCSETRPGCNRKSHSAPTPSSPTFNAMTTHVSSDPLRKIDEL"
FT   CDS_pept        join(complement(736278..736335),complement(735996..736141),
FT                   complement(735796..735936))
FT                   /codon_start=1
FT                   /gene_family="HOG000217382" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263327"
FT                   /gene_name="cgrA"
FT                   /gene_synonym="cgr1"
FT                   /orf_name="AFUA_8G02750"
FT                   /product="rRNA-processing protein cgrA "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL84894.1"
FT                   /db_xref="EMBL:AAG28884.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG395657"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniParc:UPI000006C0FA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HEQ8"
FT                   /transl_table=1
FT                   /translation="MSSAIPTSSVNPVKGMRKNGKNWHDSKKPFRPTSGLTSYEKRLEA
FT                   RKRQEAVKEHERELREEKEAERKAQIQKIKDRRAAKEEKERYEKMAEKMHRKRVERLKR
FT                   REKRNKLLHS"
FT   CDS_pept        join(736998..737108,737167..738030)
FT                   /codon_start=1
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263328"
FT                   /orf_name="AFUA_8G02760"
FT                   /product="Mitochondrial ornithine carrier protein
FT                   AmcA/Ort1, putative"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84893.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057453"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000051E5D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBL9"
FT                   /transl_table=1
FT                   /translation="MAAAEHVLAIDNEKSMELPVLPPNQGFEAFKDIIFGSAAGMAGKV
FT                   IEYPFDTVKVRLQSQPSHIPLRYQGPLDCFRQSIQADGLRGLYRGISAPLAGAAIENSC
FT                   LFFSYRIIQDILRATCYPTADSMPFSALLFSGAASGSITSLALTPIELIKCKMQVPLEA
FT                   SSSKMPGPLTLIAAIFRQDGILGFWRGQMGTLIRETGGGAAWFGGYEGVSAFFRKYHST
FT                   VSPRDSESLPIYQQMIAGAAAGISYNFLFYPADTVKSRMQTEDINSPGNSGHRQTFWSV
FT                   GRALWKQQGLRALYRGCGITCARSAPSSAFIFTIYEGLRNCFS"
FT   CDS_pept        join(738567..738648,738742..738875,738988..739073,
FT                   739257..739410)
FT                   /codon_start=1
FT                   /gene_family="HOG000014707" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263329"
FT                   /orf_name="AFUA_8G02770"
FT                   /product="Cytidine deaminase, putative "
FT                   /EC_number="3.5.4.-"
FT                   /function="cytidine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL84892.1"
FT                   /db_xref="GO:0004126"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057442"
FT                   /db_xref="HOGENOM:HBG352939"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI000051F427"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM0"
FT                   /transl_table=1
FT                   /translation="METPSGLTIQELETLSSKAIAAKANAYCPYSKFRVGACVLTKAGE
FT                   YIAGANIENVAYPVGTCAERVAFGTAIAAGHQDFKAVAVATDITPGASPCGMCRQFMRE
FT                   FTTPSFPVFMYDGQGNYAVRTMGEVSNFFIAHSFFHIAACLRSIAGN"
FT   CDS_pept        join(complement(740565..744388),complement(739875..740514))
FT                   /codon_start=1
FT                   /gene_family="HOG000169063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263330"
FT                   /orf_name="AFUA_8G02780"
FT                   /product="Vacuolar protein sorting protein, putative "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84891.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057431"
FT                   /db_xref="HOGENOM:HBG325524"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniParc:UPI000051F41A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM1"
FT                   /transl_table=1
FT                   /translation="MITRWLLITSFLALAILSLSSAAKKSEPEITSSSFDNEPFSLSYF
FT                   EDTETILMNTRDGNLFRSFDGGKAWEQVDGPDGKMKKAVRSIWQHPFDKNKAYALGANR
FT                   RHWVTKDQAKTWESFEVDGYAAAQHEPLIFHGWDSAKVIFQSDECMGRLCIVKSYYTTD
FT                   DFKTVSPLRVSAGGCLWAVGHPQFADGLNLEDELRDRVLCIVPGLKVPSAHANRLVYSD
FT                   DFFRSDAEGTELNIQHGRPVSGILSAAAVKKFFVTAAKSQGTNELALYVTLDTKAWHRA
FT                   DFGGHRVEQDGYTLLESTNYSMQVDVLTSPSSNTGVLFTSNSNGTYFTRNVEHTNRDRF
FT                   GHVDFEKIADIQGIVLVNTVKNWDKVESENEKKVVSSISFDDGRTFQSLKVGDKQLHLH
FT                   SVTTFANTGRVFSSPAPGLVMGVGNTGDHLKKYSEGSLYVSDDAGVTWRHALDGPFKYE
FT                   FGDQGSVIMAVSDKGTTDEIQFSIDHGKEWHSTKLQHKINPKLLTTTPDSTSLTFLLVG
FT                   SEESSGTKHVVYSIDFHGLHERKCEKDDFEKWAARLNENGEPDCLMGHQQFFNRRKANA
FT                   DCFVDEEFKDPQPIFEPCKCSFEDFECDFNFVRSEDGKSCVPTAPLVPPVGRCQKQTDT
FT                   FMGPSGWRLIPGNTCTREGGENLDKVVERPCKDVVSAPSHDKPMAQKQVFNDARQFSEQ
FT                   YYYLERQASSSGDDETVIMLTSEGEFWVSHDHGKNWEQPLKGVKIAAIVPHPYYSDGAF
FT                   LLTRDKQAFWTVDRAYTFKSFEAPIPPNQEGLPVLSFHPHYKDWLIWTGAVDCSHGDCH
FT                   SDAYFSKNRGENWDLLLRYVGKCEFESRENRPGSEKLIFCQQYENENKKNHLQLLSSEN
FT                   LFSDSHVHFNDAIRYATMSEYIIVASRDPDNPDSLIASVSVDGKTFARAEFPSNVDVPV
FT                   KTAFTVLDSSTHAVFLHVTVSDVKGAEYGSIIKSNSNGTSYVLSLNAASRNEWGYVDFE
FT                   KMQGLEGVAVVNIISNVDAVQKKGPAAKKLKTMITHNDGGQWMLLPPPAKDADGKNFGC
FT                   SVKDGKGSDQCSLHLHGYTERRDPRDTFSSGSAIGLMMGIGNVGAYLSGKDEADTFMTR
FT                   DGGITWKSVKKGRYMWEYGDAGSVIVIVPELRPTKVLYYSLDEGDNWEPYEFSEVEMHI
FT                   YRLSTVPSDTSKNFLLWGKEMESNRLATINVDFSGLRKKSCILVEDGQESDDYYLWEPK
FT                   HPFQEDNCLFGHVEQYHRKKPSSQCWNNWREPHVHSIGRNCTCTRADYECNYNYEPQND
FT                   GSCALVPGLPKPDALAVCREDPDRVEYWEPTAYRRIPQTTCSGGLILDHVVSKPCPSKE
FT                   KEYEKKHGISGTGLFFAIMIPLVAAAGVGYYVYARWDGKFGQIRLGENAGTYEGLLSRE
FT                   SPIVTAPIAIIAGIVAVIRALPLLAMSLWRSASGYVRLGRNRAYSRPYASRGSFAARRG
FT                   DYTSVVDDEDELLGVDDAEIDDDDEL"
FT   CDS_pept        join(complement(746090..748270),complement(745517..745885))
FT                   /codon_start=1
FT                   /gene_family="HOG000169052" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263331"
FT                   /orf_name="AFUA_8G02790"
FT                   /product="Exocyst complex component Sec10, putative "
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL84890.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="HOGENOM:HBG057919"
FT                   /db_xref="HOGENOM:HBG325723"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI0000520478"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM2"
FT                   /transl_table=1
FT                   /translation="MSDNASITPQTIPASRSIFPKGPNFTLSDFSSRDYIVKEFVEALS
FT                   DSTTSNRRSTVGPGPGNQLFDPKPLIRAFEHAQQRLGELSGDLEIKENELSAAARRAEA
FT                   QHAQNLGTLGRKLKQTIDSFQQLDTSLNGAALSGGELPGATGSMAVETGRRLEELDRQR
FT                   RRALDAHFLIQCWDGVSNRGEITLLENLRKSGTGEAKVRSAHIARQLLRISQRLDPRSW
FT                   DELRAKKNDLYRNDDDSVDEGTRGNTNGIHRNTREIIEKFSETLEKDLLKQFDDFYRKA
FT                   NFEGMRDCATVLQDFSGGASVTALFVNQHQFFIDRSQLVTEELGGDLDSWEQLADPDAE
FT                   PLKVEPSLQSLVDEVKVVVQEESAIIKRAFPFYEQVLGKFLQRVFQQSIQQRLEMVLEK
FT                   ANGISSLAFLRSLQSSRSYISGLVDDLKAHGLTEHPDPVSSQTALILDQQLEDLFVPYF
FT                   VGSSYIEREKKSLEELYTSLLFRFTTFHARRKRAATTFMASISKSGTELLSSARDAYVN
FT                   RLESSEFTPTQKKMLLQLAGLKEQSDSMKPTEIKLMEKDGLPNISYAKRMLKWLAEAVG
FT                   RGLELGSTSETPKDVSALLSLLLSLMGEGYVEVCLDAVFEAATSQESARAEPDFGYLTV
FT                   VKSIISITNLMVMCIQTLLIPLATPSITIRREMEKKTNAATLRIEDKINAIEQKVIDTA
FT                   LMWISRLLSGQKKNDFRPKEGDNAAWLEMLHTPRYAVNGAGGLMVTKDMTQYADLLKSW
FT                   DIDEHVKGPGGLLDVLLEVGSLFVIGPEALLERIRAGASSDASRRPGASRTDTERGQEL
FT                   LETGHIEPGLSVQEIRAYVSRREDSSTTAMQNVLNLL"
FT   CDS_pept        join(749247..749733,749813..750408)
FT                   /codon_start=1
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263332"
FT                   /orf_name="AFUA_8G02800"
FT                   /product="Putative uncharacterized protein "
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /protein_id="EAL84889.1"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="HOGENOM:HBG057909"
FT                   /db_xref="HOGENOM:HBG396737"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI000052093C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM3"
FT                   /transl_table=1
FT                   /translation="MALARDRELLRDTLRTQGTALTAADRENILKPYLPDPSELARRPH
FT                   RQKKPPRKAPIRTFLKSRLHQLTYTFIHIVYGIILRLVQSYHALVDRVLAIVYYHHRTP
FT                   ELIRKDVKGLRRLPGHLTVVLSLRKEDDALAILMDEVAELAAWSVSAGIPMLSVYEKSG
FT                   ILKSCIPMLHHVVASKFASYYGSIPQQPTLRLFAPHHSVYEPALDHDKARRVNTDSLTL
FT                   LLLSATDGRETIVDLTQTLAEMSQNGKLSPGDITMELVDAEISEITTQPLQPASLSIGD
FT                   RQTTAVHPTIAVKPEPDLLLVFAPFLKLDGYPPWHIRLTEMFCTGGKGSGVTSYGDAVE
FT                   YQGFLRGLWHYAGAQMRFGR"
FT   CDS_pept        join(750957..751220,751308..752676,752740..753197)
FT                   /codon_start=1
FT                   /gene_family="HOG000169030" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207430"
FT                   /orf_name="AFUA_8G02810"
FT                   /product="ELMO/CED-12 family protein "
FT                   /function="binding"
FT                   /biological_process="phagocytosis"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="EAL84888.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0006909"
FT                   /db_xref="HOGENOM:HBG057898"
FT                   /db_xref="HOGENOM:HBG325710"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FDC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM4"
FT                   /transl_table=1
FT                   /translation="MEGSIHDIVERLGSEEDAVRKMAVFKLQGSIGDPSFADIFIAEGG
FT                   LTKLRELTLHATGNTLAYSLTSFARLLEVDKGWDLVDQELVERIVQLIVTQPLVNILRG
FT                   AMSILVSIVSHPYTGGRPSQTDSFGFRALKPALAIYPQFLEMLVNRLSSADHALCANAL
FT                   QLINSLMRDSIANDSELEWPRFIQKLQDLGVIRAVYALMQGTTLQDHAHPLIEFQSLTK
FT                   VLLRRWRDIPLDLEKPEHRRALKGIHLASDQEKGIDEKVGSDAELRRSRKHNSEKWRRL
FT                   GFESENPIAQFEEMGFLGMMDLADYVRNHRSEFRKMLLEQSAKPGQKRCPIARASLAVT
FT                   SILYEHFEIEKSEIEDSRSYLVLESRANLDRLFKPLLLHWTRLHVAALQAFVRLWKTTN
FT                   ADVDDFAKIAELVRILVESVVGGAPRTKEVQDVEDEIVNFEYRRLRDLQMELLELTYED
FT                   AWRQHLLQVREELHHEALQFVKEQRIRCLLQGCWFPVEATTHTDSSSVENVSYRYVQLS
FT                   HNRKFLHYGDFETLGNGRIDLDSLPGKVDLSAVSSVASNISASADASSSSTLKIAPLSV
FT                   PSTKITIHGYIECFSSTRGPSKGHNHARSISKSKEGVLLTLRPQTPSIASEWLDGLLML
FT                   LNQRPITADTNKLIKVVSDYGLKIRLFNVRFEDATFPGEVPKVPSRDGLDDDYYYDLFG
FT                   AS"
FT   mobile_element  complement(758175..758480)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(758488..758799)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(761987..762703)
FT                   /mobile_element_type="transposon:DDE_1 transposon family"
FT   CDS_pept        join(764159..764554,764611..766383)
FT                   /codon_start=1
FT                   /gene_family="HOG000169019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902867"
FT                   /orf_name="AFUA_8G02820"
FT                   /product="Cell cycle checkpoint protein Rad17, putative "
FT                   /biological_process="DNA repair"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL84887.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG057871"
FT                   /db_xref="HOGENOM:HBG325701"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="UniParc:UPI000051F19E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM5"
FT                   /transl_table=1
FT                   /translation="MVDISDTIEDGYDSYDELFSDYIADRKVTPEKRMEAPLAAGERDN
FT                   QAQAITHTFCSRGFASNRRRFVFSSASESKHHGSYLLGNNHDKDADELPWAQKYSPVSL
FT                   NELAVHKKKVADVQSWLSDALCAFEKVCKLLVLRGPAGSGKTTTLSLLSDKLGFDVLEW
FT                   RNPSGSEFAAKGFTSTTAQFEEFLTRGNRFRGLEFHGATGSSASKFNSSDHMTPRVILI
FT                   EEFPTVFDGDSPGLAAFRLSLQRYLSVSSSPRSNIRNDIERHGSSPVVIIVSETMLNTE
FT                   GSYSDNFTAHKLLGPDILSHPCTTIVDFNAIAPTFMFKALNLVLEKHIRRYRSAKRPGP
FT                   AMLKSLSEVGDIRSAISSLEFLCLRYERPEKYPFHNATKTGQGNISLAPVEKEALQTIT
FT                   YRESSLGLFHAVGKIVYNKREDLSSTTDNPRPPRPPDHLWHCDRPTVSIVPVNELLEQL
FT                   GTDTQTFISALYENYIPSCDGPAFVDCINGCIEALSDSDVLSADNMTTPGSYSRGRYMA
FT                   AIGLGMLRQDELSYQVAARGLLFSLPSPVKRRITPTNQKGNTQDGHRILFPTELRLSKE
FT                   KDQVEELTNSWKTTLLHSLNGLGTQSTKSLAGHYFQAGRQEIVATMAPRNDFLLYQLPY
FT                   MTRIGFNETVSRELDKITSIPKQRTQWDRQGIDNTFDHEPMTTYRASCVRQHSMPTNSR
FT                   IYHQHNLPPVVSDREDKFVLSDDDIEDV"
FT   CDS_pept        join(767116..767212,767388..768028,768158..768418)
FT                   /codon_start=1
FT                   /gene_family="HOG000234632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207431"
FT                   /orf_name="AFUA_8G02830"
FT                   /product="UPD-GlcNAc transporter (Mnn2-2), putative "
FT                   /function="nucleotide-sugar transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL84886.1"
FT                   /db_xref="GO:0005338"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057787"
FT                   /db_xref="HOGENOM:HBG737529"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000051F421"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM6"
FT                   /transl_table=1
FT                   /translation="MVLMVSLIFGGCCANVGTPSVMEPAVVDLVILGPLITFAQFIVTA
FT                   VFTLPNFVSLSCGPRSLFLSPRVIPLRSWLVYTAFFVTVNLLNNWAFAYSISVPLHIIL
FT                   RSGGPVASLIVGYSFNGKKYSYGQILAVAVLTLGVVTAALADAQAKGEPLDIGHGGADL
FT                   GITGTATGFAILASAMILSAFQGIYADRLYETYGRSHWKEALFYSHVLSIPLFLPTYPR
FT                   LLDQWRAMLSSPPLQYRLLETSISVAYLFLNALTQYLCIRGVHLLSAQTSSLTVTVVLN
FT                   VRKLVSLLLSIYLFGNQLSPGVVIGAICVFAGGGLYGLEGARLRKPINKKD"
FT   CDS_pept        join(complement(771273..771371),complement(769187..771178),
FT                   complement(768813..769124))
FT                   /codon_start=1
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263333"
FT                   /orf_name="AFUA_8G02840"
FT                   /product="Dynamin-like GTPase Dnm1, putative "
FT                   /EC_number="3.6.5.5"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="EAL84885.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG057710"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI000051FDC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM7"
FT                   /transl_table=1
FT                   /translation="MASLSEDLLITVNKLQDLVFNTIGNDSLDLPQIVVVGSQSSGKSS
FT                   VLENIVGRDFLPRGSGIVTRRPLILQLINIPSEHNDRPGDNDVLAPHTAASVAGQHEWA
FT                   EFHHLPGRKFEDFALVKQEIEAETARIAGNNKGINRQPINLKIFSPHVLNLTMVDLPGL
FT                   TKVPIGDQPSDIEKQTRTLILEYIAKPNSIILAVSPANVDLVNSEALKLARQVDPMGRR
FT                   TIGVLTKLDLMDHGTNAMDILSGRVYPLKLGFIGVVNRSQQDIQSGKSLSEALQAEAEF
FT                   FRHHPAYRNMANRCGTQFLAKTLNTTLMAHIRDRLPDIKARLNTLMGQTQQELASYGNK
FT                   QFSGEEHRGSLILQLMTRFASSFISSIDGTSSEISTKELCGGARIYYIFNSVFGNSLET
FT                   IDPTHNLTVSDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLEAPSQRCVELVYEEL
FT                   IKICHTCGSQELLRFPRLQAKLIEVVSDLLRERLGPCSAYVESLISIQRAYINTNHPNF
FT                   LGAAAAMSSVIQNKQDQERKMMLADDRKKRERRRQKEMSSVNGAVPVTPEEEEDHSAEL
FT                   RSQNLGNRGQTSKNSRSMSPHVNKGQDSAITTTLNGVNTNPNTMFGATNTTRDSFLNYF
FT                   FGKDGMQSSTPLPQPLIQQRQPNHLSEPSISQSIRRQDLRSPMSLPDDYAGSSDYGGEI
FT                   SHHADNTEPTLSDRELMETELIRRLISSYFNIVRETIADQVPKAIMHLLVNHSKDVVQN
FT                   RLVSELYKEELFSELLYEDDGIKAEREKCERLLETYKEAARIVGEVL"
FT   CDS_pept        join(complement(774668..774863),complement(774426..774613),
FT                   complement(772495..774366),complement(772299..772385))
FT                   /codon_start=1
FT                   /gene_family="HOG000169008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750847"
FT                   /orf_name="AFUA_8G02850"
FT                   /product="Actin binding protein, putative "
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL84884.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG057636"
FT                   /db_xref="HOGENOM:HBG325665"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI000051F685"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM8"
FT                   /transl_table=1
FT                   /translation="MASLNLSTNGPSITKSYRSVIDCSLPTDSATYGQWAVFSVSTPLV
FT                   NAFQRNSDSKESVLKVQNTGAGELENLIDEFSEGKIQFAFVKVTDPNSGLPKNVLIGWC
FT                   GEGVPERTKGYFTSHLSAVTKFLSNYHVQITARSEVDLTPEGIIQKVGDASGAKYTPER
FT                   ASPVTALPKTLPVTSKPAFTPTRTGAVGSKTVSNVSTRVVPRTSGDEDDWGPDAPPVTR
FT                   TELEKVQSAYKPTKVDIEAIKSQNLPRTSYYRELPVTENNDVVKGGYQPIGKVDIAAIR
FT                   KQAREAGELKEDRPEPVRGAYEPVGKVDIAAIRSKAQKQPESSVDQSISSNPVGSRNER
FT                   VEPSDFSKLADQPERLTTLPKPKVAKKIGISSTFTGTKAPLPGGFVSSPVPPTTQVGIA
FT                   SRTFADEGGKTPAQLWAERKARAQGQVPAPSPSAASGSQGGSKEEWKSLYNGKTWAPVQ
FT                   TSPTGNSVDRGVSQQGQELTTGPETSLPGLPELTSRNQKLRGADMSSSPDEEPAGVSGF
FT                   ENESPAAHTSQGMKPEEPLEPEAHQPIPIPPQQPRSPTPPTPPPVRDSSPIRVAVPVGR
FT                   GEVADAHDEQYSPPPVMPTQSLRQAVPDDERLEDTTIDIGREASKSTAFHRPQDEALQA
FT                   IVQYDYEKAEDNEIDLKEGEYVSDIEMVDKDWWLGSNSRGERGLFPSNYVELVKDNQKH
FT                   LASVAGAEDPKEIPPAASIHSPGGGKGTSQPTAMALYDYEAAEDNELSFPEGAQIVNIE
FT                   FPDDDWWFGEYKGQKGLFPANYVQLEE"
FT   CDS_pept        join(777600..778919,778976..780096,780170..780448,
FT                   780503..780635)
FT                   /codon_start=1
FT                   /gene_family="HOG000092200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902868"
FT                   /orf_name="AFUA_8G02860"
FT                   /product="AMP deaminase Amd1, putative "
FT                   /EC_number="3.5.4.6"
FT                   /function="AMP deaminase activity"
FT                   /biological_process="purine base metabolic process "
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="EAL84883.1"
FT                   /db_xref="GO:0003876"
FT                   /db_xref="GO:0006144"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="HOGENOM:HBG057541"
FT                   /db_xref="HOGENOM:HBG713563"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR016297"
FT                   /db_xref="UniParc:UPI000051EF27"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBM9"
FT                   /transl_table=1
FT                   /translation="MDNAHDLQASTQNSTVDLKYDCDEENIQQADVNSSLSAAVTDSLE
FT                   HVLPRDREMKTPTYDYAYEKSMSHTEAKLFYQHHQLVSRGADSESDQGSGLSGRRSASG
FT                   ILSIKAQTEGKPQTGILGSSNSTQLGPPTSGYAENISTSAGQRPLRDDAMHHENLNEQG
FT                   SSYMQFTTEVPGAVKSAMNMTGSGTVASELNVIYRKIRGLLERRAEYIRLSSQGPGDNP
FT                   KDRPDWRIYPPPPEPAWDADGENGNQGSSAGAGTKKRKMGQDIGEDFDMAELIPLPGES
FT                   SWTFKLDENSVYQVYENLEAANANKPTIRIPSLRDFYMDLDAVIDVSTDGPAKSFAFKR
FT                   LSYLEGKFQLYTLLNEYQEIADSKKVPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKSK
FT                   MKKSPDEVVLFRDGKHLTLREVFESINLTAYDLSIDTLDMHAHTDSFHRFDKFNLKYNP
FT                   VGESRLREIFLKTDNYIKGRYLAEITKEVISDLESSKYQMVEWRISIYGRSIQEWDKLA
FT                   AWVVDNKLFSPNVRWLIQVPRLYDVYKASGMMENFEQVITNVFQPLFEVTKNPSSHPKL
FT                   HIFLQRVVGFDSVDDESKAERRLYRKYPIPREWNTKQNPPYSYWIYFMFANIASLNFWR
FT                   KQRGFNTFVLRPHCGEAGDPDHLAVGFLCCHSISHGILLRKVPLLQYLFYLDQIGIAMS
FT                   PLSNNALFLTYDKNPFANFFRRGLNVSLSTDDPLQFAFTKEPLIEEYSVAAQIYKFNAV
FT                   DMCELAKHSVEQSGFELSLKKRWLGANCSLRGVAGNNVAKSNVPDIREQFRHETLLGEL
FT                   ALIEQYSDRHIDCPTRRPIVPATGSQLEAPSRISLGPEQGHSGHCKSKRHGPETSLLRV
FT                   LFEDVGVLIASLSLFSGQFARVHMAVPFVHRALVSVLPLARSYLSFDATPVTLSFFETP
FT                   APQKPPGPATLPTHSGLPIP"
FT   CDS_pept        complement(781468..783381)
FT                   /codon_start=1
FT                   /gene_family="HOG000217383" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750848"
FT                   /orf_name="AFUA_8G02870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84882.1"
FT                   /db_xref="HOGENOM:HBG057430"
FT                   /db_xref="HOGENOM:HBG325523"
FT                   /db_xref="UniParc:UPI00005206D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WBN0"
FT                   /transl_table=1
FT                   /translation="MSEQTKKTPQRVRKFLPNVIESSSRSSRNRQSTPSVQASSMELEF
FT                   QSGKPAGTLIADTRPVPPGDLTSSQRQQDDSWTLNDIKEDSDNRAFGLPQRQPIREEVL
FT                   HNSVDTKTNGDRLSYPVSSSATEKVVLQMRSCPRKFAPQLVETNKRSFRRKETSHTLSG
FT                   APVQGYDNVSRTQSGTSTCANSNAFSATIESKFSYSSLQQRQESRSHSFRVPDLPAIPS
FT                   SCSDASEGSDTPSFSASPSISSNVSAHHSKAENGCKTGRDGHMAEYFLSLAGQSVESQL
FT                   KEQALAAFPNEQVYEPVDHFAIDKDEDECSEEDSKNGHLHVSRRESSADLPWELEHMRR
FT                   HKEDAEMRDRAMAGTKGRRLSSAIFNPRQFYSGIDNDCWRGKYEPDLSRHLARPPMLGD
FT                   DLVFPQSLSPEATICESGSVRDCATDSRHRVRNDFGLWCTKPGHVQDDATTGLWKGTCC
FT                   NYKHTQQSKRSLPCVTDNSRHSNNNECQSKVCSDEQDQDQSTSNSYHLALDVGELSRHD
FT                   IDNEHHDCCFGVDDNFVTQIYNYLSLGYPCVARYYDHELSRVSGIPVKELRRSDTSALA
FT                   RGYLQVNEDGSANGPAVRQAGARWVALRLYIHAWASSQPDFDNDNDHDAWGVLERRGSW
FT                   AV"
FT   mobile_element  complement(784910..785242)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(785945..787039)
FT                   /mobile_element_type="transposon:gypsy transposon family"
FT   mobile_element  complement(791680..793014)
FT                   /mobile_element_type="transposon:TY1_Copia transposon
FT                   family"
FT   gap             793739..822538
FT                   /estimated_length="28800"
FT   CDS_pept        join(complement(824806..824941),complement(824257..824711))
FT                   /codon_start=1
FT                   /gene_family="HOG000253041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750849"
FT                   /orf_name="AFUA_8G03870"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27222.1"
FT                   /db_xref="UniParc:UPI0000F5186D"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA34"
FT                   /transl_table=1
FT                   /translation="MSYLGGGGWCEFLMSDAPQHGKKRPAESDPEGDQPLAKKFGRLQL
FT                   EPRLFGTPQICGGGTSSIQSNSFDTTERMMLDDTKHTIYIHDLDSELADSDAQEYSITF
FT                   LPDIGAKLGTLPKLLTVDTQPQNKELVLYRDPKSLTLPEEDDYVRRAILESRRRARAAQ
FT                   TQCRSAEKIVKEVKSNPVCNVDDDVMEIDPTIQ"
FT   CDS_pept        join(825050..825293,825347..825492,825545..825571,
FT                   825628..825663,825732..828140,828205..828378)
FT                   /codon_start=1
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263334"
FT                   /orf_name="AFUA_8G03880"
FT                   /product="Alanyl-tRNA synthetase, putative "
FT                   /EC_number="6.1.1.7"
FT                   /function="ATP binding"
FT                   /function="alanine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="alanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85157.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004813"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006419"
FT                   /db_xref="HOGENOM:HBG347903"
FT                   /db_xref="HOGENOM:HBG354397"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniParc:UPI000051F6FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM7"
FT                   /transl_table=1
FT                   /translation="MRISRILRNGDMTLSHPPLPFRSNPRRFYHFHTTHTTEQNQLHTN
FT                   YRHYRMSSDSEGSPFWTAKRVRDTFLDYFRQNGHTFVPSSPVVPLSDPTLLFTNAGMNQ
FT                   FKSIFLGTVDPQSDFAKLKSAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFG
FT                   DYFKEDAIRYSWELLTKVYGLDPQRLYVTYFEGHEEGGLEPDLEAKALWRAAGVPEDHI
FT                   LPGNMKDNFWEMGDQGPCGPCSEIHYDRIGGRNAAHLVNQDDPNVLEIWNNVFIQYNRE
FT                   SDRSLRPLPNKHVDTGMGFERLVSVLQDKSSNYDTDVFSPLFNAIKNITGAREYRGRFG
FT                   ADDSDGIDTAYRVVADHVRTLTFAISDGVTPNSDGRGYVVRRVLRRGARYARKYFQVEI
FT                   GNFFSKIVPTLVEQLGDMFPELKKKQHDVMEILDEEEISFAKTLDRGERQFENYAQQAK
FT                   IKGDDKLHGADVWRLYDTFGFPVDLTRLMAEERGLNIDDLEFEEARLRAKEASKGQKKS
FT                   ATGTVKLDVHDLGKLEKMNVVPKTDDSAKFGKGNITAEIKAIYHGKNFHSSTAQIPDGE
FT                   QIGIILDRTNFYAEQGGQENDTGRIIIDGRAELEVGDVQLYAGYVLHTGFMKYGSFSIG
FT                   DAVLCEYDELRRWPIRNNHTGTHILNFALRRVLGDSVEQKGSLVAAEKLRFDFSHKSAV
FT                   TEKELEKIEEISTEYIRQNCDVYSQEVPLATARRISGVRAVFGETYPDPVRVVSVGVEV
FT                   EEILKNVEDPRWLEVSIEFCGGTHVQKTGDIKDLIILEENGIAKGIRRIIAVTGEDAHE
FT                   VQRVAKEFEKRLDRLDAMALGPQKEQEAKQIQVELNQLSISAVQKSRFRERFASINKQV
FT                   IDGQKAQQKLETKKALEAIISYFESPTNEGKTCLVTRLPISANPKAVSESLNYVKSKLQ
FT                   DKTVYVLAADLEQGRVAHGCYVSKALLDQGASANDLAAVVSSVVGGKAGGKGSTSIGNG
FT                   VHPDKTEDAIALASDYLAKFKL"
FT   CDS_pept        join(complement(829014..829136),complement(828820..828957),
FT                   complement(828578..828769))
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263335"
FT                   /gene_name="cyp3"
FT                   /orf_name="AFUA_8G03890"
FT                   /product="Peptidyl-prolyl cis-trans isomerase H "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85158.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000051F6E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCM6"
FT                   /transl_table=1
FT                   /translation="MELFADVTPRTAENFRRFCTGESKNSQGKPQGYKNSKFHRVIKDF
FT                   MIQGGDFVNGDGTGSCTIYGTPKFADENFVLKHDRAGVLSMANSGPNTNGCQFFITTTA
FT                   TPFLNGKHVVFGQVVDGMDIVRMIENTRTIRDKPSQDVIITQCGEM"
FT   CDS_pept        join(830557..830693,830758..831931)
FT                   /codon_start=1
FT                   /gene_family="HOG000156966" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056138"
FT                   /orf_name="AFUA_8G03900"
FT                   /product="RING finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85159.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057626"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000051E3E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM5"
FT                   /transl_table=1
FT                   /translation="MSSTSPVPPSGSTNGDRAADSSSSPTSSPLLFFVALGFGVVFTNL
FT                   WIIVGVKYCFRYNQRNRQLRNEETGEPIDLVTLPRTHRRRREKKLMTMDEVNSRFPLTK
FT                   YKAWRSTRANASIPTAEVISTADSSLHSPNIKNGTLVVDTSVSPSLVKSASTDSQRQMG
FT                   PTIAQTSTVAPDAGAQFAQLDEKSNGRPIFADCIHARDVSKYTNDEMKDIHNQDSCECH
FT                   GLEDIGDADHPIRTAPLAELLPTPADSCAICLDVIEDDDDIRGLTCGHAFHASCVDPWL
FT                   TSRRACCPLCKADYFTPKPRSDPVVERASTDRRSMVGMYAPSRPRPVFIGWRSNPFRRT
FT                   TILPQRLMRRDGIPPSQLSGALNVDSYMAHNASDTRSEISRPQPRGSMRLFPRLRNSLR
FT                   LPSSSLHRAPRNAGSAMGASQPSDSRSTADVEAGLRP"
FT   CDS_pept        join(complement(833657..833792),complement(833412..833593),
FT                   complement(833198..833338),complement(832546..833145))
FT                   /codon_start=1
FT                   /gene_family="HOG000156977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902869"
FT                   /orf_name="AFUA_8G03905"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27223.1"
FT                   /db_xref="UniParc:UPI0000F51874"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA35"
FT                   /transl_table=1
FT                   /translation="MTVDRDIVEILDRYGGMQPSLFGISNDNQDLRSSLIILHGLDPVI
FT                   ESSIRKEYKQSLVHCDSRATFLHSNPLNWNIDGESEDDAGTADSHCLKYLDREQGNREN
FT                   VQTLLSCLPNASAFKPVAQAFGQQLPEYVDIVESWVNDQEPLILRLSFKSFSGSVHDMV
FT                   LLGLVKSLMSDLHSLSLNGTAVTVIFIPDSQDSRVPQSLRRRGNHQAKTLQMDMASPSL
FT                   LRRQSPGSTSLNPTCYVTNSSCNEETSGCSGHGFCYRKSESKSGLTNNDCFACKCQATT
FT                   IRKEDGTTQIIRWGGAACEKQDISSPFFLLATASVVVIIALGGAIGMLFRVGQDDLPGV
FT                   ISAGVGPTKAQG"
FT   CDS_pept        join(834436..834560,834645..834958,835260..835789)
FT                   /codon_start=1
FT                   /gene_family="HOG000156988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902870"
FT                   /orf_name="AFUA_8G03910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85160.1"
FT                   /db_xref="HOGENOM:HBG057627"
FT                   /db_xref="UniParc:UPI000051F48F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM4"
FT                   /transl_table=1
FT                   /translation="MFRMRQRLFLFQIPFRASHSLCQSDANNVNVRHVRFKRPWFKKFV
FT                   TTCLIYGTAFHIWGSFVLGEYDKMLETASDEALPEKGFPEKNVMATERTVRRREEVAAS
FT                   DPFFIPLGWPRLREGKFYSSLDPEWREFVRISRDSKKLESLKDTGDCIQKCMKPLFVAL
FT                   AARDAYLVLMKRQLSRMGFEVSDKIQFGTDSLVMPPSGTVFTGLEPHEKVTQQNQPWLN
FT                   PSSVLSSLRWLPLPKLGPESDLRAAAVAFKWRLNDCWARELRTPRPGTFLIVGPVGVKG
FT                   PKGFCRIEVRGEYDPLTSRWTHVSMQLKDLNVFKQRALGNR"
FT   CDS_pept        join(complement(837486..837589),complement(837293..837437),
FT                   complement(837167..837229))
FT                   /codon_start=1
FT                   /gene_family="HOG000157009" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263336"
FT                   /orf_name="AFUA_8G03920"
FT                   /product="Cell cycle regulatory protein Cks/Suc1, putative "
FT                   /function="cyclin-dependent protein kinase regulator
FT                   activity"
FT                   /biological_process="cell cycle"
FT                   /protein_id="EAL85161.2"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0016538"
FT                   /db_xref="HOGENOM:HBG057629"
FT                   /db_xref="HOGENOM:HBG611605"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="UniParc:UPI0000F51867"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM3"
FT                   /transl_table=1
FT                   /translation="MDIDLSRRNKKPRLLLESERERLEEFIDSIHYSARYSDDQFEYRH
FT                   VQLPKNMLKKIPADYFDSSKGTLKLLWEEEWRALGITQSLGWEHYEVHEPEPHILLFK"
FT   CDS_pept        join(839316..839358,839485..839535,839598..839724,
FT                   839800..839965,840029..840736,840797..841277,8
FT                   41339..841607)
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750850"
FT                   /orf_name="AFUA_8G03930"
FT                   /product="Hsp70 chaperone (HscA), putative "
FT                   /function="ATP binding"
FT                   /protein_id="EAL85162.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI0000520749"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM2"
FT                   /transl_table=1
FT                   /translation="MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSFV
FT                   SFTEKERLIGEAAKNQAAMNPKNTIFDIKRLIGRRYEDPIVKKDIESWPFKVVDQGGNP
FT                   VVEVEYLGETKTFSPQEISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQATKD
FT                   AGAIAGLNVLRIINEPTAAAIAYGLGSGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFT
FT                   VKATAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDARALRRLRTACERAKRTLSNA
FT                   TQTTVEIDSLFDGEDFNSSITRARFEDLNAKAFSGTLEPVQQVLKDSGLEKSQVDEIVL
FT                   VGGSTRIPRIQKLLSDFFDGKKLEKSINPDEAVAYGAAVQAGILSGKATSAETQDLLLL
FT                   DVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVVDNQTTVQFPVYQGERTNCADN
FT                   TSLGEFTLAPIPPMKAGEAALEVVFEVDVNGILKVTATEKSSGRSANITISNAVGKLST
FT                   TEIEQMINDAAKFKSSDEAFTKKFESRQQLESYISRVEEIISDPTMSLKLKRGNKEKIE
FT                   SALSDAMAQLEIEDSAPEDYKKKELALKRLITKAMATR"
FT   CDS_pept        join(842291..842749,842856..843203)
FT                   /codon_start=1
FT                   /gene_family="HOG000157011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263337"
FT                   /orf_name="AFUA_8G03940"
FT                   /product="Ribosome recycling factor, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="translation"
FT                   /protein_id="EAL85163.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG057630"
FT                   /db_xref="HOGENOM:HBG328886"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI000051E63F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM1"
FT                   /transl_table=1
FT                   /translation="MQRIQRLSILSDIPRSFYSANSSPIVLDARQPWRFLPPSERFNLT
FT                   TRSFSSSPSLCKKKDKSRKLTGANTELSIPSEDPYDLSSLENGIVAAVARLKDELSKLR
FT                   MGGRFNTESLEDLRVSLGKGGKEIVRLGELAQVVPKGGRTVTILASEEEHVKPITSAIL
FT                   SSDLSLTPQPDPHNILQLNISIPPPTKELREQTVVAARAAMEKAAGAVRESRSVSHKRL
FT                   QDMQKKKLARPDDVRKAQDHMERLTEKGQKEVKELFDAAKRALERV"
FT   CDS_pept        join(complement(844408..844537),complement(843389..844320))
FT                   /codon_start=1
FT                   /gene_family="HOG000157022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750851"
FT                   /orf_name="AFUA_8G03950"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85164.2"
FT                   /db_xref="HOGENOM:HBG057631"
FT                   /db_xref="HOGENOM:HBG325660"
FT                   /db_xref="UniParc:UPI0000F51876"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCM0"
FT                   /transl_table=1
FT                   /translation="MIQTKLRFLASCRDRRTPVDGIITSVRFFTLSHQPAVIQSNHQNP
FT                   RNAATQSVSRVSSPSSAASGRVSDSNVNVTSRRNPPRRVVDARSLAVPKAGSLPSNIIR
FT                   SPRFQRSRAGAQTHGRRSGTIHRTQTAVPKGRKQGNGRTQRKRTDVEEVDEISQAEVDE
FT                   AYVQLSKASAVVPVRYTPQPPESNLTETWPSLPTGVTARTAGVVEKLSWLSDRFPNGYV
FT                   PPYELGKRLFEGRSVQFLNQVEKDNALSEAQKLARKRADTLSQRKGDLVEPEDVGFQQM
FT                   SALNKRALIEKLVQGNYPKLETALADKPTVLTEIVKNLNNNETYRIAGKSSQFISKVES
FT                   LLASGRPASAKRV"
FT   CDS_pept        844711..844947
FT                   /codon_start=1
FT                   /gene_family="HOG000157033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207432"
FT                   /orf_name="AFUA_8G03960"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85165.1"
FT                   /db_xref="HOGENOM:HBG057632"
FT                   /db_xref="UniParc:UPI000051EF99"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL9"
FT                   /transl_table=1
FT                   /translation="MLRQKPTAIAITSEDIAKLEDMRLRKRCEELQGHAYESVKSTLSH
FT                   SAIDPNDELKPLPGDRARIVRSREERIGIGRRN"
FT   CDS_pept        join(complement(847874..848396),complement(847471..847812),
FT                   complement(846505..847400),complement(845998..846455),
FT                   complement(845628..845939),complement(845361..845535))
FT                   /codon_start=1
FT                   /gene_family="HOG000157044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902871"
FT                   /orf_name="AFUA_8G03970"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85166.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057633"
FT                   /db_xref="HOGENOM:HBG328885"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000520049"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL8"
FT                   /transl_table=1
FT                   /translation="MRACNGCRKRKIKCDAATTNTWPCSACTRLKLVCVPPTIGQDSDF
FT                   QSEQGLEATSMGALGASQANSASHYSYSVPQSFGAGIQPTAGNSQPYSDGAGIMPQYAP
FT                   NGPTQHNIYEVRSSHLPVTGHAYQHAQVFPTTPNHGLDNSNTGIFPDDDQSTAENLSEV
FT                   LGELKIDETGIAPYIRQQRKERLEAEAPVQDEIEERLPPLSTGAGSTIRIPPELMPSDD
FT                   EVMNYFKIYFDDIHPYIPVVHRSHLYYQWQNERNSISPLLLEALFACSGRLSDDPAQGA
FT                   QWLALANRHESSFMDVPRLSTIQALLLLLKARESLPKKGYYYRSWQTVKTIVSMSKDLD
FT                   IHEHYNTHAEGRPCELDSVECLVQTRIWQALLVVEVMIGAPQGMSISASLALTALVDCV
FT                   ILLGRSDYGVDPETVDMRPTLDIDGLDQFEIDRSRQYAYFVRNAYHIRLITDIYHKIKK
FT                   QKDWGANPRFVEKNPLFTDWLQSLPQDLQINYPSDGSPPWIPSHFVGNMHSHCHLGIIL
FT                   LHRPQLLASKSFAAGGGWKIHMALCYSSAKSLCRLQEGILERFGLRGLLFMQRGINFAI
FT                   YCILTCTMLHLIAITSPDPHFHTDARDYFTRHMRILEKCSSAWPMPEIQAQIDSLRLAF
FT                   SADINRPFELKSTFPYGSPSEPYHPSPPLGSSYHAQLDQVPSNVQNRVCYAYPMTPPIS
FT                   AGTEDSKSDSCQLQPMGMLAPHPHHSHSVDGPLVDENNWDPTRIINQWDLAFPVAPSNV
FT                   NTNSPPMGIGQSTQGTTGVSNQFPVHYEAPKMSSIATTQPLPQTQFNGHTVLFTARDWQ
FT                   QSVASVYDPNGLKRRWAHSIDTTEQSNTKRQRESWTCWSRSLTIELVSLSLLGHANCRA
FT                   TAPHTSSRGSDLQRSMLRLASLIVNNVVYV"
FT   CDS_pept        join(851087..851315,851390..851763)
FT                   /codon_start=1
FT                   /gene_family="HOG000157065" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056139"
FT                   /orf_name="AFUA_8G03980"
FT                   /product="Cytoplasmic protein required for cell viability,
FT                   putative"
FT                   /protein_id="EAL85167.1"
FT                   /db_xref="HOGENOM:HBG201812"
FT                   /db_xref="HOGENOM:HBG447209"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="UniParc:UPI000051E644"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL7"
FT                   /transl_table=1
FT                   /translation="MASEMQNSNPIILNAADLPTRIPKAPQKPYAYGTDIFSSTLQSLG
FT                   QSGDSFSLIPHPDSEEDDDMSDEPIDEQEIFDLVSTISDPEHPISLGSLAVVSLADIMI
FT                   KPSLPHVPGSPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVDVRIKEGTH
FT                   STADEVNKQLGDKERVAAALENGTLMGVIAKMLETCQ"
FT   CDS_pept        join(complement(855157..855176),complement(854956..855101),
FT                   complement(852670..854898),complement(851942..852504))
FT                   /codon_start=1
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263338"
FT                   /orf_name="AFUA_8G03990"
FT                   /product="U5 snRNP component Snu114, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="EAL85168.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000F51859"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL6"
FT                   /transl_table=1
FT                   /translation="MEDLYDEFGNYIGEPVDSEEENQDEELKPQTFAFDEAFGEEEDEN
FT                   QNADQLMEVDEGPSNAVVLHEDKQYYPSAKQVYGDEVETLVQEEDSQPLSQPIIAPVQQ
FT                   KKFSIEEADLPPVHFSREFMTDLLSFPSQIRNIALVGHLHHGKTAFMDMLVTETHDLTE
FT                   RLEKRVGKRKEEQLRYTDIHFLERERGLSIKSAPMTLVLQNTKGKSHLFNIIDTPGHVN
FT                   FVDEVATSSRLVDGIVLVVDVVEGVQANTEQIIKHAVLEGLPITMVVNKMDRLILELKI
FT                   PPNDAYFKLKHVVEEVNTIIERTLPGQGERYRLSPEKGNVAFACASMEWCFTLQSFAKM
FT                   YAETYPQVETSDFALRLWGDIFFNPGSRKFTRKGVEENSKRTFVQFVLEPIYKLYSHTI
FT                   SESPDDLKETLAGVGINLKPSQLKSDARVLLNMVCHEFFGPATGFVDMIVQHIPSPVEG
FT                   SQRTLDRYYTGPLDTKVAAAMAACDPDGPLVVHVTKLFTSTDATKFHAFGRVMSGTARP
FT                   GQPVRVLGEGYTPEDEEDMATATISDTWIAETCYSIPTSGVPAGNFVLLGGVDNSIVKT
FT                   ATIVPLRLEDDEEAYIFKPIRHMTESVFKVAVEPVNPSELPKMLDGLRKINKSYPLIST
FT                   KVEESGEHVVLGTGELYMDCVLHDLRRLYSEMEIKVSDPVTRFCETVVETSAIMCYSIT
FT                   PNKKNKITMIAEPLDDGIAEDIESGRVSIKDPIRKVARFFEDKYDWDKLAARSIWAFGP
FT                   DEMGPNILQDDTLPSQVDKKLLGNVRDSITQGFSWGTREGPLCEEPIRNTKFRLTDVSL
FT                   ADQAIYRGGGQIIPTARRAVYSSFLMASPRLMEPIYSCTMTGPANAVASVYTVLSRRRG
FT                   HVLSDGPIAGTPLYTVQGLIPVIDSFGFETDLRIHTQGQAAVSLVFDRWSVVPGDPLDR
FT                   EVKTKPLEMAPAMATARDFVLKTRRRKGLAEDVTVSKFLEPELWRGLKESGVLDS"
FT   CDS_pept        join(855598..855662,855730..855779,855855..855930,
FT                   855994..856483,856541..857056)
FT                   /codon_start=1
FT                   /gene_family="HOG000012238" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263339"
FT                   /orf_name="AFUA_8G04000"
FT                   /product="Acetyl-CoA acetyltransferase, putative "
FT                   /EC_number="2.3.1.9"
FT                   /function="acetyl-CoA C-acetyltransferase activity "
FT                   /protein_id="EAL85169.1"
FT                   /db_xref="GO:0003985"
FT                   /db_xref="HOGENOM:HBG297252"
FT                   /db_xref="HOGENOM:HBG370930"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniParc:UPI000051EADD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL5"
FT                   /transl_table=1
FT                   /translation="MSSLPAVYIVSSARTPVGSFLGSLSSLTAPQLGAHAIKAALAKVD
FT                   GLKPSDVQEVFFGNVISANVGQNPARQCALGAGLEESTICTTVNKVCASGLKAIILGAQ
FT                   TIMTGNADVVVAGGTESMSNAPHYLPNLRTGAKYGHQSLVDGIMKDGLTDAGKQELMGL
FT                   QAEECAQDHGFSREQQDEYAIRTYEKAQAAQKAGLFDEEIAPIQLPGFRGKPDVTVTQD
FT                   EEPKNLNPEKLRAIKPAFIPGSGTVTAPNSSPLNDGAAAVVLVSEAKLKELNLKPVAKI
FT                   LGWGDAAQQPSKFTTAPALAIPKALKHAGVGQDAIDAFEINEAFSVVALANMKLLGIPE
FT                   EKVNLHGGAVAIGHPIGASGARILTTLLGVLKAKKGKLGCAGICNGGGGASALVVELL"
FT   CDS_pept        join(complement(858836..859010),complement(857625..858778))
FT                   /codon_start=1
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902872"
FT                   /orf_name="AFUA_8G04010"
FT                   /product="ZIP family zinc transporter, putative "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85170.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG057634"
FT                   /db_xref="HOGENOM:HBG325661"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI0000F51878"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL4"
FT                   /transl_table=1
FT                   /translation="MPLVSDFPDSILRAELSRRNEIRGSTSDRVACGSKEKGAYNTQIH
FT                   VLALFLILVLSTLACSFPVLARRFPRLPIPRHFLFISRHFGTGVLIATAFVHLLPTAFV
FT                   SLTDPCLPRFWSETYRAMAGFVAMISVFLVVVVEMFFATKGAGHVHGSEYDHLIGSVGR
FT                   GSSESVRDDANYLRLGRHHSTENLRLNLIQANIYADGAQEQSSSLSRMSTDGVEQSRSK
FT                   KMEPYGETGDAEFGGIDSLDNHSHSPVSDSHPRYLPSQQRDLHPKSSPVLPMQSPQRQL
FT                   LQCLLLEAGILFHSIFIGMALSVATGTSFVVLLVAICFHQTFEGFALGSRIASLIPDLF
FT                   SPSSPKPWLMSLAYGTTTPVGQAIGLVLHNLYDPASTTGLLMVGITNAVSSGLLLFAGL
FT                   VELLAEDFLSESSYATLRGRRRIEACIAVASGALLMAFVGAFA"
FT   CDS_pept        complement(859766..861397)
FT                   /codon_start=1
FT                   /gene_family="HOG000217384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750852"
FT                   /orf_name="AFUA_8G04020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85171.1"
FT                   /db_xref="HOGENOM:HBG051592"
FT                   /db_xref="HOGENOM:HBG328883"
FT                   /db_xref="UniParc:UPI000051E3E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL3"
FT                   /transl_table=1
FT                   /translation="MNCPICSRVSSSRLRFYCPTCACNQIYTLRIDNARALLEKETLGR
FT                   QVEKALLHQTSPTLSYHRFEECSTQSPDKVPSPQDVLQIITAKAESSIRRKELALQIQQ
FT                   LKSEIKDRQLGISQRRLTLARRRSDAESSKFQLESREVALICGVQNTIKRTERLWHSLH
FT                   SKTVEARIFLCREVANLYSLRQWMKQDGSEMKETYVIGGVPIVDLRDLNGKSQNCPLLL
FT                   DMPAPSINAQIGATAVQISTSFSNIAHLLVLVSHYLSLRLPAEITLPHKDHPVPTIHAP
FT                   IASYISRESILTATSTQPHNLASSTTHPLGFQSNHYQPRPLTIDRSLPKLAREDPESYV
FT                   LFLEGVTLLAWNVSWLCRTQGLNIASDSWEEICNIGKNMWQLLVAPPLEEATLMRAFAV
FT                   RETKPMKPLRDLPKTSLQKTISFPMMGHYSHGTVHSFLGASEGTEFVRTWRLPIPLKVV
FT                   DKLKSTLLGEMASAEWEVLEEKEWNDSEQSSTRVLAQGSRSQPEDDVMPDKNHVSHMAS
FT                   ASGVRNDLDSTSRPRGSSGWTKLRSR"
FT   CDS_pept        join(complement(864011..864560),complement(862945..863949),
FT                   complement(862644..862807))
FT                   /codon_start=1
FT                   /gene_family="HOG000076791" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263340"
FT                   /orf_name="AFUA_8G04030"
FT                   /product="Probable lysosomal cobalamin transporter "
FT                   /function="cobalamin binding"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="lysosomal membrane"
FT                   /protein_id="EAL85172.1"
FT                   /db_xref="GO:0005765"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031419"
FT                   /db_xref="HOGENOM:HBG051586"
FT                   /db_xref="HOGENOM:HBG328881"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniParc:UPI000051F946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCL2"
FT                   /transl_table=1
FT                   /translation="MPLPWISVIWFAYLIVIFVLIVVASVFIHVYQTPRDRSSFVTFIC
FT                   VFSIAALLATVMLLPVDVALVSSTISSALGQREEWATQEEVDKITYSLTIIYYSLYFLD
FT                   ALLCFVGIPFAYFWHEEYDEVAFEAGDQTACKRFWAATKYTLTFIAVVIALVLVGFFAP
FT                   MMESQPGHDLGYWRGYLIENQGEHAFTFLLGFVTIIGSCLYAFYTPSGLAMLPALFLRK
FT                   SSSFATQTLGGSTAMELNFNRERQRQLEGRCGGNSALLSAKDRRELDTLVREERTLIRR
FT                   QRLIEGRQEEDQSWPVTVYSKLKTILRPFRLLGGFCLFLVGLSTWISLLMTVVDKLINS
FT                   PCKHHCGYVLSRTNFNPISWIFIQSSRAFPTDYIIFALIVFFFFWGSVVGVVAVGIRFL
FT                   WIRIFQIRKGHTSPQAMLLATAVLTLITLGLNYSIVMMLVPGYATFGPQTFCDLAPTSS
FT                   EEQSDCSNHRHLVKPCSEKADSTAADKTCTPSVASTILNRVALNFPLFGALLLWAHFLF
FT                   LAGGGRRRGRGRESVSKHQKKRQSYMRGCPIASREPATSNYERLFKEGFFIFKRR"
FT   CDS_pept        join(865063..867058,867113..867426,867493..867660,
FT                   867739..868101,868153..868351,868391..868472,
FT                   868545..868998,869057..869204,869262..869743)
FT                   /codon_start=1
FT                   /gene_family="HOG000048586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20750853"
FT                   /gene_name="cft1"
FT                   /orf_name="AFUA_8G04040"
FT                   /product="Protein cft1"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85173.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG051581"
FT                   /db_xref="HOGENOM:HBG325662"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI0000F5186F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCL1"
FT                   /transl_table=1
FT                   /translation="MQCYTELLSPSGVTHALAIPFLSASAENLVVVKTSVLQIFSLLKV
FT                   QHHSRGETIETKSARPDQVETTKLVLEREYPLSGTVVDICRVKILNSKSGGEALLLAFR
FT                   NAKLSLVEWDPERHGISTISIHYYERDDLTRSPWVPDLSSCGSILSVDPSSRCAVFNFG
FT                   IRNLAILPFHQPGDDLAMDDYEFHLHQDDLNQVSDHVGNGLKSKDSTVYQTPYASSFVL
FT                   PLTALDPSILHPVSLAFLYEYREPTFGILYSQIATSHALLSERKDSIFYTVFTLDLEQR
FT                   ASTTLLSVPKLPSDLFKVVALPPPVGGALLIGSNELVHVDQAGKTNAVGVNEFARQVSA
FT                   FSMVDQSDLALRLEGCVVEHISDSTGDLLLVLSSGNMVLVHFQLDGRSVSGISLRPLPT
FT                   QAGGTIMKSAASSSAFLGSGRVFFGSEDADSVLLSWSSMPNPKKSRPRMSNVAEDREEA
FT                   SDDSQSEEDAYEDDLYTAEPETPALGRRPSAETTGVGAYIFQTLDRLPNIGPLRDITLG
FT                   KPASTVENTGRLIKNACSELELVAAQGSGRNGGLVLMKREIEPDVTASFDAQSVQEVWT
FT                   AVVALGSGAPLVLDEQQINQEYRQYVILSKPETPDKETSEVFIADTQDLKPFRAPEFNP
FT                   NNDVTIEIGTLSCKKRVVQVLRNEVRSYDIDLGLAQIYPVWDEDTSDERMAVSASLADP
FT                   YIAILRDDSTLMILQADDSGDLDEVELNEAARAGKWRSCCLYWDKAEFFSSTGPALKQG
FT                   TRCELFLFLLSIDCRLYVYRLPDQQLISVIEGIDCLPPILSTELPKRSTTREVLSEAVI
FT                   ADLGESWNPSPHLILRTESDDLVIYKAFASYIKGESHTRLSFVKESNHTLPRVTTSEKE
FT                   MQSNEKLSRPRSLRILPNISNFSAVFMPGRPASFILKTAKSCPHVFRLRGEFVRSLSIF
FT                   DLASPSLDTGFIYVDSKDVLRICRFPSETLFDYTWALRKISIGEQVDHLAYATSSETYV
FT                   LGTSHSADFKLPDDDELHPDWRNEGLVISFLPELRQCSLKVVSPRTWTVIDSYSLGPDE
FT                   YVMAVKNMDLEVSENTHERRNMIVVGTAFARGEDIPSRGCIYVFEVIKVVPDPEKPETD
FT                   RKLKLIGKELVKGAVTALSQIGGQGFLIAAQGQKCMVRGLKEDGSLLPVAFMDMQCYVN
FT                   VLKELKGTGMCIMGDAVKGLWFAGYSEEPYKMSLFGKDQGYLEVVAAEFLPDGDKLFIL
FT                   VADSDCNLHVLQYDPEDPKSSNGDRLLARSKFHMGHFATTMTLLPRTMVSSEKAMANPD
FT                   SMEIDSQTISQQVLITSQSGSVGIVTSVPEESYRRLSALQSQLANSLEHPCGLNPRAYR
FT                   AVESDGTAGRGMLDGNLLYQWLDMGQHRKMEIAARVGAHEWEIKADLEAIGAEGLGYL"
FT   CDS_pept        join(complement(872424..872569),complement(870757..872362))
FT                   /codon_start=1
FT                   /gene_family="HOG000157088" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263341"
FT                   /orf_name="AFUA_8G04050"
FT                   /product="Transcriptional regulator PacG/VIB-1 "
FT                   /EC_number="3.1.3.2"
FT                   /function="acid phosphatase activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL85174.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG051574"
FT                   /db_xref="HOGENOM:HBG323872"
FT                   /db_xref="InterPro:IPR007888"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="UniParc:UPI0000F5185D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCL0"
FT                   /transl_table=1
FT                   /translation="MEGFDTMAMPYLASPLSLGNMQGADYLNAMPGIDLPDQRSNFDSD
FT                   TFVSGEDIPPFTQHSLPNTLKRFSSGYDDPFTEMVTPFDPAPSEQPPDSSIDHNNKLLS
FT                   FSMPAYNFTLLDYSLRRTSLSLSAQLHGMFFLAESPWTTSPTENAPPQQGAELTCYRRN
FT                   LFQITGSVTLPRSLRYIMTEQGDRIPILAQELCVSATESVEGNSVKIISVPWKTPAANG
FT                   NQPTDDNGASNSNAKVEKEPPPIPLDIMAGQDLDTDYATFPIAWKRLQFRVATANNGRR
FT                   KELQQHFVVRLKVVATLSTGAKIPICEVHSGPVIVRGRSPRNFQSRKDLPLSGSAAASR
FT                   KSAQAATLNRTPTSDTDHRPSLTPGKAKSTAKSTSPDTSLPQSTIAAQRQSSPDWTHIP
FT                   HSSGGALSSTPLPQPSLYPQSTPEFSRMTDSQRRSSVMAAPINLSLLDDDTTGEGVNLV
FT                   DSARPGSSYANDVSHKSHDMGSSAPPTKMRKLSHSVSQAPSRSTSTSLPLLNTAGLQQP
FT                   FASSLPFPNESADLLYEYFPLGLDDWQAPVDAVYRPHVVHHTNMPEMKFVAGRGRSKRY
FT                   FAAEDVF"
FT   CDS_pept        join(complement(881655..881704),complement(881341..881459),
FT                   complement(878722..881234),complement(878498..878611))
FT                   /codon_start=1
FT                   /gene_family="HOG000157099" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263342"
FT                   /orf_name="AFUA_8G04060"
FT                   /product="Beta-N-acetylglucosaminidase, putative "
FT                   /EC_number="3.2.1.-"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85175.2"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG051544"
FT                   /db_xref="HOGENOM:HBG325664"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000F51879"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK9"
FT                   /transl_table=1
FT                   /translation="MAPKEDTLPPGWEDLDRQMGQLFMMGFDGTSVNPQIRSLIENYHL
FT                   GSVLLTAKNLKSAEEATRLVLELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQF
FT                   PSAMGIAATGSKSLAHDVAYATAQELKAVGVNWILGPVLDVLTNVRTQPLGVRTTGDDP
FT                   QEVSQYGVEFMKGYKKAGLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPF
FT                   RNAIVHGLDSMMVGGVSMSSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEAL
FT                   THNIGVGGGTVMAKNAGCDIILLCRSFPVQQEAINGLKLGVENGIIGRARIEQSLRRVL
FT                   KMKAKCTSWDQALNPPGLPSLMQMQPSHTSLSKRAYNNSISVVRDKQNLLPLSNIIEPN
FT                   EELLLLTPLVKPLPASAVSRSVTEHMNLSIDPIASDRTASVLSGESVFKELGRSLSRQR
FT                   SGRVLHTSYTANGVRPIHENLIDRASAVIVVTADANRNLYQHGFTKHVSLICRSQFSPS
FT                   GEPREKPMIVIAASSPYDFAMDTSIGTYVCTYDFTETALEALVKVLYGELTPKGSLPGS
FT                   ISRSQKLHQARQHWLVENWNEERDAQSLDTLLDAVRADCAQGQRSELLGVTSSSFLLRS
FT                   EEIDEAHFVVRNSSTQALYGFCSTYFFRSTGTGVIGSLIVDPARRKLSIGNSLHNRAIR
FT                   TLLQRKGMRRFQLGSRLPGIYLGIPSSNPVERKRLRQWFANLGWNTALSRPVCSVVLRN
FT                   LPTWTPPDGLIQGLKNADVSYDLVHGWDYAEPILDHIKTNSRQGLIDIYKIALGGAPNC
FT                   GIIRATRPSDGAILGTVVIYNGRSSLAEHMPVLKATQPSSGGISSPVISPSVGEYATVM
FT                   QGLVLLGIKQIRRQGAEAVVIDCVDGDSNFDCLSGMGFSMLHSFEEVNCDAATWTMMPT
FT                   T"
FT   CDS_pept        join(883601..883679,883747..883895,883959..884822)
FT                   /codon_start=1
FT                   /gene_family="HOG000064979" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902873"
FT                   /orf_name="AFUA_8G04070"
FT                   /product="Glucosamine-6-phosphate deaminase, putative "
FT                   /EC_number="3.5.99.6"
FT                   /function="glucosamine-6-phosphate deaminase activity "
FT                   /function="hydrolase activity"
FT                   /biological_process="N-acetylglucosamine metabolic process "
FT                   /protein_id="EAL85176.2"
FT                   /db_xref="GO:0004342"
FT                   /db_xref="GO:0006044"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG051497"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="UniParc:UPI0000F51863"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK8"
FT                   /transl_table=1
FT                   /translation="MSVGELSSGRTLSRRRNISRTISSVRCRIKAFKPTQDRPFVLGLP
FT                   TGSSPEIIYRTLVQRHRTGEISFQNVVTFNMDEYVGLPRDHPESYHSFMYKHFFSHVDI
FT                   PPQNINILDGNAPDLAAECASYEARIAGYGGIELFLGGVGADGHIAFNEPGSSLSSRTR
FT                   VKTLAYDTILANSRFFDNDVDKVPRMALTVGIQTIMEAREVVIVATGAHKALALKKGLE
FT                   GGVNHMWTLSALQLHQHPLVVCDRDATLELKVKTVRYFESIEQSGTDARTQGPPLVYRP
FT                   RTYVPAPLGAGKLPHQLTPASTPSKVPKDLRINTEFQNSIEEDELTPDSMSSRLVDSAI
FT                   GGLDTTLKADIMFDRMGARVVSH"
FT   CDS_pept        join(complement(886496..886980),complement(885376..886390))
FT                   /codon_start=1
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902874"
FT                   /orf_name="AFUA_8G04080"
FT                   /product="Betaine aldehyde dehydrogenase (BadH), putative "
FT                   /EC_number="1.2.1.8"
FT                   /function="betaine-aldehyde dehydrogenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85177.1"
FT                   /db_xref="GO:0008802"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051E3E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK7"
FT                   /transl_table=1
FT                   /translation="MADLPFAPRHPYYDGKVQLASSGRTFRTINPADNTPLAEIHVASN
FT                   SDTDAAIAAADRAFPLWSQTPHIARARILQKAAALLRERNDELARLETLDSGKAYSETS
FT                   TVDIVTGADVLEYYANLVGGGGLNGETTQLREDAWVFTKKAPLGVCVGIGAWNYPLQIA
FT                   LWKSAPCLAAGNTMVYKPSEYTPLHAQMLAEIYREAGLPPGVFNVVYGAGDVGAYLTAH
FT                   PLVAKVSFTGQVSTGMKVAGSAAGQMKYVTMELGGKSPLLILPDADLENAVNGAMMANF
FT                   FSTGQVCTNGTRVFVPRGMKSAFEKALLDKMQYIRPGPLFDNATNFGPLSSALHLEKVT
FT                   SYIRHGIETDKATLLYGGLGKPSLPKDLENGFWVRPTVFTDCTDSMRIVQEEIFGPVMS
FT                   ILYYDTVEEAVRRANNTELGLAAGVFTRDLNMAHRIIDQLQAGITWINSWGESPAEMAV
FT                   GGWKKSGVGVENGRRGIEAWVRNKSTLVDMNGRVATVFAKL"
FT   CDS_pept        join(888631..888877,888972..890353)
FT                   /codon_start=1
FT                   /gene_family="HOG000139601" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056140"
FT                   /orf_name="AFUA_8G04090"
FT                   /product="Choline oxidase (CodA), putative "
FT                   /EC_number="1.1.3.17"
FT                   /function="choline:oxygen 1-oxidoreductase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="alcohol metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85178.1"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="GO:0033713"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG298145"
FT                   /db_xref="HOGENOM:HBG734713"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="UniParc:UPI000051F952"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK6"
FT                   /transl_table=1
FT                   /translation="MATTNDFPSSDVNSYDYVIVGGGTAGCVIASRLAQYLPNKRILVI
FT                   EGGPSDFMDDRVLNLREWLNLLGGELDYDYPTTEQPMGNSHIRHSRAKVLGGCSSHNTL
FT                   ISFRPFEYDCRRWEEQGCKGWSFETFTRVLDNLRNTVQPVHSRHRNQLCKDWVQACSTA
FT                   MNIPIIHDFNKEIRSKGELTEGVGFFSVSYNPDDGRRSSASVAYIHPILRGEEKRPNLT
FT                   ILTNAWVSRVNVEGDTVTGVDVTLQSGVKHTLRAKKETILCAGAIDTPRLMLLSGLGPR
FT                   EQLSSLGIPVIKDLPGVGENLLDHPETIIIWELNRPVPPNQTTMDSDAGIFLRREAPNA
FT                   AGSDGRAADIMMHCYQIPFCLNTARLGYETPVDAFCMTPNIPRPRSRGRLYLTSADPSV
FT                   KPALDFRYFTDPEGYDAATIVAGLKAARRIAQQAPFKDWIKREVAPGPKVQTDEELSEY
FT                   GRRVAHTVYHPAGTTKMGDISRDPMAVVDHQLKVRGLKNVRIADAGVFPEMTTINPMLT
FT                   VLAIGERAAELIAEEAGWTREQPKL"
FT   CDS_pept        join(complement(892113..892484),complement(891135..892055))
FT                   /codon_start=1
FT                   /gene_family="HOG000275010" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263343"
FT                   /orf_name="AFUA_8G04100"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase
FT                   (NagA), putative"
FT                   /EC_number="3.5.1.25"
FT                   /function="N-acetylglucosamine-6-phosphate deacetylase
FT                   activity"
FT                   /biological_process="N-acetylglucosamine metabolic process "
FT                   /protein_id="EAL85179.1"
FT                   /db_xref="GO:0006044"
FT                   /db_xref="GO:0008448"
FT                   /db_xref="HOGENOM:HBG319223"
FT                   /db_xref="HOGENOM:HBG464950"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000051ED02"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK5"
FT                   /transl_table=1
FT                   /translation="MPGKTTTTPRITKFTNCRIVKGSELVEQDVWIDSLSGKILKDQEA
FT                   FYGLHLSPDEVVDLGGRILAPGLIDVQLNGAQGFDFSVPQASKEEYNEGLRLVNKGLAR
FT                   TGVTSYLPTVVSSTPEVYWKVLPSLGPSGSNHRPEDGAESLGAHVEGPFINPNRNGIHK
FT                   TEVLRAAQNFEDLEECYGKENLTGSSKSVKMITVAPEVGNMVSTIPSLTSAGIVCSIGH
FT                   SDATFEQALSATTAGATMVTHMFNAMRPFYHRNPGIFGLLGQSEHCRPFYGIIADGIHL
FT                   HPTSIKIAYNAHPDGLVLVTDAMKLCGLPDGVYDWTNGERIVKTGARLTLEGSDKIAGS
FT                   SATLIECINNFRRWSGASIADAINAATATPARLLGLQGVKGSLDSGADADLVVLSEEDD
FT                   PESPTLTVCQVWKRGVKIHDSDKEIASTTTV"
FT   CDS_pept        join(895512..896102,896163..896770,896848..896943,
FT                   897009..897246)
FT                   /codon_start=1
FT                   /gene_family="HOG000157110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750854"
FT                   /orf_name="AFUA_8G04110"
FT                   /product="DUF895 domain membrane protein "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85180.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG174880"
FT                   /db_xref="HOGENOM:HBG323845"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051E3E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK4"
FT                   /transl_table=1
FT                   /translation="MASEKPEDGHQPEKEGPAITADPEPGRHGAITGKPWMYKPLKIGP
FT                   LTLPWFASPEVQLVLVSFVCFLCPGMFNAVNGLGGGGQVDRTDTSNANTALYSTFAVVG
FT                   FFAGSIANRIGLQLTLSFGGFGYFLYVASLLSYNHNKNAGFLIFAGALLGVCAGLLWCA
FT                   QGAVMMSYPRENEKGKFIAIFWVIFNLGGVIGSLIPLGQNLHSSAGTVNDGTYIAFMVL
FT                   MALGFVLAWFLSDSKYVVRKDGSRVISMKNPTWKSELLGLYETLRTDYYIVLFFPLFLA
FT                   SNWFYGYHFNSVNGAYFNIRTRSLNSLLYWLMQMVGAFVFGKLLDLQFLSRSMRAKLNW
FT                   LILLVITMGVWGGGYAFQKQYTLETAKQDVDFTSHGYVGPMFLYMFYGFYDAAFQTCAY
FT                   WFMGSLTNNGRKLANFAGFYKGIQSAGAAGMWRMDAEKTPFMTQFASCWGLLVGSLLIA
FT                   SPIIFFKIKDHVDVEEDLKFSDETTEDVTGIAIEDRRDSTKGESVTKHVSAS"
FT   CDS_pept        join(complement(899728..900076),complement(899571..899669),
FT                   complement(899383..899499),complement(899190..899313),
FT                   complement(899106..899121),complement(898942..899058),
FT                   complement(898835..898885),complement(898619..898772),
FT                   complement(898494..898552),complement(897824..898393))
FT                   /codon_start=1
FT                   /gene_family="HOG000157125" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263344"
FT                   /orf_name="AFUA_8G04120"
FT                   /product="Carboxypeptidase S1, putative "
FT                   /EC_number="3.4.16.6"
FT                   /function="serine-type carboxypeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="EAL85181.2"
FT                   /db_xref="GO:0004185"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG051456"
FT                   /db_xref="HOGENOM:HBG323860"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="UniParc:UPI0000F51875"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK3"
FT                   /transl_table=1
FT                   /translation="MRGYGLISLLPVAAAIWAPAIHQPVTVDKRQLPKDPTGVKTIHTA
FT                   NNVTIRYKEPGKEGVCETTPGVKSYSGYVDISPESHTFFWFFEARHDPKNAPITLWLNG
FT                   GPGSDSLIGLFEELGPCRINSTLDSTINPHSWTEVSNVLFLSQPLGFSYSEAEPGSLNP
FT                   FTGVFENASSAGIQGRYPVIDATLIDTTDLAAHAAWEILQGFMGGLPQLDHRIKSKDFS
FT                   LWTESYGGHYGPAFFNYFHEQNEKIANGTVEGIHLNFNSLGIINGIIDEGIQASYYPEF
FT                   AVNNTYGIKLVNDTVYNYMKFANQMPNGCQDQIGYCKQTNRTSLADYAICSEATNMCRD
FT                   NVEGPYYAFGNRGVYDIRHPSKDPTPESYYVDYLKKDWVMNAIGVNINYTQSNNDVYYA
FT                   FQQTGDFVWPNFLEDLEEILKLPVRVSLIYGDADYICNWFGGEAVSLAVNYTHTEQFRA
FT                   AGYTPMVVDGVEYGETREYGNFSFTRVYQAGHEVPYYQPVASLQLFNRTLFGWDIAKGT
FT                   TKIGPDYSTSGKAKATHTESSVPLPTATPSTSVH"
FT   CDS_pept        join(complement(904040..904290),complement(903785..903975),
FT                   complement(901500..903715))
FT                   /codon_start=1
FT                   /gene_family="HOG000157136" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750855"
FT                   /orf_name="AFUA_8G04130"
FT                   /product="C6 transcription factor (Ctf1B), putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85182.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG051446"
FT                   /db_xref="HOGENOM:HBG326971"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000F5186C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK2"
FT                   /transl_table=1
FT                   /translation="MTDLAVSSTPASANTMESESQSKRKASAAGLSANSRPVKRRASKA
FT                   CCCCRARKVRCDVVENGSPCTNCRLDQVECVVTESKRRKKSRIEVENGTRQPSQSPADG
FT                   LDDAGSFLRRLSESHGLNADIAPESPSQQSVDLDQGHHMPHLLYQSQANRIGGGNHFRR
FT                   RMAPNPAVPATLPLHHVTSQIQQLLDPSFSNARSGGVLLPDYIRGLPSRLQREDIEYLS
FT                   MKGALTVPDVGLRNELLKAYIHYVHTYMPLLDLEEFLQTIVQNDGIHRMSLLLFQAVMF
FT                   AGTAFIDLKHLHAAGYPSRKAARKVFFQRARLLYDFDYEVDRISLVQSLLLMTYWYETP
FT                   DDQKDTWHWMGVSLSLAHTIGLHRDPGNSRMDARRQRMWKRIWWSTYTRDRLIALGMRR
FT                   PMRVKDDDCDVPMLTLDDFEFHPFSPEIVRMVGNSEILQNVEHQKKLALMFIEKAKLCL
FT                   CVSHVLSAQYSVLSHKFGGTMETTMMLVPKKSAAETFEVRRCDQELEDWLANLPAEIQY
FT                   TPAASAKLTEAQEVLHSHRALLKMVYLTTSSALHRPQVLPANPFPSMDAELQEISRNKV
FT                   RFAAVEITNIAQDLHSLDLTRYFPTTGVTVLLPAVIIHLLDIKSSDPSVRMTSLQRFYQ
FT                   CMRILQRLREIYASADFATSFLEAAIRKAGIQLTVAPQDVQARPGSSFDAGARVDTLTP
FT                   PPDSLAQKIPDLTYPKPAVVGTARQPVEEGDTLFASTPPPSDGSENGSTANINPNYHRD
FT                   AFSIPNLDSELSISELMDLANDAEVTQNDFDALINFDDAGADFFTADDHLNLNGSGPNS
FT                   KGFGFSMDPINGMSDLMGLDAGNKPDIASLGDRQLHSDHMATTTGHSNTGTAASESNGL
FT                   TANVDADLGICLSG"
FT   CDS_pept        complement(909768..912086)
FT                   /codon_start=1
FT                   /gene_family="HOG000157158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263345"
FT                   /orf_name="AFUA_8G04140"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85183.1"
FT                   /db_xref="HOGENOM:HBG057638"
FT                   /db_xref="HOGENOM:HBG328870"
FT                   /db_xref="UniParc:UPI000052005A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK1"
FT                   /transl_table=1
FT                   /translation="MSKPLSPLPTSRQNSRAFSSGLNGLEIESLVNESGSENVFASPNK
FT                   TTDGGADTTTPQSGHYPATYHTQESILDVGDLESVDEQPSSPFQYDARDPTVDFRVLGN
FT                   QQISSGLRECSMTPRKRSYSHCPEDGDATDRSSERSKKGMSRRDMPDIQVYADDEPQMH
FT                   EREMTGRTGHEIATSMVEKKRNEGMSTVLDVHNNYDDSFSEKENLDMKAADDVMNDDSH
FT                   DPMDDTCFSTFSAVPNADMTSFANLRGDSPFKTGRQLPSSPGRMDENQSRSPAPATPDT
FT                   SRRSQRQSALIDIGTPIASTPRGRERRDMENASETPNLLDLTDQPNFFPRQRYSIQKER
FT                   YSPSRRSPLRTLRESIRSPAKVSLLDFDIPAIPTPRSIPTVTPRELESLKSGFLSEISS
FT                   LKATLSGKEAEVSSLKNAVADAERRVGEALEEVRNEAARKEALEIEQAEWQRRGQEMED
FT                   VLRTVRADIVEGEREKERLIRKLEEAERSREHLERRMVELESQLSAARKSAPNETGDDG
FT                   SAQRTTAAEETAREVQDAVEKVARELHTLYKSKHETKVAALKKSYEARWEKRVREAESK
FT                   FKAVSEENERLRNERDAALSEASRPDASIMAHQNDEHEAEKHVLAAQIKGLQQEMETLK
FT                   QDNERLHAELKVERAEKGELVAAVDEWLAMQQNVPQPSAPPESPVVSVEYETPEPEPAP
FT                   AQSTEESRRSIGRSDSSGIRPASTGSGSGEKRIPKIGAPTGRHIRGNSGGKSGIAVFTP
FT                   GRGPGGIMGSIERMGRGGV"
FT   CDS_pept        join(complement(914311..914383),complement(913889..914254),
FT                   complement(912593..913821))
FT                   /codon_start=1
FT                   /gene_family="HOG000157169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263346"
FT                   /orf_name="AFUA_8G04150"
FT                   /product="MFS transporter, putative "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85184.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG051159"
FT                   /db_xref="HOGENOM:HBG329685"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051EAE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCK0"
FT                   /transl_table=1
FT                   /translation="MVLTRQTRQTTSDDAFPTTQLFLLAICRVAEPIALTSIFPYSWVM
FT                   VKDFRVADRTDASFYAGILVSAFSLAEALTGMFWGGLSDRIGRKPVLLSGCFGTILSLL
FT                   LVGFAPNFWVALLGRALGGLLNGNIGVIQTMVGELVKRPEHEPRAYAVMPFVWSIGTII
FT                   GPAIGGLLAKPADSYPSLFSANGLFGKFPYLLPNLVCSFLLLLSIAGSWLFLQETHPGL
FT                   QHQNAAGNLDHTSAESPLLATAGATANAGVDLRAESYGTFNQVRLQADEDWFVNADGSK
FT                   YKTQKQPVFTYRVVSLIIALSIFTYHSMTYDHLLPIFLQDKNGRNTSGFSNAPFSFPGG
FT                   LGLSTRTVGLIMSSDGIIALVIQSCIFPILAQLLGVWRLFVVVTVLHPLAYFIVPFLIF
FT                   LPQSSVIFGIYICLIVRNILSIIDYPVLLILIKQACPSESVMGKINGLAASAGAVARTI
FT                   APPIAGFLYSTGADMNFTAIAWWGSSLIAVIGAVQLCFMKHKKHTSATIRPAMPCHYQY
FT                   VPDESRPQKETIHIIVTDTDANADGAGTSQSRRYSFLT"
FT   CDS_pept        join(918913..918945,918996..919859,920062..920121)
FT                   /codon_start=1
FT                   /gene_family="HOG000181278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263347"
FT                   /orf_name="AFUA_8G04160"
FT                   /product="Folylpolyglutamate synthetase, putative "
FT                   /EC_number="6.3.2.17"
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="EAL85185.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG057639"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniParc:UPI000051FBD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ9"
FT                   /transl_table=1
FT                   /translation="MKEWLQLLGHSDNAVNSLNVIHVSGTKGKGSTCAFTRAILRAHGM
FT                   RTGFPKRIGLYTSPHLQCIRERIQLDDHPVPEDLFTKYFFEVWDCVMPEDIQQDSGVAR
FT                   QPRYLQFLALLAFHTFIREGVQAAIFEVHHGGEYDATNVIQSPVATGITSLGVDHVAQL
FT                   GPTIEAIAWHKAGIFKPGAPAFSVNQKPGPADVMRKRALDKGTTLTFVSTNECLPTDGT
FT                   VLSVPVQRLNCSLALELSRAFVHAKAPGHTISDEDICHGVESFSLTGRFEIINEGQVQW
FT                   FVDGAHNVLSLGEAAEWFRERMTPLVRRIVEVLANHD"
FT   CDS_pept        complement(921768..923375)
FT                   /codon_start=1
FT                   /gene_family="HOG000157180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902875"
FT                   /orf_name="AFUA_8G04170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85186.1"
FT                   /db_xref="HOGENOM:HBG057640"
FT                   /db_xref="UniParc:UPI000052074C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ8"
FT                   /transl_table=1
FT                   /translation="MTTTASETTRLHITPFTPDLLPSVLPSSIRASATDISFHSIATFP
FT                   ENNYGYVTLPAMEADKIKKKLNGSILKGRKFKVETARPPKRQEVDVETDTVMSIRKTTS
FT                   DKVSKKRKANDNVLDGYELPSGRQVKRGWTESADAKKGRRKDEKLKKGKDGKKAKTQVK
FT                   SKYTEKSECLFRTKIPKNRSASPDEKQEKQIKKKKKSPQESVVHEFATTITHPSFLRSE
FT                   VDGAAPTSAFEEGKGWIDSAGNLKETVSDRLRKDQYRPGQVAGAKEKRKSAKAHPTAQE
FT                   THLEKTEDDGIDSADESEDWTSSSGTTSSDDSSTDSEIDDGMSSASSESSASFNRGEQQ
FT                   QSHSLTTKENVSSPRKTDESELLPDSATPSAQTTHRTDSKGVHPLEALFKRPAVGSSDS
FT                   KPAPETNAQFSFFGQDDVESEEEEEEYREPQTPFTKKDLLSRGLRSAAPTPDTALINRK
FT                   IDWNNDDSDAMEVTEEYADTPITRAESKAESKEDSEFTKWFWENRGDNNRAWKKRRRDA
FT                   AKEQRQRENRRTGMKGKS"
FT   CDS_pept        join(924709..925095,925150..927201)
FT                   /codon_start=1
FT                   /gene_family="HOG000089922" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263348"
FT                   /gene_name="sip5"
FT                   /orf_name="AFUA_8G04180"
FT                   /product="Protein sip5"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85187.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG057641"
FT                   /db_xref="UniParc:UPI000051FBC1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCJ7"
FT                   /transl_table=1
FT                   /translation="MGNSQTKEFRPPLSSSNRRSHQWGSSSSHGRSPYSDRHHAESSRS
FT                   RGSRPDLSILGIGGSSERDVATLEHRRETKQEREARRLEKERAARVKERERSMREEHVD
FT                   GGYLVTQGVYVGTEDFNKAVTRQLMIERRLAPFWRGLNDFSESWTEHQLMAAARGLPIP
FT                   PPDEIPPELEYKNPPKLSGDGKEPSIQHLMVPITSRSQSYGSEASQSSTPAHSLPAPVS
FT                   PIASGTSTSPLFRSRAKTLASLTTSKLGSQSDSTPKEIHLPEDPFVNGQPIEAYLYKDA
FT                   TECPICFLYYPPYLNRTRCCDQPICSECFVQIKRPDPHPPEHGEAEPNAAAAEGDRQDN
FT                   QDCQLVSEPAACPFCVQPEFGVTYTPPPFRRGLVYATDPTLRPNFTSPVSSTSSLASAN
FT                   ASPGTGRRRATSLSANDPAVITTDRVRPDWAQKLANARAHAARRSAAATALHTAAYLMN
FT                   STASGNESRNFSLGRRGVMRRTGQSETPSASSRSGSPALQALAFLTDRRTPGHDTDSAE
FT                   EGTGNLAPPRNSSRRNRIDDLEEMMMMEAIRLSLASEEERRKKAEKEARKEAKRREKEN
FT                   KKAEKAARKHGFYSNNASSSALDVPSDARLGRVASTSSSITGEDASPSKGKEVDRTSPA
FT                   ATAASSQSSTEIASESMTINPHPNVVEQGPSAQSSMAQLSPRELPKPSHLRQVSSASSS
FT                   FSSLVESTGEDHSGAYDGNASSTEPLFNFRSLAAVIGDEDKGDGTAEHVEDTSSKPSAE
FT                   GSASSTAPVADEMPGQSTTPADPIAVKTVAEDRDCLMPKELETQSVEITSATRNAEATT
FT                   "
FT   CDS_pept        929050..929862
FT                   /codon_start=1
FT                   /gene_family="HOG000157191" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750856"
FT                   /orf_name="AFUA_8G04190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85188.1"
FT                   /db_xref="HOGENOM:HBG057642"
FT                   /db_xref="HOGENOM:HBG328865"
FT                   /db_xref="UniParc:UPI000051E895"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ6"
FT                   /transl_table=1
FT                   /translation="MAILQKENRPRGLRVPSLSAFKSKKAIDHEPAPAATPVSTAPSAA
FT                   APAPPAPVAPPQYPVRTDSAPIRPARPQNDKELPPNPLPAFPPTSASLGPEDIHPAFRN
FT                   EPSAARNHNYAPPTRARDEPPVQIPTQQTSSSESSVPPDAGDPLEDFIPDPEPEPEHEP
FT                   ELDAASGRLDSVSSDEHNGPFTPPEIEPVTVPLNRLHYACFQEHRSMMPANNVWYSLPC
FT                   MTCQKFDREMRYRCVFCCLRICADCYQSLQKVPNRSLARLMETMPANF"
FT   CDS_pept        join(complement(931261..931374),complement(930174..931184))
FT                   /codon_start=1
FT                   /gene_family="HOG000157202" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902876"
FT                   /orf_name="AFUA_8G04200"
FT                   /product="G-patch domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85189.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG057643"
FT                   /db_xref="HOGENOM:HBG328864"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI000051F6FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ5"
FT                   /transl_table=1
FT                   /translation="MSPANGGEEEEDDYMSMVIEEPQQKETFAQKKLRKQREAEARAKV
FT                   PSKAELAAREAARRDEALSKSTLDPSNKGFQMMAKLGFKPGQTLGKPQRAPGDSKPSDG
FT                   DSPPLHGDKEERLRSEPLNLVFKEGRGGIGLDSEKKRKLREEAEEAVKKVKQEEGDYRD
FT                   RVRQERETRRTEAQVYAAQKVAERLDAEAEGETADGVVETAEAGQMEKDDKSLDREQSR
FT                   DEGSVEGSTGGSRAARGKVRVKPTSQINVLYRGLVREREEKERALQMRHTLQTSLPSSF
FT                   FPNPRLPGYDDPTLEPDDKEALGSGKDTSTILEQELEEEDPELDEFNALAPSERLARLV
FT                   VYLRERHRYCFWCKYRYETDEMKGCPGITEEDHD"
FT   CDS_pept        join(932305..932557,932653..932933,932990..934027)
FT                   /codon_start=1
FT                   /gene_family="HOG000157213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16263349"
FT                   /orf_name="AFUA_8G04210"
FT                   /product="Triacylglycerol lipase, putative "
FT                   /EC_number="3.1.1.8"
FT                   /function="cholinesterase activity"
FT                   /protein_id="EAL85190.1"
FT                   /db_xref="GO:0004104"
FT                   /db_xref="HOGENOM:HBG050985"
FT                   /db_xref="HOGENOM:HBG327208"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI000051F94D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ4"
FT                   /transl_table=1
FT                   /translation="MHLNNLYALVLLLLPAASARKSVVDLGYTQYQGHELSNGIVQWLG
FT                   MRYAAPPVGQLRFAAPQDPLPIKGVQEANKVAIQSQPRCHCLFIDVYAPRNASNLPVFF
FT                   WIQGGGFNSNSNANYNGTGLIEASGSQIVVVTFNYRVGPYGFLAATEVQNGGSLNNGLK
FT                   DQIKALKWVQKHISKFGGNPNHVVLGGASAGAASITLLLSAHGGRNDGLFHAAAAESQS
FT                   FATMLTLNESQFAYNNLVIRTGCASENATLACLRNLDTASLQRQNFNTPFPGAQLAPLY
FT                   MYGPTIDGDLVPDYTYRLFHQGKFIRVPVIFGDDTNEGTIFVPKDVSSFSEVDKFLQNQ
FT                   FPKIELHHLAKINELYLQENQTQSFPDASVWWRPASNAYGEMRYICPGINMSAVYENAG
FT                   VKSWNYHYAVEDEAAQASGTGVSHTVEVNAIWGPKYTNGGAPPSYTTTNAPIVPVMQGY
FT                   WTSFIKTFNPNTHRYPGSPEWKTWGDGGGYNRNFIKTNETKMESVPIDQKQRCGYLTNI
FT                   GTALGQ"
FT   CDS_pept        join(complement(936765..937052),complement(934244..936697))
FT                   /codon_start=1
FT                   /gene_family="HOG000157224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263350"
FT                   /orf_name="AFUA_8G04220"
FT                   /product="RRNA maturation protein (Nop14), putative "
FT                   /protein_id="EAL85191.1"
FT                   /db_xref="HOGENOM:HBG202617"
FT                   /db_xref="HOGENOM:HBG737435"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniParc:UPI000051FBC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ3"
FT                   /transl_table=1
FT                   /translation="MPPSQLKQLKASLRESGVLAPQQSKKQKRQNAKAGVSAQNRAQRN
FT                   AALQAIRDRFNPFEIKVTSRNKFDVTTRDGGSKPAAGLSRPGVTKSLGEEKRRQTLLRE
FT                   MERKNKIGGIVDRRFGEDDPTMTPEERAAARFARESQKKLRKESMFNLEDDDEDDFQLT
FT                   HKGQTLTLGDDVPQDDFEEDLRGLEEDQSDSEVPRKRKRILDNDELEDFVFDDEDGEDQ
FT                   PERKKSKHEVMKEVIAKSKFYKLERQKAKEEDDELREELDKGLPDLFDMLRGVKPPPKP
FT                   EPAKDDLESMNPDRAALLKGTADNDPNKEYDQRLKQLTFDKRSQPTDRTKTAEEKAEEE
FT                   AQRLKTLEEERLRRMRGEQESDEEEDDEEGESETGGEDSNDESIPDDAEAFGLKQPSPQ
FT                   TNKGPEMGVEDEDDFIIDDDLVETRSNVSLSFDESDGEEGSSEEKSEEEDEEEDELING
FT                   LTLPTSKSGESTAAADGAGKRSEGLAYTYPCPEDHESFLEVIKDVPMNDLPTVIQRIRA
FT                   LHHPRLHADNKTKLGRFAAVLVRHVAYMAEQPEHPPFNVLEAILRHIHSLAKSHPESVC
FT                   MAYRNYLREIATDHPLSLRAGDLVILTGIATTFPTSDHFHAIATPAYLCLARYLGQGAI
FT                   NSLGDYATGAYAASLCLQYQTISKRYMPEFINYVLNALCNLCPTEPTSSLGFFPARGSQ
FT                   ESLRLIPSKQLNPRKLRFWDIATAQSDQRAQDELKLSLIHTFVTLLNSASDLWAGKSAF
FT                   FEIFEQVQRVLRHVSKSAKGKLSSTVQDTLQSTLDKLDTHLSRARATRRPLLLHNHRPL
FT                   AIKTAIPKFEETFNPDKHYDPNRERAELNRLKAEFKRERKGAMRELRKDANFIAREKLR
FT                   EKKERDAEYEKKYKRLVAEIQNEEGREANAYEREKRKRQGKW"
FT   CDS_pept        join(937226..937301,937356..937475,937530..937590,
FT                   937648..937784,937847..938475)
FT                   /codon_start=1
FT                   /gene_family="HOG000157238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263351"
FT                   /orf_name="AFUA_8G04230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85192.1"
FT                   /db_xref="HOGENOM:HBG057645"
FT                   /db_xref="UniParc:UPI000051FBD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ2"
FT                   /transl_table=1
FT                   /translation="MSFENLHCHSNMASHLSDRFLWLCLGVSLFFAIRGIAADLRRVSD
FT                   LTEIKHVEKEDKIISEGTEDALKLDTLLKLSDSTSYDLRAAALRIIAERSTKGPTRDLL
FT                   LKDLASKNKERRGRALTALYFLLSNRALSRTSVCSRLKDLSTYNALVDCLCNFLEEHVE
FT                   ETSTTDSPILPKTRPLGEKKALNILNLILRENIPAALEAGVISRWLSKYPFPCALTEPS
FT                   RRQDVVILMKTWWSDDTIMSEIFSTLSSHPDGTKQLRKYGLMGSMMEENDHDDDDEDSD
FT                   VWMIDGEDTAGSSHLSGRRLRGGTAAEQAVRRRRREAMVLSDGVHPLNNDDIFQIPITE
FT                   "
FT   CDS_pept        join(complement(941085..941147),complement(940820..941029),
FT                   complement(940714..940764),complement(940402..940659),
FT                   complement(940204..940343),complement(939877..940150),
FT                   complement(939696..939817),complement(938666..939644))
FT                   /codon_start=1
FT                   /gene_family="HOG000217385" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263352"
FT                   /orf_name="AFUA_8G04240"
FT                   /product="Origin recognition complex subunit 3, putative "
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nuclear origin of replication
FT                   recognition complex"
FT                   /protein_id="EAL85193.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005664"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG057646"
FT                   /db_xref="HOGENOM:HBG325666"
FT                   /db_xref="InterPro:IPR010748"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniParc:UPI0000F51869"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ1"
FT                   /transl_table=1
FT                   /translation="MEPDHIDMDALGPFKDGSSSQGVYIYKPSIQNRSLGERPSKRRKV
FT                   QSEQKAEIDSAYSFEPLLNGDEPEHAVKLRYETYQQLWSEQEAKIQEILVDIDSDVYER
FT                   ISTFLRNLIGNRYKGCIPAALVTVGSNVSSLGRLLSRLNDQLSSTGEGGVVVLESGDAP
FT                   NLKTTLKNIIRAAVTNTEGNDGYQKLLTDREGPRLLAYDLDLLSDYVNRKGVKKLVLAF
FT                   RDSEAFDPTILTDLLLLLNSWLDRIPFTLLFGISTSVELFEGRLPRSTVALLRGKYFEI
FT                   HDASNCVDRIYERLQADPNGRFWLGRNITAVLFERSNDYFQTPEAFSRVIKYSYMTHFF
FT                   ANPLSVLLANDLPGTLRSGPLCEAIRNLPSFRGYCEHLLDVGSFDQARRLLEDDEFFFQ
FT                   EMLRHLRSGQQKMRDIFQTVRWIQSCRRTLNLTKRTDISELSIRAMSGELLSSSSVGDM
FT                   MKILRSLDSKRLGDILSSLPDGLTNVQEFRQIKRDLDALLQDYQGAEPLRSEYDSRQSV
FT                   VATTVVQQRVKLSKGKSKVSKHIVDYTRIIDHFYHLLESYLTETLLRPQDLCLHEVFFL
FT                   DMRSPLKETFTPRPRFAIERALSNPFDYLISTPEPCETKLSTKQPATAILFQLYLESGS
FT                   LVNVYDIWQAFYAVFESEQGDSCDERMILAMFYRSLSELKAFGFVKSSRKKIDHVTKSA
FT                   WMGL"
FT   CDS_pept        941378..943966
FT                   /codon_start=1
FT                   /gene_family="HOG000157260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16263353"
FT                   /orf_name="AFUA_8G04250"
FT                   /product="Pentatricopeptide repeat protein "
FT                   /protein_id="EAL85194.1"
FT                   /db_xref="HOGENOM:HBG057647"
FT                   /db_xref="HOGENOM:HBG328862"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000052004A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCJ0"
FT                   /transl_table=1
FT                   /translation="MLRQAARGARWYQYVAHKSPLTTSPPRLRAFSVLAPQLLHYGGKD
FT                   DKIRFYEQDTRGSKTRREIDPEAEDRAAKEEVESELSQLDKELEDLREGPYGPNSAFIK
FT                   ELPEHERKIALEALRKHAEETGEADDDLGLDKVFDEELDNMLREEFEGMAMEEENWLSE
FT                   VEEEGSTEAPVPRQPYEVTLNDAESHPYVDKLNECLRRLNSDPSDERAKQYLWKWYRRC
FT                   RQVIPNFLQSIPEEALTMMWESQANGDLTRASRATRLQALAEDAISAGRSLATSRTLVY
FT                   IQSLQESGKTNLALDQWEACQTSLSQSKEDLEAYWKLGVRLFAAADDPQRAQDIALAFL
FT                   ANDKSREPRILLPVITAWGRQPGREAEVKAWALYLQLKALLESKMKMEDYDFVSIGLLK
FT                   AGKLDLAIAVFKDMMVTAQDPANDSAALYKAALGLVGNLQMSSIREQDVNKISLSTLTV
FT                   LPRRFQNRFFYASWIKKLIGMGEVDSAAMVIELMYERGVKPDSKHLNGLLAAWLREGNA
FT                   IARAKAEQLGWAMIQQRIDLVWARIASPEKSPRLHVRQETDGARIPKFMQRQMPSANIE
FT                   TFSILLLHYTRRGDDDMVKYLVKCLGDAQIRPNSYFMNHLLYAELRKQDIRSVWDKFKA
FT                   MSLSIKPDLETYACLWDCGKLQYDRGRAAFDAGFPSARCLFAEMMKWYSQLSPRGKSTA
FT                   QEEFSKELYDQIIRCFCLSKDLPGTLVALYSLQAAFGYFPDEVTARLIILQVARMAGVP
FT                   ADTPKRRLRRLSTTPRSKENIAQVNRLVEILSERKAAGLQARGLSPDQLEPQEKQQYQL
FT                   EIMSDLLRVVIARTATAPGQIEDQIAKVAVEMGVSDVDLGSSLDDDSLLL"
FT   CDS_pept        join(complement(945286..945385),complement(944911..945224),
FT                   complement(944445..944831))
FT                   /codon_start=1
FT                   /gene_family="HOG000157271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750857"
FT                   /orf_name="AFUA_8G04260"
FT                   /product="Translocation protein (Sec66), putative "
FT                   /protein_id="EAL85195.1"
FT                   /db_xref="HOGENOM:HBG057648"
FT                   /db_xref="HOGENOM:HBG328861"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI000051E3E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI9"
FT                   /transl_table=1
FT                   /translation="MVDWLSLAVPLAYLGVLLGSLATFSSLYRKRKARKATSLEPWFPP
FT                   HLQRDIYFSLLHLDPPASTSSKEKKAPAVPETVLKAALLRRATEDIKRVMALRNQKQAL
FT                   AMLLQRGSVGDDLWQRFQRAEKEMEDEVRDVVAEANAYVPNWGQTIFQSANEMLNNALF
FT                   RERLQSYQNKLAEEREWWDKKKASIQEGFMKELDAESSAATKSEQAVSTTTTTSSTPGT
FT                   KTPESSAAPSTAAPSDDEAVLVEAADTVAGGSSGAGKKKKKGKK"
FT   CDS_pept        join(complement(949151..951209),complement(946188..949093))
FT                   /codon_start=1
FT                   /gene_family="HOG000157282" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19902877"
FT                   /orf_name="AFUA_8G04270"
FT                   /product="AAA family ATPase, putative "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="EAL85196.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG057649"
FT                   /db_xref="HOGENOM:HBG328860"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000052073F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI8"
FT                   /transl_table=1
FT                   /translation="MPRPKRTIEELANKSDSDDENYSDRPVRSSRQSARSKSRKKPKPT
FT                   KKRARRHSNDDITSDDDDILDDVDELDFDDEDEEDPNAPKNARGLTARKAATNRPVYNE
FT                   GDSSSVDDDFEEEDDSEPTRSPKKRKSTVVTLKVNALKRQPLPESGRRMTRRTRDPSED
FT                   IVALTNSGRHMELVERGTHSPEMEARRSRRGSRASKRLNFGPEKVEIDEKPEVFEPIEE
FT                   TSMEVKASQPEIMESDHQGDFEEGVPSGQDSGEGAAEADEVGVVPESENGDVKHQEEDD
FT                   EDDEGPTTRRRRGKPSRSQPTEEAQPDEEEDAHPRRSGRKKPRSSQRKRQDDESDFEPE
FT                   EDESNDDDDEERSLSGKSHGSPRKASQARDDEEQDSTAGRRPGLRKRASRSRGQSEVRG
FT                   DIAEELAEELEDLRGDRPRRRLQTDIVYEKPRRSRKDVDYRIIRPDLILPIEEAENEVN
FT                   ESPSRRGRGGGGSSWQRTLFPTYGPFGGGGPPAILAPPGAPAATGGVDSDSSDDEVMQH
FT                   PKTGGSVSGPPGAGLLPSAQTHGADPLQGPSGTPANLGKIKDKQALADADPLGVDVNVN
FT                   FDSVGGLQGHIDQLKEMVSLPLLYPEIFQRFHIVPPRGVLFHGPPGTGKTLLARALANS
FT                   VSSEGRKVTFYMRKGADALSKWVGEAERQLRLLFEEARKTQPSIIFFDEIDGLAPVRSS
FT                   KQEQIHASIVSTLLALMDGMDGRGQVIVIGATNRPDSIDPALRRPGRFDREFYFPLPNT
FT                   EGRRAILDIHTKGWDPPLPDHIKDELAEITKGYGGADLRALCTEAALNAVQRRYPQIYK
FT                   SDQKLLIDPKKIDVTPKDFMLAIKKIVPSSERSASSGATPLPKTVEPLLRRPFSDIKTI
FT                   LSEILPQRKRLTALEEAQFEEPEGPKGFRREQMQQEFDISRVYRPRMLVRGPFGMGQQH
FT                   LAGAILHHFEGLHVQAFDLPTLLSDSTRSPEAAVIQLFQEVKRHKPSVIYIPNLQSWLN
FT                   TVGPTVISTLLGLLRSVPPSDPVLLFGVLESTGEEVDNGLLSNMFGFSKKNFYDLKAPD
FT                   YDARYEFFGRVIDYVKTPPSDFPDPENRKRRELETLEVAPPPPPKPAPPPTKEQLKAQK
FT                   KKDHQTLNLLKIRIQPIMDQIKKYKRFRTGVIDESQIRYLWEEDDPNIVTSDLPIEQRT
FT                   TFRPFEKAFDKHGVPGLRETVSGKFFYNMEIVTIEKRLSNGYYKRPKDFLADIKRLAKD
FT                   ARQLGDQERLLRANELLSNVEVDIATIEQAEPALVAECENVYLRELEREKLAAEQAKKA
FT                   AGEGGYSRLSATGNVPHGNTDSGPSSGPVVLGESFPDGQARPQTPTRRSAVSFLTNGYH
FT                   EGGGSDLNDLSNHATISNGSHESRGDGDGDGDVYMTNSEDHSGERETQGSSFGPSAQPR
FT                   PPYSHTAPSQQVRRESGFSSLSQKGPMTPMAPGSQPNDYTNEASTTQTTSDKKSSVQSS
FT                   VPQNLTQSPMAAHGLRHDFPDLTQYPDRVSQEEHLPDTQQPESSQPSPHPRESLPGHAD
FT                   FAAGESQSQPKHQPPVPLFEAPVKQPSHVPTALQSLLNNEDLSPKVSLEHELIDNLHNQ
FT                   LTQRTSGCSVEQLEQINSNLMDYIWRMRGEWNRNKVAAGIRDTFNEVLEDMQAMQEIGP
FT                   ISQRTKEQLGADIFHA"
FT   CDS_pept        join(951535..951621,952760..952886,952944..952999)
FT                   /codon_start=1
FT                   /gene_family="HOG000157293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264341"
FT                   /orf_name="AFUA_8G04280"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85197.1"
FT                   /db_xref="HOGENOM:HBG057650"
FT                   /db_xref="UniParc:UPI000051E640"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI7"
FT                   /transl_table=1
FT                   /translation="MLGLADGLQGSSRTGSTAKRQCARVRSSELAQYKTFASPFAKVFL
FT                   GAIFTYQVIYWTWLKLEMDESKLEKNQEVAALEKKARELTNVQK"
FT   CDS_pept        join(complement(955233..955933),complement(954914..955177),
FT                   complement(954104..954851))
FT                   /codon_start=1
FT                   /gene_family="HOG000157304" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264342"
FT                   /orf_name="AFUA_8G04290"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85198.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057651"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000051FE2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI6"
FT                   /transl_table=1
FT                   /translation="MGTRVMSNASPDHHPTDGSTSSSHVALGDPASFLGIQFGSDPAVL
FT                   PHDHSSILHPWLPCGSNHPSPSSLSPAPNYLEYYQYHTPQSFNHQDAWNPLQVTGVPLN
FT                   TSAFNLQPMGKPYQINDYIDRRRSTGQYSTPSENDSQYNGLASGDSGYGSRSCTTRSIA
FT                   ASSFAVDSACSPHLGPHEYELDDRTTTFDLGPSACGEAVEKTEQHNAPCEYEIKCDYPE
FT                   CNWKGKCPSDKRKHEARHQKLYKCDQPNCSRKQGFGTINDLARHKKCVHKQEPERGPKI
FT                   LYLCFGRNCPRRQKRWPRLDNFRQHLLRMHGDEDADELLKRSHEWYNSIKQASELTFAA
FT                   VDPVFKKTQSPEMQLPTEQDCVMEDLDQTPCIPAVAFESLIGARSPENEYRILNPIKDT
FT                   TEQERDQELADATLMAPSNTVQLPGYGTPNLDSALDQTPPIAHQDSKKNDYVEEFIVDA
FT                   ATNMINALTRIMNSNHRRHSQPAKDIDDPTSPSTELCSPKKKILQRILTAALDCLSEKP
FT                   QRSGDRTPKVPERDPDKKDWIQCGVCAKRTRLRCEMKLVLTFLSALSYSNMVA"
FT   CDS_pept        complement(958366..961929)
FT                   /codon_start=1
FT                   /gene_family="HOG000157315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264343"
FT                   /orf_name="AFUA_8G04300"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85199.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057652"
FT                   /db_xref="HOGENOM:HBG328856"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00005204E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI5"
FT                   /transl_table=1
FT                   /translation="MSTLSPQLVRSESPTDMGFPNANFSDPYLSAPLDPEQDVFKSSGI
FT                   RWTPEPGQHDLREASTSPYNHNVNSDTAQGAETAGYPTSYSDFLSPIDDFSSDLSAQAS
FT                   PNGDQPPGSINMELHSYLDAWPHEGSSSNMAVADEPRSVDSESAALSQPALVTSQLLTP
FT                   ERTNHPSPAPDLTNRRNNESQSHSEQILTIVTAPLDNNLNVHPPSDAARARSPIVTVES
FT                   YSRGDSPVRNTISVRRQPSQSTTHLSPGRESEDGDHNTSWQTSEQAIARAPDGSWLPDG
FT                   TTGQAGVAPTSRDDTYILSPNEVESRRRLEEKNADIRSWSATVSVAGSEDGDDGLHTRG
FT                   RKVPAGTRRRARSAGDPALQQDYFNLQFGAYGPVLPGPGALIHESSDEELSVNDSEVEA
FT                   SDPGSPAVSVNEARWARDGLADSPVQDQPNSADEEPAPHQFLATHPWKDADHDSTPRSV
FT                   RMQPSTASAAMMEYQRRAREIDAVSRYATWGTRPMSEIEVNSIIGAGGSFANLSISQDS
FT                   SKKHTRRSSLMKFFPRKPSISVLKRPLSDLSLVENQTTNNEIKSPPSRKDSFPHRKLSL
FT                   ARSPKSPSLSTGGAVIAIAGQMAAIGGRDSLSTVSPHSTSNPWNKFGRTRSRSEIPRSS
FT                   APGLLDLMTSHGGPPVPTIGHSQALTTDNHGLQQVASSRPVETGDDEEEDDDTGEKGQV
FT                   MDFPVPTRLPVPTTEGFKAQITQLNPRLEPALIDRLANEQVRRYKKLVEQKMNHTHAVS
FT                   KKSCSAGKFCFAQGGEAVILAARAEPHDSEATHTQFEITGHSGVDDEPLALGENAVTAA
FT                   QFPPGVPLPPVKRLPAEFECPICFKVKTFQKPSDWTKHVHEDVQPFTCTFPHCNEPKSF
FT                   KRKADWVRHESERHRKLEWWTCTVHDCHHTCYRKDNFVQHLVREHKMPEPKIKKTKTKG
FT                   VGPAAETQEESSREREAEQLWELVDQCHHDTSKGPREEPCRFCGNVCSSWKKLTVHLAK
FT                   HMEQIAMPVLALVQERHLFPNIDADVAPKAVSYPGSIAQEVTSFSPQLNGIKAEPEAPM
FT                   NFEAGQSEPPTGFLNPTYPPTSTTLHQGFLSAGPDVYTAYGSQAGFAGQQFVSLHQNSV
FT                   TYPPLLNTGSRPRITTQELSVLQNPYQLCSSPTDMRATYDPQGTLHMSPPPVENGQAYH
FT                   DQITQATSYSYDGSVGYSRQF"
FT   CDS_pept        join(complement(966053..968583),complement(964858..965755))
FT                   /codon_start=1
FT                   /gene_family="HOG000157326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264344"
FT                   /orf_name="AFUA_8G04310"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85200.1"
FT                   /db_xref="HOGENOM:HBG057653"
FT                   /db_xref="UniParc:UPI000051ED10"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI4"
FT                   /transl_table=1
FT                   /translation="MAGSGKKSKGKPGAKQKNKKGKNQETSENPSETPFAEKQDQQTHP
FT                   EIDSETPLDQEGQPLQAEVEAEPQPAESQGFESNVPLQSLPEPGPNHGQAPEQVPELEH
FT                   PQPVAATASAVTENWEDPQPSTNLDQEGISSQPQTLNDVQNILEATHESILEELAASGP
FT                   PTETAAVETNPEPNHGLSGQSDAAEPPEPTPVTAPQTPMFQEAAAACPLPSPSLTETEY
FT                   IAASSHSNAASPAPNPSPEAEAEVNLPNPQQEPTPPADQAVSPAPDPASSSRPLSPAPV
FT                   AASSEPPASSSVLQTASPALEADAFHSASPVNHPASPAFHTASPASKPSSPIPQSASSH
FT                   YRGASPAMANPASPVQRYSSKPASPLAKASSPLTRPYVSPAVSPHATPFGPPPPAPSVP
FT                   PSIAPGYATAYQSPAMSSAGYMPHYAPYYHHPSPNLRPTPRGSIDPHYVSAYQAIRDMG
FT                   LPNGHGVNDRGTISPPQEQHDEPLELLQRIQEAIPDINRLLDGYKNTKSKLAAREAEFK
FT                   QMETQHEQALMHKDFYIEALQNQMRKAANESAEEATKLKNTINELRMELGNLEEKRKDI
FT                   EESLAEAEKFNQELLQTKSELEGQVATLKTNIKEAQEAHEQELERQKEERAEALANQKQ
FT                   ELTELFEEIKAEDEKAAAEALAAREKELLDQQTTMKTEYEKEKQQLHEKHDALQSEFDS
FT                   KVTELESKEAELASTKEELDSKVAALESTKTELDAKVAELESTQAELISTKDALDAKQK
FT                   ELDQKEQRWTDERTELEARISAKCEELANCERENKKLEEDNLLKEQQLEHAVEGMRATI
FT                   DNLGKDCDRLRKTLHSLGEATDLKSTKGDSFLISKSSLDCFDQLSRLIVSLSKEHFTYL
FT                   PIDPPKDILSKIPPELPSFLDNTPASRELRSAYVQHVISKTLTYRIFQPFLFTLGRRYD
FT                   KADTFFQMLSMDIRRKSVRREAFWRQQTLKAAYTTSDAKQSINVVAAVIVDEIIDLIKH
FT                   FADPRHLDSLLIGVRKIVKLAAETWRLARVERELIIASLPAPDAEAVSNDSWDEYGAPK
FT                   ERNVSLGNDPSRHVILRTFPQITREAAHEDFAEDEEKASPCTYSRGIVLYSDSPVVMAR
FT                   LQELAKKSTETLASGEDSPRRGSRGSLRSVEVTAH"
FT   tRNA            complement(970485..970558)
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        join(971190..971402,971468..971712,971783..971939)
FT                   /codon_start=1
FT                   /gene_family="HOG000157337" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207687"
FT                   /orf_name="AFUA_8G04320"
FT                   /product="NADH-ubiquinone oxidoreductase 178 kDa subunit,
FT                   putative"
FT                   /protein_id="EAL85201.1"
FT                   /db_xref="HOGENOM:HBG057655"
FT                   /db_xref="HOGENOM:HBG328851"
FT                   /db_xref="UniParc:UPI000052074D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI3"
FT                   /transl_table=1
FT                   /translation="MSGEPPSGGFQPQIIWRQHHHHKLVLPIVFPHNMSFARQSVASAR
FT                   QLLRNQQPRRFASHAAHAEPVNESFGRSFYVTIGAFASAYVLYRLSKSAEESGSQSWIS
FT                   NLIQKWTPSEKLFEERNAIHTALMEKAAQDRHLLQSQGPRATFELKQPEVNFNTSPPYN
FT                   VPAGSSVDLSAVVAHYEQQNKQMEEARVARMKDGKVVSLYD"
FT   CDS_pept        join(complement(973341..973502),complement(972895..973191),
FT                   complement(972172..972822))
FT                   /codon_start=1
FT                   /gene_family="HOG000157349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056395"
FT                   /orf_name="AFUA_8G04330"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85202.1"
FT                   /db_xref="HOGENOM:HBG057656"
FT                   /db_xref="HOGENOM:HBG395766"
FT                   /db_xref="UniParc:UPI000051E64F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI2"
FT                   /transl_table=1
FT                   /translation="MTSAFSFGFSGDDIDIDEDDLSGIDERDMNAVEDASKQLTGRLME
FT                   PQRHDMGEWISTLPSQISYNKLVINAYHGEERTFTLARREVFDIRTQLMAEDSADHENE
FT                   ELISGLEEGDIKPNFYEGGFKTWECAVDLAKLVASEDLSHQDKDQHIIELGAGTSVPSL
FT                   TLFAQALRRPDSATNKIHFTFADYNSAVLRLVTLPNLLLTWNYIVMHRDPPSAEDTSPR
FT                   DQPDEEELDITPELLESFQKDLANKKITFEFISGAWSSAFVDLVFSSYGQGKGKTLILA
FT                   SETIYSPASLEPFSETLIALLRRSETEQERSKALIAAKKVYFGVGGGVDEFLMVLKNVN
FT                   GYDLDVEEQVNINSEGVGRVILKITLRST"
FT   CDS_pept        join(complement(975383..975505),complement(975226..975311),
FT                   complement(974712..975159),complement(974078..974659))
FT                   /codon_start=1
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264345"
FT                   /orf_name="AFUA_8G04340"
FT                   /product="Cystathionine gamma-lyase "
FT                   /EC_number="4.4.1.8"
FT                   /function="cystathionine beta-lyase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="EAL85203.1"
FT                   /db_xref="GO:0004121"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000051F94E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI1"
FT                   /transl_table=1
FT                   /translation="MTASSNGHAQNGEGAQDRRFGTLAVHAGSPHDPTTGAVIAPISLS
FT                   TTFAQTSVGNPVGLYEYTRSANPNRDNFEQAVAALEHAKYALAFSSGSATTATILQSLA
FT                   AGSHVVSVSDVYGGTHRYFTKVASAHGVHVTFSPCIEVDVEALIRPGETKLVWIETPSN
FT                   PTLGLVDIRNVAAVAHRHGIIVVVDNTFMSPYVQNPLDHGADIVVHSVTKYINGHSDVL
FT                   MGVAAFNSDALKDRLTFLQNAIGAVPSPFDCWLAHRGLKTLHLRAREATANATVVAKAL
FT                   EASPHVISVNYPGLDSHPHRAIAIKQHRQGMGGGMLSFRIKGGQKAAHLFCQYTKVFTL
FT                   AESLGGVESLCEVPSSMTHAGIPKDQREAAGVFDDLVRMSCGVEDAEDLKADTLQALEK
FT                   AVLASQQLENGSS"
FT   CDS_pept        join(complement(976829..976944),complement(976593..976770),
FT                   complement(976487..976531))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264346"
FT                   /orf_name="AFUA_8G04350"
FT                   /product="DNA-directed RNA polymerase III subunit 22.9 kDa,
FT                   putative"
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="EAL85204.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG057657"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI0000520290"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCI0"
FT                   /transl_table=1
FT                   /translation="MQLLQARGHHAHANTKAVGVEFFNDILIPPDLLLDGARFDIADQV
FT                   WVWENEDGSTFYFDIGEIVRFRVEMEEWHDQIPNAPDLGDGTTIERKPPYSIIGSMQMA
FT                   GLGPVSWW"
FT   CDS_pept        join(977937..979823,979902..980087)
FT                   /codon_start=1
FT                   /gene_family="HOG000157371" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056396"
FT                   /orf_name="AFUA_8G04360"
FT                   /product="CCCH zinc finger protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85205.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057658"
FT                   /db_xref="HOGENOM:HBG328850"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR019496"
FT                   /db_xref="UniParc:UPI000051F940"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH9"
FT                   /transl_table=1
FT                   /translation="MSSQGFSFPPPPPPPPQQQQPPQSTIPSGPPQYGYGSYGQRGGRG
FT                   AGGHNRGRGRGFGNRGGQGGSFVTHHANHTPTYSSTPSSFGYGSINYTGFTPQSQPTGS
FT                   CNNPSPHIASLGSPSFQHQSNTSSYASPQRFSQPPVVLGSPYQPQPSYDTAYAPSNAQS
FT                   SLPYPPVMHSSQHTPQPVQAPMMSPPMRWGFEASPPTGTFASPRRSNQWTPRQSSTHQN
FT                   QSSSNGNSMKHGGKRDHASAFGGKPPTVAPSVPAPPPVPSFGNPLPVKPPPAVDAANPR
FT                   KKKRKHNQLGLTPKTEDHESSEEDDVDEESRLAPAAASAIVPLRFTYKGRTSTLQSPTD
FT                   IAAWIEERKKRFPTQAKAEEKRKAMQEAKKAREEALNKKRIERQEQRRAQKVANDRPES
FT                   VIDPADAAAKAKRKADKLQRKLLKEQERVAKAEADAERARLEVERLQKVAMEARRGSES
FT                   ATQKTEIQPSVAAEKPDPESGQKVEMVGSKDNNSEAVAVPTESSIASMAHGTVVTKIEP
FT                   GDSVESRNEESAASSFDDSDSSDWTSSSGSDISSDSDESDDDSAPEEVSSRREGPERVA
FT                   PPPRVNKKKVCRHFARNRRCLHGEKCHFLHELPERGPKTKSVEKKGRRGLFQALLERQK
FT                   EDEDRRAMEVIVWLGENGFLEAPEAEERASGHSHSDGNKDESRDSQETKDTVAAV"
FT   CDS_pept        join(981544..981757,981817..982268)
FT                   /codon_start=1
FT                   /gene_family="HOG000157382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751085"
FT                   /orf_name="AFUA_8G04370"
FT                   /product="GPI anchored protein, putative "
FT                   /EC_number="3.1.1.5"
FT                   /function="lysophospholipase activity"
FT                   /protein_id="EAL85206.1"
FT                   /db_xref="GO:0004622"
FT                   /db_xref="HOGENOM:HBG057659"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI00005204DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH8"
FT                   /transl_table=1
FT                   /translation="MRSIIFLSLSALAAIAAAASKENPFNIPANGYQFTAGEPTTLSWE
FT                   PTTSGTVTLKLQWGDVFTPDSGSTIVSSIPNSGSYTWNVPSSIASRPDYTIEIISDDDT
FT                   SETNYLNRFMIAGATGVASSTATATATTSKTASTTSNSTTTSGTPTMTTVTSTTASSSS
FT                   SSSTTSSSSTTESSTTTTQASRTTATTSPTSVPDPNGGAINRISGGMMALVMGVIAFM"
FT   CDS_pept        join(complement(984993..985156),complement(984660..984942),
FT                   complement(983787..984563))
FT                   /codon_start=1
FT                   /gene_family="HOG000051226" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751086"
FT                   /orf_name="AFUA_8G04380"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="EAL85207.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG169068"
FT                   /db_xref="HOGENOM:HBG328848"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520291"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH7"
FT                   /transl_table=1
FT                   /translation="MNPPQKCAAVVVGAGPAGLAVVGNLLERQLGGKIAWVDPYFQAGR
FT                   VGRKYREVPSLGGRSLRLTVRVLSSNTKVSFFQAYATGVQPFRAVISSTRMPNAFTTLA
FT                   KLDQDQTCLLQHGADMVQALTEGIVKSDRVVQCKGYVVAANLAEKTSSWTVRIKSQGSS
FT                   DEFEVETPKLILCTGSSPTTAPIPVPAHNIQRLDLDIVLKPSELASYLPRDTPLTIAVV
FT                   GASHSAVLALLNLVDLARSSHPQLRLKWFTRHSLRYAEYMDGWILRDNTGLKGLAADFA
FT                   RQQLEDEVLPTSEAGRFITKVDCSSGKEMAQFKLQLPFCTHIVQAIGFTRDPLPELSVN
FT                   GSPLQPDFDHETGGFYDQRGRLVKGLYGAGIAFPERTVDPHGNVEYAVGFFKFMKFIKR
FT                   VCPQWVAA"
FT   CDS_pept        join(complement(987083..987412),complement(986431..986976))
FT                   /codon_start=1
FT                   /gene_family="HOG000157404" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264347"
FT                   /orf_name="AFUA_8G04390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85208.1"
FT                   /db_xref="HOGENOM:HBG057660"
FT                   /db_xref="HOGENOM:HBG328845"
FT                   /db_xref="UniParc:UPI000051E89A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH6"
FT                   /transl_table=1
FT                   /translation="MMFPSIMRRFRSPRQPPFNDSDDTSPSSSEPAQDTALDIFYPGVF
FT                   DVFKVRYILRWKITSEGLPMEIVDMIMEAAEYWPSIEARMDTRTIIRQDHDRELLRTAP
FT                   LCYDEVTLGSASPGVLPHQTVHPCRKIVFRILSHDQGWGGGPRGESPYDGSYTWFDVEV
FT                   IHATPQKGSDQTNSQASTQSTGQGERQEPIGPQHSHFLPGPGRVQMNKTAVSQTQEYTI
FT                   TWHYLDKIQAESTDAEEIERSQGRGRATLDGSVVRTLGVGDSIAVWGRARFPGWSNHVE
FT                   FISVRVFWAM"
FT   CDS_pept        join(complement(989730..989855),complement(988182..989672))
FT                   /codon_start=1
FT                   /gene_family="HOG000157415" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264348"
FT                   /gene_name="nop12"
FT                   /orf_name="AFUA_8G04400"
FT                   /product="Nucleolar protein 12 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL85209.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG057661"
FT                   /db_xref="HOGENOM:HBG328844"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051F491"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCH5"
FT                   /transl_table=1
FT                   /translation="MGKKSKAQSDNVSQPGKTDVTLPFLGGKAAIDPTVASLFEKSAGP
FT                   VKAPSVQPIITQRKENGPEDDVEKEEDDEEISELEEDLQSEDEDMQDVSEVAGDAERTL
FT                   AVDTQAPSSKKRKRAPAEDLEETYMRRIAKEEQKEQEKRRAEKAKRQKVEEGGKDSDPV
FT                   SDKSKDGRDESSEEEDEITVPRHETQSGDPESKELEKSNRTVFLGNVSSQAIKSKSAKK
FT                   TLLKHLASFLSTLPESTGPHKVESIRFRSVAFASGGKVPKRAAFARREILDDTTPSTNA
FT                   YVVYSTVQAARKAPAALNGTVVLDRHLRVDSVAHPSQIDHKRCVFVGNLDFVDNETDPE
FT                   EDDKKKKKKKSGPADVEEGLWRTFNAHTKGSKERASTRGNVESVRVVRDRTTRVGKGFA
FT                   YVQFYDQVCVEEALLLDGKKFPPMLPRKLRVTRAKKLPKKRDGPETGSHGKALGEGFST
FT                   LQGRAGKLFGRAGAAKMKAEGRKSISGNSVVFEGNRASEGSSRIKIKTKSRGSKGKPKN
FT                   RSAKRAAAYQAAGGRKGKMAK"
FT   CDS_pept        join(991594..992467,992529..992607,992669..993920)
FT                   /codon_start=1
FT                   /gene_family="HOG000157426" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056397"
FT                   /orf_name="AFUA_8G04410"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85210.1"
FT                   /db_xref="HOGENOM:HBG057662"
FT                   /db_xref="HOGENOM:HBG328843"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI0000520297"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH4"
FT                   /transl_table=1
FT                   /translation="MEVAASRDSAPVGPPTGPDATITNGDQDLLLDDSLMDDGRSSSLS
FT                   DIDDVLDNEPSDYEESPKPEKLAAENDSEAETERIEDSPNHFRRTNIVVSSYGPSPSKL
FT                   AQSTTYDDAVDGDDQIEDSPSKPRSKPNGILESAEDILGLEDSTLSEGTGKKRKRPESG
FT                   ADVEGETGDEGEPPQKRRGSVKSELSDPPADDSALSPEPIEEVIKANEEDNPADDLPES
FT                   DLPTAPAKNRKGKKGKRKGRKTRDTADDDMDSGALETGAEGPVDDGDDENIERGEDADD
FT                   GEAAAKLEEESSEAAKRMSAMESLAILEKEFAALRDKIYDERISKLNRELEMLTGPNPT
FT                   HPEYLRQLECVKRHRDAKIKYEHTLFQYRIQALMNKSLAERAQTHSTYFQRIRDIREKH
FT                   SSAVSKHFYAIQHDRFKSEELSAQHYIPFPTRRSQQIAHQTAYNQEVSIMAGVAKYVGF
FT                   PAAPSLAPARPSELEEDMEKMGVSLILRTCFAYLELTYMSGQISFETRAPTSQPSTNLP
FT                   RGAMPSMSSNAFRTAAEEAFLEQTPWANPQHPIHHHHHHHHQQHHHHHHQIQPGPHSRV
FT                   FENPHASSFTTPAAQKRVVDINAPNGSASTIAENLSAANSSANNTPYGAEQDHQRHGLA
FT                   HFGVPDYDADRKSGYRSLSSSPLDVRKPHPAYATLDHRASQATSSRNPPFSPQPARVGL
FT                   FQSNASKHDSSPPLSSKQVNSMHPSTGILTGSGSSHMTAR"
FT   CDS_pept        join(complement(997154..997494),complement(996388..997014),
FT                   complement(995984..996332),complement(995145..995925),
FT                   complement(994679..994884))
FT                   /codon_start=1
FT                   /gene_family="HOG000157437" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264349"
FT                   /orf_name="AFUA_8G04420"
FT                   /product="MRNA cleavage and polyadenylation specificity
FT                   factor complex subunit (Pta1), putative "
FT                   /protein_id="EAL85211.1"
FT                   /db_xref="HOGENOM:HBG057664"
FT                   /db_xref="HOGENOM:HBG328842"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="UniParc:UPI000051F6E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH3"
FT                   /transl_table=1
FT                   /translation="MSETAANHLADQVAQLNAARNLVLGDAAFYPQIVNGIIPIIGAHA
FT                   RLELRRWGAEFLAETFASPALATAQKEQLAGRVLQTIREIIELPEGDTPVLKHIVQIAA
FT                   SLYPLAFRHIINHPEDSALWENMMAVKQDILRKWDSSPYPVKVCCIKFVQRVVQVQTHG
FT                   PIADPRVCVQPSDYSVNKTWLLLTISSGPSIMKRPWPSFPKITPFWLYPISRRKPLACS
FT                   TGCCRFSKKTPGTINNFRSHTAQCASSLILSCSDPLLVNATLNCLAVLIRNRQSVGNKI
FT                   INAVLNFYPAKQVRSPLTPAIRIGVKSMERTARALFVNILKKNPSHPLAGKMQHHMERL
FT                   MQSRLETIDDASKKRGLPFEPTDGLDNAKRARLDAETPPLIKIPPLPPGPVSYAQLYTL
FT                   TEDSGLSSFDVKQLPPDLLVKIAVPVLARVDPSALMQAVEGVRARYQTLTRQQAAKPQV
FT                   VVPEDEDDDYEPEYQPTDVAVAAAPQADVVSADMAELQPDLVSLGPFVLPQPPPLTEEE
FT                   AADIGRSAVGRVFEMLTSAAMAPNPTKGKAQQHLGFSRLAGSTFDRDAWVTLLTRLATR
FT                   APATLEVDDKKTESDPRARKTPAISNFIRESLYRYILEDFRARVNVGIMWLNEEWYNDR
FT                   IQMKFAATQRTEEDEASIPLHYDQWVLRLLDGFLPYLDSRDTKIFIRFLSEIPEVTIPI
FT                   TKRVSRKILAKWRPHVVEQQQQQQQQEQSEQQEQISLASRSVPAESTAPPADDGSAPAP
FT                   ADSSIQPQVSASET"
FT   CDS_pept        join(complement(1001736..1001865),
FT                   complement(1001635..1001658),complement(1001467..1001547),
FT                   complement(1000785..1001378),complement(999598..1000729),
FT                   complement(999263..999533))
FT                   /codon_start=1
FT                   /gene_family="HOG000157471" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264350"
FT                   /orf_name="AFUA_8G04430"
FT                   /product="Oligosaccharyl transferase subunit (Stt3),
FT                   putative"
FT                   /function="oligosaccharyl transferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85212.1"
FT                   /db_xref="GO:0004576"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG269471"
FT                   /db_xref="HOGENOM:HBG314442"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniParc:UPI00005204DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH2"
FT                   /transl_table=1
FT                   /translation="MAETPVDVLLKGKTGRNTRGLLRIIILCTIAAAAVASRLFSVIRF
FT                   ESIIHEFDPWFNFRATKYLVQNGFYSFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGVIY
FT                   HILRFLTIPVDIRNICVLLAPGFSGLTALAMYLLTSEMSPSPSAGLLAAAFMGIAPGYI
FT                   SRSVAGSYDNEAIAIFLLVFTFFLWIKAVKNGSIMWGALTALFYGYMVSAWGGYVFITN
FT                   LIPLHVFVLLCMGRYSTRIYISYTTWYALGTLASMQIPFVGFLPIRNSDHMSALGVFGL
FT                   LQLVAFAEFVRSFVPSKQFQRLLTAMIFITFGLGLLGLVVLTVTGVIAPWSGRFYSLWD
FT                   TGYAKIHIPIIASVSEHQPTAWPAFFFDLNFLIWLFPAGVYMCFRDLKDEHVFVIIYSV
FT                   LASYFAGVMVRLMLTLTPIVCVAAALALSSILNTYMATTLPTPASEAKTNEDSSSQPLR
FT                   SVRKPNVGITSHVSKIIVTASVVVYLLLFVAHCTWVTSNAYSSPSVVLASRMPDGSQYI
FT                   IDDYREAYYWLRQNTPQNAKIMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMS
FT                   SREEVSYPILRQHDVDYVLVVFGGLLGYSGDDINKFLWMVRIAEGIWPDEVKERDFFTA
FT                   RGEYRVDDGATPTMRNSLMYKMSYYNFNSLFPSGQAVDRVRGSKLPTEGPQLSTLEEAF
FT                   TSENWIIRIYKVKDLDNLGRDHNQAVAFDKGLKKKRSTKRKGPRVLRTE"
FT   CDS_pept        join(1002275..1002471,1002534..1002715,1002775..1003046)
FT                   /codon_start=1
FT                   /gene_family="HOG000157472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264351"
FT                   /orf_name="AFUA_8G04440"
FT                   /product="COP9 signalosome subunit 8 (CsnH), putative "
FT                   /protein_id="EAL85213.1"
FT                   /db_xref="HOGENOM:HBG057665"
FT                   /db_xref="HOGENOM:HBG328837"
FT                   /db_xref="InterPro:IPR019280"
FT                   /db_xref="UniParc:UPI000051EF8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH1"
FT                   /transl_table=1
FT                   /translation="MDLPPLSREQLSTVLATASSSSALYETLSQYEGHACFLSTSNSEE
FT                   AELLSLFYSSFFFSHLLLDDIYEARAMTKRMPQDLAQNDATLQNCLRLLRAVWQRKYEY
FT                   VYKVLRDLPWPEMLKPTVRNYELHFQEKTLKEVSRAYEAIRPDAAANYLGLDVTAAKQG
FT                   DPAIISKFTACGWRWDEQNGLLYPQPIITAREKIGHSSNGLSEVMALMGSHSG"
FT   CDS_pept        complement(1003129..1003281)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207688"
FT                   /orf_name="AFUA_8G04450"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85214.1"
FT                   /db_xref="HOGENOM:HBG057666"
FT                   /db_xref="UniParc:UPI000051E649"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCH0"
FT                   /transl_table=1
FT                   /translation="MCGLSGFAAHLLSPGTINYFVQVVCDVASHRACVGAGSHRNGAVR
FT                   VAGGH"
FT   CDS_pept        join(1004354..1005361,1005417..1006544)
FT                   /codon_start=1
FT                   /gene_family="HOG000116383" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751087"
FT                   /orf_name="AFUA_8G04460"
FT                   /product="Dynein intermediate chain, putative "
FT                   /protein_id="EAL85215.1"
FT                   /db_xref="HOGENOM:HBG354169"
FT                   /db_xref="HOGENOM:HBG446681"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00005204DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG9"
FT                   /transl_table=1
FT                   /translation="MSSVQQRKAEILAKRAKLAELRRQRELRQKEFSQSRASTGGDASE
FT                   VCYPSHEHEIHKPDTDVPSAKVVSPVPSRSDSRAELDDLIARLVDRPGSASVSHADGPS
FT                   RKGSRPNSVLSASQLSGDNAEAFNSATRPLSQSIAVQTDATDPFVASTEPAPAPEPKRE
FT                   VVTYSKGVQTDDSKQRQTDSLDSESETGEFDDGTGPSKRLSKSDREHDEEIRRKLRREI
FT                   EEELQATQQQAAGGPSAQANLRYPLRTLDEDELKAVTSSEDFLDFVERSAKVIERALDE
FT                   EYDVLADYELGGVDGDLEEDDEHGRKRKSIREVCQFFDERWSKKRMISDLSFSPKFPEL
FT                   VLAAYTKNPSAPHEPDGLVQVWNQHLHSRPEYVFHSTSDILTAKFSPFHPNLIVGGSYS
FT                   GQVLLWDTRSSRAGGGAPVQKTPLTGSGHTHPVYSISIIGTQNAHNILTASTDGVVCGW
FT                   TVDMLSQPQEYLELSTPPPSKTEDLAPTTMSFPQSDPTFFIVGTEEGGIYPCHRYDRAG
FT                   AKAGTDQRLAYRGHAAPVMSTAFHPAKGPVDLGDLMLSSSLDWSVKLWRVRPPATTAPA
FT                   TSAAIATTQVVSPILDLNREDVVYDARWSPHRPGVFSLVDGAGNLEVWDLCSDTEVPVV
FT                   RTTPTRGRGGILTRSLNKVAWEEREGKRLATGGLDGVITVFEVGKGLSGTPEEVPSDEW
FT                   TAMKRLVGKLEQRDRVN"
FT   CDS_pept        join(complement(1007526..1008533),
FT                   complement(1007104..1007472))
FT                   /codon_start=1
FT                   /gene_family="HOG000157494" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264352"
FT                   /orf_name="AFUA_8G04470"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85216.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="HOGENOM:HBG328832"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051F941"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG8"
FT                   /transl_table=1
FT                   /translation="MTERCHPVDDSSAEKMTSAPDTVKEAALLVVTEGQPNIQNVSEEE
FT                   YTAMERRIRLKVDMRLCTIAGILCSLNLLDSGILSSASVTSMFEDLDLRGSRYSVSIFI
FT                   FTIASVVAQLPCTVAVRLVGPRVWFALITFCFGLITLCTAFIQNWKQMIALRVLLGFAM
FT                   SGIYPGLTYLISTWYTRTEQQLRFAFLQSGEVLALATGTIVNYALNRLDGKAGLRGWRW
FT                   MFLVQGLITCVLGIITYWWMVDFPEQSHRSFCFLSKTEAKVAAQRIQTDRDDVVPEPFS
FT                   WRKILVNFLDPKLYGFACLFFLLNLVSTSLNYFLPIILQSGMGFSSSQSILLSTPPYYW
FT                   SVIPVLITSFISDNYRVRGPLITFNALCVVVGFLMFGLPSSTEVAVRYIGTFLATGAYV
FT                   SNWAALSAFMANNVVGQWKRATTAAAVAACNGLGGVAGSYIVRQQEAPQYTTAVWVSIG
FT                   "
FT   tRNA            1009806..1009879
FT                   /gene_name="tRNA-Val"
FT   tRNA            1010165..1010238
FT                   /gene_name="tRNA-Val"
FT   tRNA            1011735..1011808
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        join(1013856..1013972,1014025..1014257,1014281..1014447,
FT                   1014497..1015285,1015334..1015581)
FT                   /codon_start=1
FT                   /gene_family="HOG000178887" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056398"
FT                   /orf_name="AFUA_8G04480"
FT                   /product="Hexose transporter protein "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85217.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG190581"
FT                   /db_xref="HOGENOM:HBG327399"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000052029E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG7"
FT                   /transl_table=1
FT                   /translation="MPSSSTFELAGRQFPRVTWYKDPGMRKTYICLMFVVLTAATNGYD
FT                   GSMMNGLQTLPHWQEYFKHPEGSMLGILNAIMSLGSLAALPAVPYTADILGRRMGILIG
FT                   CLIMYAIEVVVLGILGVVLQSISANYGMFLAARFLIGFGVAIAHGASPLLITELVHTQH
FT                   RAIFTTIYNTTWYLGAIVAAWLTFGTNNIDSNWSWRAPTVVQAAPSILQIVFVWFVPES
FT                   PRFLIYKGKDEQALKVLADCHANGNQQDEVVQLEMQEIKETIRLEKEFESSSWMELVRT
FT                   KGNRHRLIICITAGFFSQWSGNGLVSYYIAKILTSIGYTSSVQQNLINGCLQILNMIVA
FT                   LTMCFFVDKIGRRKLFLVSTAGMLVAFVVWTICSARYAIAGNHNAANAVIAMIYLYYVF
FT                   YNIAWSGLLVGYTVEILPYSIRAKGMTVMWLCIDLALFFNQYINPIALENLGWKYYIFY
FT                   CVWLGVELTVVWFFYIETRNTPLEEIAKYFDGENAIVGGVAGTEKARELKNTLHIEEVS
FT                   "
FT   tRNA            1016439..1016512
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        1017246..1018391
FT                   /codon_start=1
FT                   /gene_family="HOG000157505" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056399"
FT                   /orf_name="AFUA_8G04490"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85218.1"
FT                   /db_xref="HOGENOM:HBG057667"
FT                   /db_xref="HOGENOM:HBG328831"
FT                   /db_xref="UniParc:UPI000051F6E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG6"
FT                   /transl_table=1
FT                   /translation="MVELISPPDPHTLLPPLLACLPTAFVSTRPPPVLLPLLSPILRQR
FT                   VQILSSVSTSPTESWLRLLCWDSEKAERLQALVDGADFESHPVSGEIELPEEVHVAYKR
FT                   VDEETLHSRILLPEYGLKAIYLWCRSDQDGGGPGWRVAELMPHEGGAENDGVWSFSIGE
FT                   ANAQAKEQMLEDALREAERDQKVAPHTQEKNDEEDDDDGYWARYDATPGRTPSVKTPAP
FT                   NQLSSLHRQDTSEASYFSRYADVQPAMDNHDPSEEQSEVGPTSLNGDMLASLLRQQLNN
FT                   SSLEESVNGYANGTIADETAAMSLDHPRPSSTSSTASEAAVAKLEQEAEHQSACEVGVK
FT                   QHISSNIKSLFRLAKITGISRAEFQSLVKTELELLNLSDEE"
FT   CDS_pept        join(1019076..1019321,1019387..1021031,1021091..1021542)
FT                   /codon_start=1
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056400"
FT                   /orf_name="AFUA_8G04500"
FT                   /product="Mannosyltransferase PMTI "
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85219.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG328830"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI000051F489"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG5"
FT                   /transl_table=1
FT                   /translation="MSSSPSSSLRKRGGRKEAYSPLPSDDASSPLSSSKPSVASTNQSG
FT                   WDYRLALVVLTILAFITRFYKISYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLL
FT                   FAFMGWLIGYDGHFLFDNIGDSYIDNKVPYVALRAMPATLGALTIPVVFLIMWESGYSL
FT                   PACVLAAGLVLFDNAHVGEDRLILLDASLVLSMALSILCYVRFYKLRHEPFGRKWWKWL
FT                   LLTGVSLSCVISTKYVGVFTFVTIGAAVLVDLWNLLDINRPSGALSMAHWTKHFAARAF
FT                   ALIIVPFFFYLFWFQVHFAILTRSGPGDDFMTPEFQETLSDNLMSAQSIGIQYYDTITI
FT                   RHKDTKVFLHSHWEKYPLRYDDGRISSQGQQVTGYPFNDTNNHWQILPSVPYPETDRQG
FT                   HSVKNGDIVQLRHVGTDTILLTHDVASPYYPTNQEFTTVSHELANGERHNDTLFEIKIE
FT                   NGKPQQEFRSLSSHFKLIHVPTRVAMWTHTTPLPEWAFKQAEINGNKNILQTSNLWFVD
FT                   TIESLEENSPRAIKKERQVKHLPFWRKYLELQRAMFFHNNALTSSHPYASEPFQWPFLL
FT                   RGVSFWTKNDTREQIYFLGNPIGWWIASSLLAVFVGVIGADQLSLRRGVDALEEIWGRG
FT                   ARSRLYNSTAFLFLCWAAHYFPFWLMGRQRFLHHYLPAHVASCMVAGALIEFIFNLQPI
FT                   SVARAVKEDDPTGKSKAHGSAGHFVTAKERMGRQSLIAGWVATLVILSLTIWGFCFFAP
FT                   LTYGTPGLDVAGVNARKWLGYDLHFAK"
FT   CDS_pept        complement(1022022..1022930)
FT                   /codon_start=1
FT                   /gene_family="HOG000248360" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264353"
FT                   /orf_name="AFUA_8G04510"
FT                   /product="Pirin, putative"
FT                   /protein_id="EAL85220.1"
FT                   /db_xref="HOGENOM:HBG199391"
FT                   /db_xref="HOGENOM:HBG518911"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051F210"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG4"
FT                   /transl_table=1
FT                   /translation="MAVPRAIRQVFLAIEKAEGAGARVRRSIGTPKLRNFSPFLMLDHF
FT                   TIGRGAGFPDHPHRGQETITYLLSGGVDHEDFAGNKGTIGPGDLQFMTAGRGIMHAEMP
FT                   RENPDGSPNVGLQLWVDLPKELKMCEPRYRDLRASEIPVVEVDDGRVTVKVISGQSHGV
FT                   DSVRDLAYTPVWLLDMTIRPGGRISQPLPEGWNAFAYTLAGTTIFGSNDATRVVKEFHN
FT                   VVFDQAGGYVEASVPDNAESESRFILVAGQPLDQKVVQYGPFVLTSQEEVYQAMLDYQT
FT                   ASNGFERVRGWESEIGKRMTY"
FT   tRNA            1023658..1023746
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        join(complement(1028102..1028299),
FT                   complement(1026502..1027924),complement(1024539..1026424))
FT                   /codon_start=1
FT                   /gene_family="HOG000157527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056401"
FT                   /orf_name="AFUA_8G04520"
FT                   /product="Cytoskeleton assembly control protein Sla1,
FT                   putative"
FT                   /protein_id="EAL85221.1"
FT                   /db_xref="HOGENOM:HBG057669"
FT                   /db_xref="HOGENOM:HBG396086"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007131"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI000051E3E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG3"
FT                   /transl_table=1
FT                   /translation="MGFLGVYKAVYDYQPQGEGELELREGDLLYILEKSVEDDWWKAKK
FT                   KAERDDEDEPEGLVPNNYVEEAPAISHAKALYDYTRQTDEEVSFSEDAELVVYDTSDPD
FT                   WTLVGVNGDFGFAPANYIEVQEGDTSTARPSLPSPAAVEPSAPALPQRPVEVPTQEPVA
FT                   PASTRSPIDTIQNPAAAAIADIIHKQHASPVESEPSRDIPPPQTQRPSQRPEDSYQREP
FT                   SPPPPTLPQRPPSQQISPPVDRYSPPEPSPPLRPQHATVREQDGQGHVRESPPYNRIGQ
FT                   STPRSPSGYHLYNINEMVEVMGKRKKMPTTLGINIATGTIFISPEGDGDMQEWTADRLT
FT                   HYSIEGKHVFLDLVRPSKSIDFHAGAKDTAREIVSALGEISGAYRAEGLKEVIAAGAGG
FT                   GGKKKGQILYDFMAQGDDEVTVAAGDEVVILDDTKSEEWWMVRRMKNGREGVVPSSYIE
FT                   ITGFVSSQPTGVESGLSTVERNRLEETRLAKEAMRKSRTDSIDSRTSEVSCTVKLPYQT
FT                   TVTLVRENTDNLEQHKKRDSKSAKPDPTKTRLWTDRTKSFTVEAQFIGLQDGKIHLHKT
FT                   NGVKIAVPIPKMSIEDLEYVEKLTGVSLDEDKPLSDIRRRAQKSEPKSEANRAGASVGP
FT                   EYDWFDFFLKAGVGPHQCERYAQNFIKDSMDEAILPDITSENLRTLGLKEGDILRVMRH
FT                   LDNMFGRTGSKSKLRNVSFGGEEVISNGEAGSPGGLFSGPGGVLRNNTRKGRPAPAVQT
FT                   GDVVDPKAFEQKEDAPNPQERTGTPPASAAVEKPVQRGFDDDAWEVKQPKQPASSAPPS
FT                   SSPPPATAPPATTQAPVQKQLTGAMADLSLLQAPLQPTPAQPAPAPTSQASQAASSPAA
FT                   IQPQPTAVPAPQMQPQQTGATPGFFTQVAQIAQQPMQTGPQTFSPQQTGFQQASRQRPQ
FT                   PPQNMAQSSLLPPPPQRPLSAPQNFPQQPSTFGPPPLQPQLTGLPQPGPQIAPPGQSLA
FT                   ELNQQRFNPSLQPQPTGFMPQGQFAGGLVAQPTGFQPQSQFGIQQLQQQQTGFQGLAPQ
FT                   PTGFGGYQPQLQPQQPMPTGINSILPPALQPQPTGMNGASSMPYTVTSPPPVPPIPQQP
FT                   TAAPLQPQKTGPPPPVRFGVKHDAPKKLTPQPTGLRANLAQASEFSPLPRRAILPPFGQ
FT                   GH"
FT   CDS_pept        join(complement(1030895..1031011),
FT                   complement(1029365..1030810))
FT                   /codon_start=1
FT                   /gene_family="HOG000157538" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056402"
FT                   /gene_name="yos9"
FT                   /orf_name="AFUA_8G04530"
FT                   /product="Protein OS-9 homolog "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="EAL85222.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="HOGENOM:HBG057670"
FT                   /db_xref="HOGENOM:HBG328829"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR012913"
FT                   /db_xref="UniParc:UPI000052005B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCG2"
FT                   /transl_table=1
FT                   /translation="MIRRIRTLTPLLVLACAGSGAWASKKAFNIQDDLLAYPQFQVFFP
FT                   DEYILDARARELLQNQQESSSASADKTFSEGNDAQVYLGSRKDQSEDVNKETIEGSGFT
FT                   YEEMLLEGQRYLCSIPQVDNGNRDQTNGAESTSKEDEQREIARATDRGLELLREMEGKC
FT                   MYYISGWWSYSFCYKKQIKQFHALPSGPGVPNYPPIEDSTTHSFVLGRFPNSGDDEDLE
FT                   GDAEHKKTTTDVAELQTKGGSRYLVQRLGGGTKCDLTGKDRKIEVQFHCHPQSTDRIGW
FT                   IKELTTCSYLMVIYTPRLCNDVAFLPPQQDEAHAIECREILSEEEVSDWEANREYHLAQ
FT                   QLVESAITPEFPVVGDIEVGAHKWVGSEGKQIEKGRVASIGEEKIEVVAKRQNGEITRL
FT                   SKEELKKYGLDPEKIETLKSRLEELAKGKDWTLEIVESNGERGLVGTVDSNDDEKEDHA
FT                   AQGSISQPAQGTTADKGESNAETGEEKKKADEKIDHYEPEKSGPTTDDADDGSEEIFFK
FT                   DEL"
FT   mat_peptide     join(complement(1030895..1030942),
FT                   complement(1029368..1030810))
FT                   /product="Protein OS-9 homolog "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCG2 "
FT   sig_peptide     complement(1030943..1031011)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCG2 "
FT   CDS_pept        join(complement(1031930..1034077),
FT                   complement(1031742..1031833),complement(1031402..1031724),
FT                   complement(1031282..1031346))
FT                   /codon_start=1
FT                   /gene_family="HOG000157549" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264354"
FT                   /orf_name="AFUA_8G04540"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85223.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057671"
FT                   /db_xref="HOGENOM:HBG328827"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0000520740"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG1"
FT                   /transl_table=1
FT                   /translation="MPRASTAPGARLRCRRACDSCKRRKQKCNGEQPCTICIQRRKEAE
FT                   CNFSDKPARLLKANAPKETMLLSEHMVPTPQRQTAMDRLLNALEDHSADLEQQTTDDKD
FT                   GTAPVPKVARLLRDGQGKFMYIGDSASLSFLQSVRRIVSLSIGRCEFTEDTSRHSMLEA
FT                   FQGSSATQTGPLSAPPSNDEAQRLARQYVLATSPLLDLFDLEEFYQRLANWVGNPTVDE
FT                   DTVSSIFYLVLAIGVQVSEVNQDLAEQYFVSGRQLAFSAFTETPSIYTIQSYVLISMYM
FT                   LGACRRNGAFMNLGIALRAAYAVGIHRRDANALFCTRERRARERVWKSLRMIDLFLSAS
FT                   LGRPPATSDFDHDVRDPATLAGEQQLPRPEAQLSQCVVALCRIFDRILTEVYMKQVVSI
FT                   NVAETISNQHRAWVRYLPTFLSGQTERLSSKNLESMLAAAHVFGAYYWSIILLTRPFFI
FT                   FRVSQYVKSKSDPGISSNDPRASASRIALFSDACVYSALRCLNIVDDLSRFEALPRRLP
FT                   FLINSVFNSAVVLGAAFFAEYDNLLPLEEGMDKSEKFLGLFVPHDPHACRFYQIIKYLR
FT                   GAVAEYVRRRNRQWMERRSKQVDQLFGQVGLRSEPSASSDDVVISRNGEPLAPSPSSPE
FT                   KLATGSLSAQGAQPTASTGESENDIWNTLCGTQGATALPYDSTISTLTTTGIPIGCSPG
FT                   GTLTTAQPGMETDAGGQTPLSDLMRKASSPRPSELTAICFPATPMPGPFLMTLLRILHL
FT                   PLCPRVSFSYFAMSGRISIYSEKYPGCFLASEWSLVGYVFNHHLSILYISISTLSSPFI
FT                   GYCQMVLDRTIVRCSKYLENDIISRWSNDFFRPNGNQILIPLLDDDLRVLIHVSISQNA
FT                   DLRR"
FT   CDS_pept        join(complement(1035672..1035706),
FT                   complement(1035575..1035612),complement(1035442..1035521),
FT                   complement(1035297..1035379),complement(1034732..1035227))
FT                   /codon_start=1
FT                   /gene_family="HOG000157560" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264355"
FT                   /orf_name="AFUA_8G04550"
FT                   /product="Sulfonate biosynthesis enzyme, putative "
FT                   /EC_number="4.4.1.-"
FT                   /function="lyase activity"
FT                   /biological_process="coenzyme M biosynthetic process "
FT                   /protein_id="EAL85224.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0019295"
FT                   /db_xref="HOGENOM:HBG057672"
FT                   /db_xref="HOGENOM:HBG433034"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="UniParc:UPI000051F942"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCG0"
FT                   /transl_table=1
FT                   /translation="MGKRYLADVLETMGTHVDGLKFAGGSFSLFQEKPLRELIDLAHDY
FT                   GVYVSTGGWAEHLLTHPDANTVFDKYLKKCKDLGFDVIELSSGFLSFPEDDWLGLVDKV
FT                   HAYKLKAKPELGIQFGAGGDTPASGLEAIGTSDPGKLVNMGRKFLDVGVERLMIESEGI
FT                   TENVQSWRTDVVSTIMKELPSERVMFEAADPKVFNWYIREFGIDVNLFVDHSQIVQLSC
FT                   LRQGIWGTADTWGKVVSFRSE"
FT   CDS_pept        join(1039215..1039601,1039687..1040221,1040294..1040709)
FT                   /codon_start=1
FT                   /gene_family="HOG000157572" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903132"
FT                   /orf_name="AFUA_8G04560"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL85225.1"
FT                   /db_xref="HOGENOM:HBG057673"
FT                   /db_xref="HOGENOM:HBG328825"
FT                   /db_xref="UniParc:UPI000051EF8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF9"
FT                   /transl_table=1
FT                   /translation="MGAGAILEPLVVIVLLFGGTWINRSTATFSAVRRVRRSSTSTRAN
FT                   SPDSLESGLSSPTAKDALLNSRTPSPTLVQLNDARWRKRQIRILSYTFEVKSPDTAVFQ
FT                   DRLLSRLLRKFPFLVECWYWALVYWTYQLGRAFTAVTLQEGTVDVARKHALQIIQIEKS
FT                   LRIFWEVSIQRVFLRHSQLMSVINWVYSFIHIPGTIAFLVGLYYYTTTRNRVDESQIGK
FT                   PLGAAKGSTAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDENVKGPDGELGRS
FT                   YGFVDTVHGVNGAGSVWTENRFCNQYAAMPSLHFGYSLMIGLTIMTIPLPSHRRRPAVR
FT                   SRLLGRALGFRLPSWSRLACLLVGFLYPFVILVAIIATANHFILDAVAGTVVCVLGWRF
FT                   NSILLNLLPLEDYFLWLVRIHKPEPTAMDNVDYWDDDEVPDFPALY"
FT   CDS_pept        join(1042481..1042643,1042790..1043258,1043318..1043690,
FT                   1043785..1044001,1044058..1044659)
FT                   /codon_start=1
FT                   /gene_family="HOG000157583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903133"
FT                   /orf_name="AFUA_8G04570"
FT                   /product="PWWP domain protein"
FT                   /protein_id="EAL85226.1"
FT                   /db_xref="HOGENOM:HBG057674"
FT                   /db_xref="HOGENOM:HBG328824"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniParc:UPI000051FE2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF8"
FT                   /transl_table=1
FT                   /translation="MAEDTPADSRTEVGEAPVERAPSAVAKTAPVESAPETSKEQETEK
FT                   VNGTQEKPSGEASVSEEKKESTDTSAEKSKAPAEAADAKEPEATAAAPAESEAQEAPPS
FT                   SKKSGGSRRKSASGVPEHKSKLSRKKSQARMTNLHAKPGEYYLARLRSFPPWPSIICDE
FT                   EILPQTLLSTRPVTAMRADGTYREDYADGGKRAHERTFPVMFLETNEFAWIPNTDLTPL
FT                   DPASCRDVPEKGKSKQLLAAYAVAAEGHDLQYFKELLADHQRALQQELEEQEAQQAAKE
FT                   AAKAEREAKKNKRKSMDIVDDLEDIDMEDAGEPKKPKSSKKRKKDAETDGEAEKTATKL
FT                   KLTTPKTPTSETEKKATGASKSKQTASSKKAGKGGVSDEGEEDTGAAPKEPEKQVDQGE
FT                   AKERKQKEVLFVRHRLQKGFISRDQPPKEEEMTTMSNYFTRLERVADDLEVSIIRATKI
FT                   NKVLKMIVKLNSIPRDEEFQFRRRAINILSKWKNVLDADTTTTPAEPKANGAHKEDSVE
FT                   TPAKTETEGEKEEEEIKAAKQDSAEPQDESMVDADAALEKAEAPESAKEASEKEAHKIE
FT                   EATGANVTEEKTTEEKPAEEKAEEKAVEAAA"
FT   CDS_pept        complement(1045447..1046808)
FT                   /codon_start=1
FT                   /gene_family="HOG000157594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264356"
FT                   /orf_name="AFUA_8G04580"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphoprotein phosphatase activity "
FT                   /protein_id="EAL85227.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="HOGENOM:HBG057675"
FT                   /db_xref="HOGENOM:HBG328822"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="UniParc:UPI000052029F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF7"
FT                   /transl_table=1
FT                   /translation="MILLASSRRACSLACSSLQPVARDRSLSFATSTATWSRHLPDSLF
FT                   SLSSQRLSSSYLPRFSRRTFHATSLFSLDAPRISYRVAASSSPKNRRFHPPTNFHNFQP
FT                   ELHDAIGVVTEEIDAATRRKRRPDSGEDAFFVSRVGSQDSGAIAFAVADGVGGWVESKV
FT                   DPANFSHALCLYMALEALSWDSSTDKLRAKNLLQSGYDQLVADKSIRAGGSTASVGVGL
FT                   EDGQVELANLGDSGSMLLRLAAVHHYSVPQTHGFNTPYQLSIIPPRMRAQASIFGGSFL
FT                   EDSPRDAVVTNLHMQHGDVLMLATDGVYDNLNNQDILKLITSRMILTGAWTATTDLGIK
FT                   VSDNLGALTGPDGLASLLPWPSPPSKPSAADPSTSGNVAPSSRINQHHTLQSLLASTVA
FT                   GEAKRASMDSRRDGPFAKEAQRYYPGDWYRGGKVDDICVLIIVAVEEGRGHESC"
FT   CDS_pept        join(1047790..1047828,1047972..1048005,1048083..1049620)
FT                   /codon_start=1
FT                   /gene_family="HOG000157615" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056403"
FT                   /orf_name="AFUA_8G04590"
FT                   /product="Pre-mRNA splicing factor, putative "
FT                   /protein_id="EAL85228.2"
FT                   /db_xref="HOGENOM:HBG066306"
FT                   /db_xref="HOGENOM:HBG435054"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR014906"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI0000F51861"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF6"
FT                   /transl_table=1
FT                   /translation="MHPSRQAYVEESEDTEMGIDLANVPVDRDYDIPSAAAGIPAERAS
FT                   AILSQFERKRRAAAMAVPTDDNRVRARLRELGEPITLFGEGPVDRRDRLRELLTDLAER
FT                   QEAAAAEGDVSMRGTTEETEAAEEEAEQQEEFYTEGSQELLNARKAIARYSLPRAKARV
FT                   ERLREESTIPLRTHIKHRKAIKEKLQGFDLYGSQIAGDRPVSICRFAPDGKTIAAGNWG
FT                   GGIRLLTVPNLEEKSNLNGHTDRVGGLAWFPGATLPSSNVSESSVNLVSGGGEGNVALW
FT                   SLDKDTPLATLSGHSGRVCRTEFHPSGRYIASASFDTTWRLWDVETTVELLLQEGHSRE
FT                   VYTVAFNNDGSLLASGGLDSIGRIWDLRTGRTVMILEGHVREIYGLDWGVDGYRVLSGS
FT                   GDGWIKCWDLRQVRNIGGIGAHKSVVSDVRWYKGTESAASYLPSTESNGRMDVDSNPTL
FT                   TTSEQSTPATPIQPKKSGTFFVSSGFDKNVNIFSADDWSLVKSLSGHAGNVLSTDISDD
FT                   AQWIASCGHDRTVKLWGIE"
FT   CDS_pept        1050158..1050970
FT                   /codon_start=1
FT                   /gene_family="HOG000157616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751088"
FT                   /orf_name="AFUA_8G04610"
FT                   /product="DnaJ domain protein"
FT                   /function="chaperone binding"
FT                   /function="heat shock protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="EAL85229.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG277816"
FT                   /db_xref="HOGENOM:HBG396151"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000051E64A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF5"
FT                   /transl_table=1
FT                   /translation="MAASFQMQRLAQRSLLSTVPLARTEATHSLFLTGACIFCQLRPRA
FT                   WAAQPARRPCLTLPTRRLASTSSTTAPETSNQDSNLPDLTNHYTIFRETLPAGPPPASA
FT                   FDIPLSDLRREFLRLQNVIHPDKFPPGPEKQRAEALSARINEAYRTLSDPLQRAQYLLR
FT                   EIHGIDVTAEDGSTQHALDPETLMEVMEVQERIEEVGAGPEAEGTIAALKKENDARVAA
FT                   CVKSLAQAFERGDIEAARQECVRLRFWYSVGEGLREWEPGRTEIRLIH"
FT   CDS_pept        1052510..1054090
FT                   /codon_start=1
FT                   /gene_family="HOG000157627" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751089"
FT                   /orf_name="AFUA_8G04620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85230.1"
FT                   /db_xref="HOGENOM:HBG057676"
FT                   /db_xref="UniParc:UPI000051F6E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF4"
FT                   /transl_table=1
FT                   /translation="MNSGLTRESKHHIAVLEEEDAETFVAFCEYAYTGDYSVPTPGSRE
FT                   DDRVESSNNPTFNQMFSNPNPFASAVPPPAPSPPPSAKFSDRNLDVPDSGDAKTAEATE
FT                   ESAQPLKEGEGEGVKDATDDVREDVAAPDDPPQDLASNCDEPSEQPLATSTAEEGSSWG
FT                   LEENAMPSKGKKAKKSKKGKKKQQGGATAEEPMSNLTPPTTPPPGNVDDQIDNPLTVEA
FT                   TTMLDDPIPVIEPTKVDEVAEAVEVPEPTGADQSPDAAALSDTESWDRATSVPPNVKDT
FT                   LNQKVELDPDSQKQDRVKEEVASPRSQMKAFIDTSFAKQLYLSRRPTGVGLWDEFVNLD
FT                   YFDHPSTYGTRPLTPTATHSDTTKSDLPYLLFHAKLYVFAVRYLIPGLAQLCLRKLHAD
FT                   LLRLDFPGPKDDERKEERAAWTATKGRMVLDLLHFTYTKTTRLEPISPTSATQLRDNEL
FT                   RKLVVHYAACKVRELAEYCGPMESIVSSPFPSPVDKQPRRANRPSSRGFRALLDSTTEL
FT                   ASDLVFRMM"
FT   CDS_pept        1057269..1058450
FT                   /codon_start=1
FT                   /gene_family="HOG000157649" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751090"
FT                   /orf_name="AFUA_8G04630"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein, putative"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85231.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG328817"
FT                   /db_xref="HOGENOM:HBG434591"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniParc:UPI000051F953"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF3"
FT                   /transl_table=1
FT                   /translation="MFNDHDHVPPTSSQSDSGFFEQEMKKSPRLSLRERLRHFTWAWYT
FT                   LTMSTGGLALLIASQPYTFNGMKGIGMVVYILNLLLFALVCSLMVLRFVLHGGFLDSLR
FT                   HPREGLFFPTFWLSIATIITGLHRYFGSDDLESYLIALEVLFWVYCSCTLATAVIQYSF
FT                   LFAAHSYGLQTMMPSWILPAFPIMLSGTIASVISESQPARSAIPIITAGVTFQGLGFSI
FT                   SFIMYAHYIGRLMQSGLPCREHRPAMFICVGPPSFTALALVGMAKGLPDEFKIIKDAHV
FT                   EDARILELMAIIVGVFLWALSLWFFFIAFVAVVRCRPTAFHLSWWAMVFPNTGFTLATI
FT                   TLGRALGSPGVLGVGSAMSVGVVCMWVFVFVYHIRAVIRQDIMYPGKDEDVLD"
FT   CDS_pept        complement(1060695..1061906)
FT                   /codon_start=1
FT                   /gene_family="HOG000157670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264357"
FT                   /orf_name="AFUA_8G04640"
FT                   /product="RNA-3'-phosphate cyclase family protein "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL85232.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG020852"
FT                   /db_xref="HOGENOM:HBG381263"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR013796"
FT                   /db_xref="InterPro:IPR016443"
FT                   /db_xref="UniParc:UPI000051EAE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF2"
FT                   /transl_table=1
FT                   /translation="MATTSQPPLRFTGHKNFVNRLVFSTLTGRAVHISQIRPSSPTNPG
FT                   LAPHEISFLRLLEAVTNGSQIEISYTGTIVVYKPGLITGGIAGNGVTTGGVIRHELPAG
FT                   CTRGVSYFLIPLCLLAPFSKAPIKVLFTGPGVITSATPTGDMSVDSVRTAILPLYNQFG
FT                   IFNNIELRVLRRSNPGPNGRGGGGEVQLVFGHQVRLPKTLHLMNPGRVKKVRGVAYSVG
FT                   VSASNNARMIDVARGILNPLVPDTYIFSDVSSAPLVPDRNNPSAKKKIGLGFGLSLVAE
FT                   SSTGCLYSADVASPPAGGQAPEDIGKQCAYQLLETISKGGCVAPAAASTMLGLMTMGSE
FT                   DVGRLQFGREVIADESIIQLARDLAKFGAPGWGLRDATGENEQGDVIVSVVGRGIGNVG
FT                   RKVA"
FT   CDS_pept        join(1062212..1062243,1062360..1062906)
FT                   /codon_start=1
FT                   /gene_family="HOG000218448" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751091"
FT                   /gene_name="bna1-1"
FT                   /orf_name="AFUA_8G04650"
FT                   /product="3-hydroxyanthranilate 3,4-dioxygenase 1 "
FT                   /EC_number="1.13.11.6"
FT                   /function="3-hydroxyanthranilate 3,4-dioxygenase activity "
FT                   /function="iron ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridine nucleotide biosynthetic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85233.1"
FT                   /db_xref="GO:0000334"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019363"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG003696"
FT                   /db_xref="HOGENOM:HBG341987"
FT                   /db_xref="HSSP:1ZVF"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051F954"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WCF1"
FT                   /transl_table=1
FT                   /translation="MLPPALNIPKWLEENSHLLQPPVNNYCVYHPSSPATAGYTVMIVG
FT                   GPNARTDYHINTTPEFFYQYRGSMLLKTVDTSVSPPVFQDIPIHEGSIFLLPANTPHCP
FT                   VRFKDTVGVVMEQPRPKDAVDTMLWFCKKCGEVVWEKRFVCTDLGTQVKEVVEEFAADQ
FT                   EKRTCKACGTIAETRYQEGEVVQPPRFLE"
FT   CDS_pept        complement(1063619..1065658)
FT                   /codon_start=1
FT                   /gene_family="HOG000157671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751092"
FT                   /orf_name="AFUA_8G04660"
FT                   /product="Noc1p protein, putative "
FT                   /protein_id="EAL85234.1"
FT                   /db_xref="HOGENOM:HBG057678"
FT                   /db_xref="HOGENOM:HBG328804"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="UniParc:UPI000051E3E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCF0"
FT                   /transl_table=1
FT                   /translation="MAPLDDIQVGDVVNVPGGMYGTVRYLGSVAGKQGRFAGIELAPEH
FT                   AKRGKNNGDVEGRKYFKTTVPGSGIFVPMNNNRYVTKRSSTSAPTVTTAPPTPSRPINF
FT                   SKSVGPSPAVPRPRVRRPSLPRPESPRGPPPSKLSLAGLRTPSTASRAGPSPNGYPRSP
FT                   VKAPSRASDRTPSRMSMDDDLSSVRTSDFHRSSMASEVQELKDQIKSLEKQLLDRDKQL
FT                   EEQANTLAEFQRTIEDLEGSDALSIRAQLREKNERIAQLTAEFDLHRADFRSTLDTLEI
FT                   AASETERVYEQRLDELMQQNKELQDRGEDVEAVARQLKQLEELVSELEEGLEDARRGEA
FT                   EARAEVEFLRGEVERTKLELKKEREHSSAMLREAHSGGDGGRQYSKELDQKDDEIRGLK
FT                   AIIHSLSRGDPNFPGLQNGLASSRQDHDSEHIARLEQRIQEFEHATESKNYRIEELERE
FT                   LQQLRLSNESRTRSSTISAPAPPHKPSNSAGYVGTANTINHAHRLSDRTVVPNDWQEQP
FT                   HGENQYQPFGSHHRGASNSSRHRLETMHESDGRSDDGNSLWCEICETGGHDILSCTNIL
FT                   GAETKNEHVRPVEQSHHEASVDSKSTPGTSIAGESSPLKDEVSATPQKTGRDAVLEGLK
FT                   GISGGLTASMAPVAGKASGVIDETKWCALCERDGHESIDCPFDE"
FT   CDS_pept        join(1066821..1066940,1067014..1067629,1067681..1068225)
FT                   /codon_start=1
FT                   /gene_family="HOG000157694" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903134"
FT                   /orf_name="AFUA_8G04670"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85235.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F492"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE9"
FT                   /transl_table=1
FT                   /translation="MAQYFFDLLYNFTDCMCCFPSTPQLKINNRSFKLLRLLGEGGFSY
FT                   VYLVQDKATSELFALKKIRCPFGQESVSQALKEVEAYSLFTSQPNIIHSIDHCVSTDSG
FT                   SKFRSDGGEPGSKTVYILLPYYQRGNLQDAINANLVNHTRFPEKRLMVLMLGVANALKA
FT                   MHQYRVKSGAGSTRRAKAVRREGEAADAQLSMQMGKPKRRASQRVDEEDSENEPLMDDE
FT                   VTISQEGVQEGDLRPYAHRDIKPGNIMIDDDGQTPILMDLGSLAPSPIAITSRSLALAV
FT                   QDTAAEHSTMPYRAPELFDVKTGSIIDTKVDIWSLGCTLYACLVGKSPFEARSEETGGS
FT                   LSMCVLGGDWRFPDEKPGATKGKGRAGAEDAGKDNTATISEPVKEVVRKCLQVEPADRP
FT                   DIDELIQIIKDVIKDLSDDDVIASGSA"
FT   CDS_pept        join(1068780..1068847,1068931..1069363,1069432..1069558,
FT                   1069614..1069654,1069734..1069848,1069944..1070059)
FT                   /codon_start=1
FT                   /gene_family="HOG000157695" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264358"
FT                   /orf_name="AFUA_8G04680"
FT                   /product="Oxidoreductase, short-chain
FT                   dehydrogenase/reductase family, putative "
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85236.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG057679"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000F51872"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE8"
FT                   /transl_table=1
FT                   /translation="MGIRDQRCRCGQCLSPEHQETNIGTGLSAATAEALASGDAAAIIL
FT                   MGKSQAEAQAMIDDINHKHPKAKLIFISVDFGRLASVREAAEAIRKLEVPIDGFVGFPT
FT                   VMAGPWMKTEDGIESHFQCNYLSNFLLINLVVHLMPAGSRVVIVCSSIRPEAPPPAWDD
FT                   PNFADGKKYHPLDAYALSIFANVQMVKCLAITGCGRSMATFSVNTGNTKPSLQTVASPE
FT                   QSARFQVGEDLPLLLQQAPKSASQGIATILRALLDPDISDNCQILALPKIDFPAGEENG
FT                   RALWTQSEQLVGQEFKRL"
FT   CDS_pept        join(1071126..1071319,1071392..1071599,1071663..1071679,
FT                   1071739..1071841,1071890..1072338,1072394..1072480,
FT                   1072531..1072584,1072645..1072974,1073032..1073215)
FT                   /codon_start=1
FT                   /gene_family="HOG000157706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207689"
FT                   /orf_name="AFUA_8G04702"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EBA27224.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG325669"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0000F5184C"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA36"
FT                   /transl_table=1
FT                   /translation="MAPRGDGDSIPGTFTLVDVDGVLATRHLDRGDRDIVLVPEPSNDP
FT                   DDPLNWSPRRKLLSTICVSVYTLFAGISTSVVYSVLVQLSEETGVAVDTLNQGTGYMFL
FT                   LAGWGLLFWQPFALQYGKRLTYILSLVGILATLVWGPYVRSNGEWIGRSILSGFFVAPI
FT                   EALPEVTVTDVYFTHERGTYMGLYAFFLAGSNYFAPVICGFIAQYQGWQWVFYWPAVFC
FT                   AVTIAFLFFFMEETNYARKCAETTTVEGILESSTTPSKQGDQEKPLPATGQPDQTECGV
FT                   MYSKKTYIQKLSIIGPRQPRNNMFRRFYQTLYYLSWPVIFYAGFSYGSYLIWFNVLNAT
FT                   ASLILGSAPYNFRSSMVGLSYLACCLGVICGSLFTGRFSDWLTIKLARRNGGVMEAEQR
FT                   LWPFLACVIIVPGSLLLWGVGAAHEVHWFGLLVAMCLLALASTCGVTLSVNYLVDSYRE
FT                   LSGDAMASVILVRNTMSFAMGYGITPWFEDLGYQNCFVSAAFIGMAISAVFLVMIKWGK
FT                   TFRARSRDKYWSIVRENQARGMGH"
FT   CDS_pept        complement(1073343..1074326)
FT                   /codon_start=1
FT                   /gene_family="HOG000292007" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264359"
FT                   /orf_name="AFUA_8G04710"
FT                   /product="Xylosidase, putative"
FT                   /EC_number="3.2.1.37"
FT                   /function="xylan 1,4-beta-xylosidase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85239.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0009044"
FT                   /db_xref="HOGENOM:HBG057681"
FT                   /db_xref="HOGENOM:HBG585375"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="UniParc:UPI000051F201"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE5"
FT                   /transl_table=1
FT                   /translation="MSEPLVKHIYTADPSAHVFNNKLYIYPSHDRETDIQFNDNGDQYD
FT                   MNDYHVFSLETVGGPVTDHGVVLKDSDIPWVSKQLWAPDAATKNGKYYLYFPARDREGI
FT                   FRIGVAVSDKPEGPFAPQPNPIRGSYSIDPAAFVDDDGQAYLYFGGIWGGQLQCWSRSA
FT                   ATGEWEFDASKTGPQEPRGEGVKALYPRVARLTEDMLEFEGEIQELQIVDEERRPLAAD
FT                   DHERRFFEAAWMHKYNGKYYFSWSTGDTHYLVYATGDSPLGPFTYRGRILEPVLGWTTH
FT                   HSIAEFQGKWYLFYHDCSLSGGVDHLRSVKMREIVYDAEGNIKLAE"
FT   CDS_pept        complement(1074779..1075417)
FT                   /codon_start=1
FT                   /gene_family="HOG000157717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903135"
FT                   /orf_name="AFUA_8G04720"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85240.1"
FT                   /db_xref="HOGENOM:HBG057682"
FT                   /db_xref="UniParc:UPI00005204E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE4"
FT                   /transl_table=1
FT                   /translation="MQGSNNPSLPGIVIDPSSPQSPTVSCAFSPSTPTSSMSSRSTPQS
FT                   SQPASQAESKPAKRPRKVHPSFQPVLRHLRSPLCPLVSSTTGQQHPDFPKTLLAYHLLT
FT                   SRQLDDLARHFHQVWPPVEATRAYPVSIPPWIGTQGEKSVDLQTKRRRFGRFIGLRGCE
FT                   SPTVGTAGSTSEDDTEELLERMEWEWEQGLRQAQRDDPDAILRWKAWGR"
FT   CDS_pept        join(complement(1078183..1078214),
FT                   complement(1075934..1078088))
FT                   /codon_start=1
FT                   /gene_family="HOG000157728" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903136"
FT                   /orf_name="AFUA_8G04730"
FT                   /product="Oligopeptidase family protein "
FT                   /protein_id="EAL85241.2"
FT                   /db_xref="HOGENOM:HBG003256"
FT                   /db_xref="HOGENOM:HBG333902"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000F51860"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE3"
FT                   /transl_table=1
FT                   /translation="MTIRSMKFTPEVLLGAPRRSGPIPNSSGTLAVYTQTSYSFDSHSK
FT                   TNEIRVLDIATGRSALITNDPGASSPQWLENSDQLVWLKTKANGNTSFIVGDAREVDKT
FT                   YTAGTVPGPVSDLKVTVVEPGKIGFAVVGKANPDGSLYNPHDAKKPLSSGRLYTSLFVR
FT                   HWDSWIEPQRNAIWYGLLQRAPLSPATRQAGRYSVSGLTNLISVCGLTGVESPIPPFGG
FT                   SGDFDISPSAIVFVAKDPNLNPATHTSCSCYYCPMFSWTGVGALEAKVCTVKGLEGAMS
FT                   SPVLSSDGSSIALLGMREDGYESDKNRILYVPNPWNGEMIEIFASADGKGQWDLSPSGL
FT                   TFAKDDQSLFVQVEEQGRGVLYQLPLDNVRHSTPDVLKKLTHSGYVTDVFPLVAKSSNL
FT                   LIASNSLVDNSLWTIIDTQDTSKVRVISSIGRGGAAFGLSPTQVDEIWFKGAEDHPVHA
FT                   WVVKPSNFQPGNKYPLAYLIHGGPQGAWNDQWSTRWNPAVFAEQGYVVITPNPRGSTGY
FT                   GQPFTDAIRGSWGGLPYIDIEKGLDYIEENLDYVDTTRAVALGASYGGYMMNWIQGHPL
FT                   GRRFKALVTHDGVFSMTSQLASEEQYFPLHDLGGPIWKVPENWEKWDPSRFTEHWQTPH
FT                   LIIHNELDYRLTIAEGLAAFNVLQMKGIESAFLTFPDENHWVLNPENSLVWHQTVFNWI
FT                   NKYVGLPPVTDEKRDAFSSKKTPLEKRVAGLSLS"
FT   CDS_pept        complement(1078634..1085263)
FT                   /codon_start=1
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264360"
FT                   /orf_name="AFUA_8G04740"
FT                   /product="Pre-mRNA splicing helicase, putative "
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL85242.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG023097"
FT                   /db_xref="HOGENOM:HBG736699"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000051EAE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE2"
FT                   /transl_table=1
FT                   /translation="MADQNISQYKYSAMSNLVLQADRRFISRINDEPTGDPESLAGRIS
FT                   IREMGSRVARDDAPKTKKKPVGPTDIERGAIREGEDVLAREQRKRRGQQQLRGQGILSA
FT                   ADALIEGLKYRPRTPATRATYDLILTMTASHLGDVPHEVVRSAADAVLELLKDEDMKDF
FT                   DKKKEIDDLLGSSMSPKEFNELVNLGKKITDYDAQDEDEEMEGGMDGQEEAELDERQGV
FT                   AVVFDEEDEDDERMGTVTEVRDEDDLTDDEETDEQEAPDVEAAATEKADIEGLEAEEQM
FT                   VIDGGLDRDDQRRNKNLIVPARQIDAYWLQRQVGSVYTDAHIQQEKATQALEILGGKAE
FT                   DGTEKSLRDVENDLMELFDYEHPDLVAKFVMNRDKIVWVTRWRRVAEDADARHLVESEM
FT                   VEAGHRAILDEIRGKTVRDEAAGRPEKKIKLDLMDVDVPSAPAPEEKPTEGGLVGGLQP
FT                   KRLINLENLVFHQGNHLMTNPNVKLPQGSTKRTFKGYEEIHVPPPKPKRDPGEKNIPAT
FT                   ELPEWARIGFGSAKELNRVQTKCYPAAFHDDGNMLVCAPTGSGKTNVAMLTILREIGKN
FT                   RNPETGEIMLDDFKIIYISPLKALVQEQVGNLGKRLEPYGIRVSELTGDRQLTKQQIAE
FT                   TQLIVTTPEKFDVITRKASETSYIKLVRLIIIDEIHLLHDERGPVIESIVSRTIRKVEQ
FT                   TGEPVRIVGLSATLPNYRDVASFLRVDPNKGLFHFDGSYRPCPLKQEFIGVTDKKAIKQ
FT                   LKMMNDICYNKVLEQVGQRRNQMLIFVHSRKETAKTAKYIRDKALEMETIGQILRSDAA
FT                   SRAILAEEAESVDDASLKDLLPYGFGIHHAGLSLADRDSVQALFADGSIQVLVCTATLA
FT                   WGVNLPAHTVIIKGTQVYSPEKGSWVELSPQDVLQMLGRAGRPQYDTFGEGIIITSQTE
FT                   IQYYLSLMNQQLPIESQLMSKLADNMNAEIVLGNIRNRDEGVEWLGYTYLFVRMLRSPG
FT                   LYSVGADYENDDALEQKRVDLVHSAAVILERAGLVKYEKKTGRLQSTELGRIASHYYIG
FT                   HNSMLTYSQHIQPSISTIELFRIFALSDEFKYIPVRQDEKLELAKLLGRVPVPVKESID
FT                   EPHSKINVLLQAYISRLKLEGLALMADMVYVTQSAGRILRALFEISLKKGWSSVAKTAL
FT                   DLCKMAERRMWPTMTPLRQFPHCPRDILQKAERIDVPWASYFDLDPPRMGELLGMPKAG
FT                   RTVCDLVSKFPRLEVQAQVQPVTRSLLRVELTITPNFVWDDALHGTAQDFWILVEDCDG
FT                   EEILFHDQFILRKDYAQAEMNEHLVEFTVPITEPMPPNYFISLVSDRWMHSETKIAVSF
FT                   QKLILPERFPPHTPLLDMQRAPVKALKREDYQQLYPEWQLFNKIQSQTFKSLYDTDDNV
FT                   FLGAPTGSGKTVCAELALLRHWATGKGGRAVYIAPFQELIDHRHADWEKRLGNLGGGKN
FT                   IVKLTGETTADLKLLDQADLVLATPTQWDVLSRQWQRRKNVQSVQLFIADELHMLGGYG
FT                   GYVYEVVVSRMHSIALQLENGMRIVGLSVPLANARDIGEWIGANKHTIYNFSPHARPVP
FT                   LELHIQSFSIPHFPSLMLAMAKPAYHSILQLAPDKPALVFVPNRKQTRSTAIDLLAACA
FT                   ADDNEDRFLHADVNELAPLLNRIQERTLAESLSHGIGYYHEALSATDKRIVSHLFTIGA
FT                   IQVLLASRDVCWDLNLTAHLVIIMGTQFFEGREHRYIDYPISEVLQMFGKATRPKEDKI
FT                   GRGVLMVPSVKREYYKKFLNEALPVESHLQLYLHDAFVTEISTRTITSTQDAVDWMTYT
FT                   YFYRRLLANPSFYGLSDISHEGLSTFLSELVENTLRELSEAKIIDLDEEDDSVSPLNAA
FT                   MIGAYYNISFITMQTFLLSLSARTKLKGILEIITSATEFESIQMRRHEDHILRRVYDRV
FT                   PVKMSQPAYDSPHFKAFVLLQAHFSRMQLPIDLAKDQEVIVSKVLNLLSACVDVLSSEG
FT                   HLNAMNAMEMSQMVVQAMWDRDSPLKQIPHFGPEAIKVANEYNINDIFEFMEAMDPSEN
FT                   KDYPTLVKRLGLDNSQLAQAAAFTNEKYPNLDLDFKVEDPENITSGEPAYLKIKIEREV
FT                   EEDEEPDTTVHAPFYPGKKMENWWLVVGDEKTKNLLAIKRVTIGRKLELRLEYIVPTPG
FT                   EHELTLYLMCDSYVGVDQAPTFTVTAAEGMEEDESEEEEE"
FT   CDS_pept        join(1085695..1086069,1086159..1087080,1087143..1088902)
FT                   /codon_start=1
FT                   /gene_family="HOG000157750" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207690"
FT                   /orf_name="AFUA_8G04750"
FT                   /product="DNA mismatch repair protein Msh1, putative "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="EAL85243.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG377949"
FT                   /db_xref="HOGENOM:HBG397978"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniParc:UPI000051EADC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE1"
FT                   /transl_table=1
FT                   /translation="MRINGCRFARLVTSQFHHVHKFDTSAAHRCLVHRTICHHARRPHA
FT                   RVEASLPTPNFELRRGARTRTTVKVKDLPQGTVKLKPYDDGATGATDDAPQYPTVVQGH
FT                   RNNMRKFRNCVILTRVGGFYELYFEQAEELAPLLNLKLAVKRTSAGPVPMAGFPFFQLD
FT                   RFLKILVQDLNKYVAISEEFANAAEDKARGGLLFDRRVARIITPGTLIDEKFMDPSENN
FT                   FLLAVYIDVAALKAQLEQQEGNLSAQQHILSSASQHVGLSWLDLSTGDFFTQSTTTQML
FT                   PSAIARIGAREILVDQKLQDLIGQELQLLVGHDHRLMTFFAYPSKILPIAQWSSVLEAQ
FT                   VADQDSDAFTPEEVAAGYSLLEYIRVQLQGLNLKLQPPRRRHLNESMNIDRNSLKGLEI
FT                   LETARDGFGKGSLLHAVRRTSTKSGARLLRDRLTSPSTSLLVINERLDLVSVFLENSDL
FT                   RDSVIQLLKRSYDAQRLVQKFTLGRGDADDLICLARAIQASREIKMVLSSQDNGPLEAL
FT                   PHIQSNHAKRSLSAMTGRLCLDGPTALADRISAAIDEEGLLQKQRLADDTAAEAAILAQ
FT                   EVAMSEGLPGEVETLPKKVRAKNSDQSKTSTEEITAPDTWIMRRNASAALLELHESLDR
FT                   LQDEKARLTQRLREAVGSSALSLRWTSGLGYICHVKGAKISQQSLEELGVTRNVSSTKS
FT                   TRSFYLPAWTALGDRMDQVKVQIRQEEQAIFETLRREVILNLVKIRRNAAVMDELDVAC
FT                   SFATLAEEQRLVRPILTSGVTHKIVGGRHPTVKLGLEEQGRQFVSNDCFLGDSERIWLI
FT                   TGPNMAGKSTFLRQNALITILAQVGSFVPAEYAEIGIVDQIFSRIGAADDLFRDQSTFM
FT                   VEMLETATILKQATARSFVIMDEVGRGTTPEDGTAVSFACLHHLHYRNKCRTLFATHFH
FT                   ALADMTDDFEALGRYCTDVKESASGSFSFVHRLRKGVNRNSHALKVAQLAGLPKETLEM
FT                   ASRVRESLGNRAPWSSGGSDSHPIVSATV"
FT   CDS_pept        complement(1089083..1089832)
FT                   /codon_start=1
FT                   /gene_family="HOG000256169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264361"
FT                   /orf_name="AFUA_8G04760"
FT                   /product="Ureidoglycolate hydrolase, putative "
FT                   /EC_number="3.5.3.19"
FT                   /function="ureidoglycolate hydrolase activity"
FT                   /biological_process="allantoin catabolic process "
FT                   /protein_id="EAL85244.1"
FT                   /db_xref="GO:0000256"
FT                   /db_xref="GO:0004848"
FT                   /db_xref="HOGENOM:HBG289179"
FT                   /db_xref="HOGENOM:HBG434376"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniParc:UPI000051FE2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCE0"
FT                   /transl_table=1
FT                   /translation="MAPILTSSPTLRITPEPFTKEAFAPFGTAISCPLPRDLSSAPPLS
FT                   SLPPHDPAPVIANQSSALKYSPISPLLDHYAQCPRTQPSSARMSMFSCFPRKLRTAKAT
FT                   GGETNVFDVRILERHPFTTQTFTPLDLSNQPRAGDAEEPFYLVIVAPTLKGQTATATTP
FT                   SGDTVAIRDPPDLNNMRAFVARGGQAVTYGVGTWHAPMVVLGPRRVDFVVVQFVNGVDD
FT                   EDVQEAAFGEGIVVDLGRSRTSGASKL"
FT   CDS_pept        join(1090594..1090707,1090766..1092254,1092318..1092658,
FT                   1092715..1092873)
FT                   /codon_start=1
FT                   /gene_family="HOG000229992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264362"
FT                   /orf_name="AFUA_8G04770"
FT                   /product="Acetoacetyl-CoA synthase "
FT                   /EC_number="6.2.1.16"
FT                   /function="acetoacetate-CoA ligase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="EAL85245.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0030729"
FT                   /db_xref="HOGENOM:HBG519036"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000051ED09"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD9"
FT                   /transl_table=1
FT                   /translation="MASPSDLPRKLWEHPNPQSTQMWAFKTELEKERGLQLPDYHSLYR
FT                   WSTDNRASFWDFCWRYFPIISEGTYRTVVDESARIDSVPTWFEGVRLNFAENMLFSAER
FT                   SSSGHIQITTKGKEDNKIALTEIREGGAEAPRHITWAELRRKTGRMVQALKAAGVVKGD
FT                   RVAAVASNSVDTLVVLLATTALGAWFSSTSTDTGVKGILDRLLQLKPKYVFVDDFAIYN
FT                   GKRIDLRPKIQDIADGLREVSEFEGIIALPRFPGQPVDVTHVPKTQPVEAFLARAPLHK
FT                   LEFVRVGFRDPFLVVYSSGTTGKPKPIVHGVGGVILNTYKEGRLHRDHGPDSTVLQYTT
FT                   TGWIMYLSAISGLMFGGKAILYDGSPFLPDAKFLIELLSKYKVTHFGTSPRYLHELRKN
FT                   NIRPKDIADLRALRIVTSTGMVLSESLFEWFYDEGFPSQTQLANISGGTDLAACFGLEN
FT                   PLTPLYVGGCQGPALGIPIAVFDQADEGATAVKGTAVPDGVPGELVATAAFPTMPVKFL
FT                   GDDGPQKYFDSYFARFDNVWTHGDFICVHPITKQILFLGRSDGVLNPSGVRFGSAEIYN
FT                   VIDTQFSTEIADSICVGQRRPTDVDESVILFLLMRPGYQFTPQLVTRVKEAIRKALSAR
FT                   HVPKYVFQTPEIPTTVNLKKVELPVKQIVSGKKIKPSGTLLNPQSLDYYYQFAEVEKLV
FT                   NPRSKL"
FT   CDS_pept        join(complement(1096309..1096323),
FT                   complement(1096125..1096240),complement(1095747..1095960),
FT                   complement(1095467..1095690),complement(1095358..1095415))
FT                   /codon_start=1
FT                   /gene_family="HOG000157771" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751093"
FT                   /orf_name="AFUA_8G04780"
FT                   /product="Peroxisomal membrane protein (PmpP24), putative "
FT                   /protein_id="EAL85246.1"
FT                   /db_xref="HOGENOM:HBG026621"
FT                   /db_xref="HOGENOM:HBG328795"
FT                   /db_xref="InterPro:IPR019531"
FT                   /db_xref="UniParc:UPI0000520298"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD8"
FT                   /transl_table=1
FT                   /translation="MDALLSRLDSFVLDPHLAPLLSLVKGARNGIVYGSKVRFPHALVF
FT                   REKVKLVLKATRQHARNLATFALIYKGSMIVLRNVNPTGVGKEGRYDSFFAGLLGGYAV
FT                   FGRHKTSITQQIVIYVFARVVLALAKLSVQPNMHPLSSLITPESRARIEANAWPVFASL
FT                   SWALVMYIFRWHPETLMSSLRSSMVYIYSDSDHWDSFRNFLIYNK"
FT   CDS_pept        join(complement(1098075..1098088),
FT                   complement(1097022..1098000))
FT                   /codon_start=1
FT                   /gene_family="HOG000157782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751094"
FT                   /orf_name="AFUA_8G04790"
FT                   /product="Ribosome biogenesis protein, putative "
FT                   /protein_id="EAL85247.1"
FT                   /db_xref="HOGENOM:HBG025797"
FT                   /db_xref="HOGENOM:HBG622739"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI000051F202"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD7"
FT                   /transl_table=1
FT                   /translation="MLREVKPKNPRTARILKAREPQLIEPPKRTLFMHGSKCPTALNTV
FT                   LKTFHSLTVPHSVLFHKKNENIHPFESAESLEFLANKNECGIVVFGSSSKKRPNCLTVA
FT                   RIFDSKLLDMCELMLLPNPDGDSIPPINNLKMQIGIGLRPMLLFAGTAWDDSTSTAHVM
FT                   LKSMFIDMFKGEESDKIDVEGLQYVLMIAAEEPTDGLAPVIHLRWYKLRTKRSGHKLPR
FT                   VELDEIGPKFDFKIGRLHEAPESALKEAMKQGKRPNENMKTKKNIGMDIMGDKIGRVHL
FT                   GKQDLSGLQTRKMKGLKRRAGVESDEEDAEMMDVDEVSDDEGRKKARTE"
FT   CDS_pept        join(complement(1101851..1101881),
FT                   complement(1101636..1101761),complement(1099857..1101556),
FT                   complement(1099495..1099804),complement(1098425..1099431))
FT                   /codon_start=1
FT                   /gene_family="HOG000020094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264363"
FT                   /orf_name="AFUA_8G04800"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /function="ATP binding"
FT                   /function="valine-tRNA ligase activity"
FT                   /biological_process="valyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="EAL85248.1"
FT                   /db_xref="GO:0004832"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006438"
FT                   /db_xref="HOGENOM:HBG379584"
FT                   /db_xref="HOGENOM:HBG577712"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000520741"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD6"
FT                   /transl_table=1
FT                   /translation="MSQPTPSPNPVGEPKAPMTDPAPQADDQTRNQVADPTAKDAPGAP
FT                   KVKSEKELERERRKAEKAKKFAEKQAKAAAAKPAPVKSEKKANKIEKEKTTDAYDPKAI
FT                   ESGRYEWWEERDLFKPEFGPDGKVKPEGYFVIPIPPPNVTGSLHMGHALTNALQDTMIR
FT                   WERMKGKTTLWLPGMDHAGISTQSVVEKMLWKKEKKTRHDLGREEFTKRVWAWKDEYHA
FT                   NIKNALRRVGGSFDWSREAFTMDPNLSAAVTETFVRLHEEGIIYRANRLVNWCVALNTS
FT                   LSNLEVENKEVEGRTLLDVPGYDKKIEFGVLTHFCYEIDGTKERIEIATTRPETMIGDT
FT                   GIAVHPDDKRYQHLIGKFARHPFVDRLMPIVADTDVDPEFGTGAVKITPAHDFNDFNRG
FT                   KAHNLEFISVLNDDGTFNKNGGPFVGMKRFDARYKVIEMLKEKGLYVKWENNPMKIPRC
FT                   AKSNDVIEPILKPQWWMKMQDLAEPAIKAVENGEIVIKPESAEKNYFRWMRSINDWCLS
FT                   RQLWWGHQAPAYFVKIEGEDGDDSDGNLWVTGRTEEEARKKAEAKFPGKTFSLVRDPDV
FT                   LDTWFSSGLWPFSTLGWPRQTHDLENLYPTSVLETGWDILFFWVARMIMLGIKLTGKVP
FT                   FKEVYCHSLIRDSEGRKMSKSLGNVIDPLDVMEGIELQALHAKLLTGNLAEKEVATATK
FT                   YQKKAFPKGIPECGADALRFALVSYTTGGGDIAFDIQVIHGYRRFCNKIYQATKFVLGR
FT                   LGDDFKPLPAPSKTGRESLSERWILHKFNTAAKEVNEALAQREFSVAASTTYQYWYGQL
FT                   CDIFIENSKYLLAPEVPAEVQESAKQTLYTALEGALTLIHPIMPFVTEHLWQRLPRRPG
FT                   DKTISIMKARYPQYNPEFNDPEAETAYELILNTSKAIRSILAQYEIKTKGDIIIQTYDP
FT                   VSYKTISDEVTSIKSLGGKFLGELTVADLENTNPPSGCVVAPVGAQAAVYLRVSKEVAL
FT                   EQEEKAKASLEKARETVRRQQTLVNAAGWKEKVKPEVREQEERKLRDAESEAARLEEQI
FT                   REFEKLRLE"
FT   CDS_pept        join(complement(1104134..1104248),
FT                   complement(1103651..1104024),complement(1103176..1103595),
FT                   complement(1103015..1103116))
FT                   /codon_start=1
FT                   /gene_family="HOG000233021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264364"
FT                   /orf_name="AFUA_8G04810"
FT                   /product="Casein kinase, putative "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85249.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000051F6EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD5"
FT                   /transl_table=1
FT                   /translation="MARVYADVNEHMPRSYWDYDSVNISWGVLENYEVVRKIGRGKYSE
FT                   VFEGINVVNYQKCVIKVLKPVKKKKIKREIKILQNLAGGPNVVALLDVVRDSQSKTPSL
FT                   IFEYVNNTDFRTLYPRFTDYDVRFYVYELLKALDFCHSKGIMHRDVKPHNVMIDHEKRK
FT                   LRLIDWGLAEFYHKGTEYNVRVASRYFKGPELLVDFQEYDYSLDMWSLGAMFASMIFRK
FT                   EPFFHGQSNSDQLVKIAKVLGTEELFEYLDKYDIELDPQYDEILSRYPRKPWHSFINAD
FT                   NQRFISDEAIDFLDKLLRYDHAERLTAQEAMAHPYFAPVRAAESQAARNNATSQS"
FT   CDS_pept        join(1104727..1104802,1104888..1105768)
FT                   /codon_start=1
FT                   /gene_family="HOG000157793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264365"
FT                   /orf_name="AFUA_8G04820"
FT                   /product="Ribonuclease P complex subunit Pop2, putative "
FT                   /EC_number="3.1.26.5"
FT                   /function="ribonuclease P activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="EAL85250.1"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG135833"
FT                   /db_xref="HOGENOM:HBG328793"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI0000520051"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD4"
FT                   /transl_table=1
FT                   /translation="MFYDLNVPYSSDDPEISDTLSFLAELGYTTVALSQTISGKLPSNL
FT                   APPPAPTNAPKNLKLLSRVNLMLSDPAQNQRLASLAQVYDLVALRPTNEKALLNACTNL
FT                   ECDLISLDLSVRLPFYFKFKMLSAAIERGVRLEICYGPGVTGSGLEARRNLIGNAMSLI
FT                   RATRGRGIVVSSEAKRALGVRAPWDVINLTCVWGLSQELGKEAISEEARKVTALAKLKR
FT                   TSWRGVIDIVDGGQMSKSQVMESGMGQKGMSKKNFSQAQVTGDNLKRKASLGSEAAVEI
FT                   EKPLSKREMKRRAKKARLEAGECGGNAAGPGATVASG"
FT   tRNA            complement(1106808..1106893)
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        join(complement(1108208..1109748),
FT                   complement(1107618..1108143))
FT                   /codon_start=1
FT                   /gene_family="HOG000157795" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903137"
FT                   /orf_name="AFUA_8G04826"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27225.1"
FT                   /db_xref="HOGENOM:HBG325671"
FT                   /db_xref="UniParc:UPI0000F5185E"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA37"
FT                   /transl_table=1
FT                   /translation="MTSTSTPNHQHPPATSGPEFSNQTPHTSHVDSHAHLATSGYAPND
FT                   NQLAGLVEAATAAAGQDVSEWAAAAAVAAAAGAAGHQHHLDSYGPEIHIEDDGFGDGSF
FT                   GAGMSAGRQLRGSGSASVNDQGQSSGLSRSVSKKRKRGEDALDPALTAAGGVGLPGGPQ
FT                   QSQQQQQHHLQPPSHHYDGDNLDIRAVPPQSLSDARAAGVHSAAALFRQPSSNKKHTRP
FT                   PMSKLFASLELSPENFLHLQAAAKAYMLDPKHPERRECVGQRGKGDTEMVKLRLWNCVR
FT                   HFLEVEGNGERFFSENVVNEGMGPRSYIWPRDQQKIISLVIPLLRRMVTNERQRQYAVE
FT                   TRKGGGADERRRRKTNESFQTFTTSASPPRFSSDGQLQMHPHHHMPEEYSSSQVPMPPP
FT                   PPQMDSASQNMELGLTDLLLDGYTHDWNAIHKTYDMYNHDFELDNLWYLSGLQQPDWRG
FT                   LVAAVDSHYQVVHEGGYDCPAPCEDENIHRIINADVTSDLRWRIGGSHNTTARNEFASS
FT                   ITRDISRIIRDNLAAKQGVHASNHDHDSMPQPQLFPPQQFSSMPGNANSNAHNSISAPP
FT                   NSVYLRINIMQQGKRILPRLDVPAVQCPDLETLKQLISRRFAGQLPGLSSDSAMGASGG
FT                   SWGSSLSWKFRAWLPDGLTAVQNDGDWTMSLLSAGNVDWMDGDLKVLADLEST"
FT   CDS_pept        complement(1110637..1111878)
FT                   /codon_start=1
FT                   /gene_family="HOG000157806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056404"
FT                   /orf_name="AFUA_8G04830"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EBA27226.1"
FT                   /db_xref="HOGENOM:HBG325672"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniParc:UPI0000F5185B"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA38"
FT                   /transl_table=1
FT                   /translation="MVSSRRAVPLLGLAFFVIFLYTVNSLSKQWRRTPEGVGSGKLVAS
FT                   PSPIPSGFSNISLVENRPSRTPYAPRPQYVPGVPKPDGAEYTKMLVVPKTQNEDTNWIA
FT                   AELPDWQSAIYVVDDPSSPLHPPKNKGHEVMVYLSFIIEHYDKLPDIVAFMHSHQFAWH
FT                   NEEIFGGDAAEMLRRLNVARVVREGYMNLRCIWEPGCPDWMHPSNPEDNEQKQEETMLA
FT                   RSWGEIFPDDPIPQVLAQPCCAQFAVSRERILAIPKARFVFYRDWILRTELSDYISGRI
FT                   WEYLWHVIFTGEHIICPEVHICFCDGYGLCFGGKEEYEAYRRLGHEKQELEDELKRWKS
FT                   QAQTVEIARMRGTLGETSHLDIPEPGKDSSLQQKIYEKEQKINEVLYNAAERGMDPKAR
FT                   ALEAGRKWTEGDGY"
FT   CDS_pept        join(complement(1115738..1115761),
FT                   complement(1115567..1115671),complement(1113312..1115498))
FT                   /codon_start=1
FT                   /gene_family="HOG000157817" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264366"
FT                   /orf_name="AFUA_8G04840"
FT                   /product="RING finger protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85252.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057686"
FT                   /db_xref="HOGENOM:HBG328792"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000051EAEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD2"
FT                   /transl_table=1
FT                   /translation="MRLAAYAGASAALATAIVLKALHQRANFYAACVYLSQSSANLMIL
FT                   TNLCLLVVGFFLFWLQRLLYGPLRPIETEQLYEKAWFAVTETCLAMTIFRGELGGWFLV
FT                   MFVCLLVGKVWGWIGEGRVEFLEQQPPANPRLFHTRLAISLVLAVLYDSFMLKYCITTV
FT                   LEQARPDMMVMFGFEFAILTILSSSTAARYTISLVELYITRQQIKAKVEERRREIRAAR
FT                   EEALRQNAQTGETPPAADLPDENDIDQMEIDVPGWEEKGRWIFYLDLLTDFFKLTVYLS
FT                   FFAILFMFYGLPIHILRDVVVTIRSFVRRITDFVRYRNATRDMNERYPDATPEEVARED
FT                   VCIICREEMAHWQEPAGVGEGGAAPAQPRPRIPERLRPKKLPCGHILHFSCLRSWLERQ
FT                   QNCPTCRRPVMAPTRGRDHPPANINLVQGNGGAGPQPNVPAGNQPFGQNGPADNLPRAR
FT                   IFQFGPFRIGFGAGRGDLFRNFHQQIHQGNAPAQQANNGIPPGARQIGFGLGFGRPTPA
FT                   PVPQALPTNTPSNFVQMQNQLHQMELQIMQEINNLRVTAEQLHYVRLLQAELQRLRNPP
FT                   AASSDPNTTITPASTFQPSSSLSATLRRQFTSDPQASAIPSGDSRLPEGLSLPEGWSLI
FT                   PLQSAGQGPSGISSPVPTTAPEPIPTVQVREGPSVTENSAPAAGMNGESSSTVDAARSP
FT                   TSSLPDWGSETPTAAAHSYIESSPQNLDKELFGKPSETKESSAWDDEATNTDKSPESSS
FT                   SKGKARVVTVEDAADEET"
FT   CDS_pept        join(1116561..1116815,1116885..1118273)
FT                   /codon_start=1
FT                   /gene_family="HOG000157828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264367"
FT                   /orf_name="AFUA_8G04850"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85253.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057687"
FT                   /db_xref="HOGENOM:HBG328791"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F482"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD1"
FT                   /transl_table=1
FT                   /translation="MMASQQLLFTATRTQTFTYLLAVCPFSIAFLVFVNSSVSFVVTDL
FT                   IGLHDGEGDAVGTLGFADELLALAACPLWGVLSDRIGVRNVCVIGYGIIAVSLVVFVQA
FT                   RNVYPQLLLGRLFFSLGGSAVSTMVTAVLPAVAGETPSEQLRPGRESRAEAKSPSSRLA
FT                   GFVGMCAGSGALISLAIFLPLLARFQSWGYSPSEAIQNSYYLVASVAILVSFCCFMGLR
FT                   GLASEQGKGWHLLWASPKASASETDPLDLNKGAIQLPYLGQLGTALYLGLQNRDIFLGY
FT                   LGGFVARASSVGISLFIPLFVNHYYRRSGLCGHEQGEVPESIPRDIKQTCRKAYILASI
FT                   LTGVSQLVALIAAPVFGYLSERSRRYHAPLLFASLAGILGYTVFALLPSPQISGPDGSA
FT                   GVLVLMGLIGISQIGAIVCSLAVLSNGILRISLDSDGSEIFHTPEDPGSTSTNQVNQDV
FT                   DEHQPLLQGSPRHRGHQLSHLKGSIAGVYSLYGGAGILFLTKLGGLLFDDLSPKSPFYI
FT                   MAGFNAVLLLAGIVTGAMSCAKESVTRAEA"
FT   CDS_pept        join(1119188..1119319,1119333..1119514,1119571..1119970)
FT                   /codon_start=1
FT                   /gene_family="HOG000157839" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264368"
FT                   /orf_name="AFUA_8G04860"
FT                   /product="GPI anchored glycoprotein, putative "
FT                   /protein_id="EAL85254.1"
FT                   /db_xref="HOGENOM:HBG057688"
FT                   /db_xref="UniParc:UPI0000520047"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCD0"
FT                   /transl_table=1
FT                   /translation="MRSNAIRSLTLLTATVATAAAESTVSLFLPYVDTQSLVAEVLGSK
FT                   SSLLIALQDHPSDVRTQSASATTYRVNCVSAGDDCGIPSSGFTVIQGASTVQQAYTYDD
FT                   YNVAFGCNLGGTTSISCLVSQTDSTTTHVTATAMITDIGSFFLPVVVTGTATAGAHATT
FT                   GASVTGATPSATGQTTLATSGPSVTSGPQATGSSASASATPSHSSSGNAAIPQITGNAN
FT                   WAIGGAAMAMALALA"
FT   CDS_pept        join(complement(1121306..1121438),
FT                   complement(1120936..1121249),complement(1120728..1120875),
FT                   complement(1120066..1120685))
FT                   /codon_start=1
FT                   /gene_family="HOG000227440" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751095"
FT                   /orf_name="AFUA_8G04870"
FT                   /product="NAD binding Rossmann fold oxidoreductase,
FT                   putative"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85255.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057689"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520048"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC9"
FT                   /transl_table=1
FT                   /translation="MALVDQAATFLHQYVYSWLHSIPSKTPDALKLGVISTAQINPAAI
FT                   IHPAESHPLVILHAIASRNLSTAQKHQRNYRFTKAYGSYQDLLDDPDVDIVYISTPNSL
FT                   HYEWAAKALQAGKHVLCEKPFTANADEAKKLVELAREKGLIVEEAFHWQFHPAAHAWRQ
FT                   ILDSREYGKIICTKAAMTASPGIPRGDIRWKFDLAVVDKGIGGSAMDMTYALSFTRYAL
FT                   HAQLPQEIISVSVRPSKDDPRVDEAMYAHIDFQGPDGNPVHSRVYTDMAREKVAGVIPR
FT                   VWELPSIEVETEKAIIYYYNAMMPHLYHYISIQDKTAGKVSYKKQYSGGPLWGNVVTST
FT                   GEKGGNPHWSTYRWQLEAFVDAVKGKTPAYWVSGEESIWQMESIDSLYKAANLPVRPSQ
FT                   GTKLG"
FT   CDS_pept        join(complement(1123362..1123500),
FT                   complement(1123245..1123289),complement(1122897..1123144),
FT                   complement(1121827..1122843))
FT                   /codon_start=1
FT                   /gene_family="HOG000091977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264369"
FT                   /orf_name="AFUA_8G04880"
FT                   /product="COP9 signalosome subunit 1 (CsnA), putative "
FT                   /protein_id="EAL85256.1"
FT                   /db_xref="HOGENOM:HBG057690"
FT                   /db_xref="HOGENOM:HBG328788"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="UniParc:UPI000051EAEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC8"
FT                   /transl_table=1
FT                   /translation="MDSTLPDAFDASQTGLYAGQASSTGVLDPEGTNGNMIASAPFVKV
FT                   DDPPKFELESYIANYTGTCSTYLSTEALKAAVVEAKAGKDVVRYQQAVRALAEVSPNEP
FT                   EAIEDTKWVDHMQRVVKSETDRLEHELRGYKNNLIKESIRMGNEDLGLHYHQIGNLVAA
FT                   SKAYSRMRDYCTTPSHIASMLFKIINVAIERGDWLSVQSNVHRLRNLQSKPEEQAKNQP
FT                   KISAALGLSQLHSGSYLDAANSFLTTDPSLGDSYNEVVTSNDVAVYGGLCALASMDRNE
FT                   LQRRVLDNNSFRNFLELEPHIRRAISFFCNSKFRPCLEILESYKADYLLDIHLQRHVST
FT                   LFTRIRTKAIQQYLVPFSRVTLDSMLKIFAPGVAAGQAHPTDFNSPFVQELITLIQDGT
FT                   LDARIDLEKGVLVSKQTDLRTDVQRAALESLVNFRKEAHLRLLRTNILRAGLEVRAPGD
FT                   DRKLRPEDRGVGKGLAGLGGKYSR"
FT   CDS_pept        join(complement(1126630..1126699),
FT                   complement(1126475..1126566),complement(1126016..1126384))
FT                   /codon_start=1
FT                   /gene_family="HOG000157850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751096"
FT                   /orf_name="AFUA_8G04890"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85257.1"
FT                   /db_xref="HOGENOM:HBG057691"
FT                   /db_xref="HOGENOM:HBG328786"
FT                   /db_xref="UniParc:UPI000051ED04"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC7"
FT                   /transl_table=1
FT                   /translation="MVGLVSSQTWTAVNISAIDQSTRSKWCLDQTSSCPLLCLQINATG
FT                   DPRQNECDSCVCSNGISPNTSEYSQTIPYYLCTEANNECVSRCSEADSACQSACRSEHP
FT                   CGAQNPTRYNVTTTSATSNPTNNPATTTTLAAFTGEATNKNAAVRISPVDIGHVYGLCV
FT                   VVGCFIAGFAVLL"
FT   CDS_pept        join(1128624..1129049,1129165..1129332)
FT                   /codon_start=1
FT                   /gene_family="HOG000157861" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264370"
FT                   /orf_name="AFUA_8G04900"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85258.1"
FT                   /db_xref="HOGENOM:HBG057692"
FT                   /db_xref="UniParc:UPI000052051E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC6"
FT                   /transl_table=1
FT                   /translation="MEPANEETGSVPPPQPSSSPPQLSTSPPAVDRDTIVAAALSDGVS
FT                   VSNDSVLPQARYVSSTDRPVSGVIPPYWSHHRNISRTSQISLDQPAITLEDHTEDPNSE
FT                   TSRGLWAKSVTVDDYAVVQGKTGVGAYVVWNCRIQTLDLDDSHLAHKRTDTPNLMTYDG
FT                   NCKSRSHMRRTLYQHCLLKVCSVCVSEWTKQTLS"
FT   CDS_pept        join(complement(1131973..1132078),
FT                   complement(1131727..1131777),complement(1131500..1131676),
FT                   complement(1131261..1131449),complement(1131017..1131213),
FT                   complement(1130944..1130967),complement(1130594..1130888),
FT                   complement(1130463..1130520),complement(1130270..1130401),
FT                   complement(1130014..1130198),complement(1129786..1129952))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264371"
FT                   /orf_name="AFUA_8G04910"
FT                   /product="Choline transporter Hnm1, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EAL85259.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG327463"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI000051E641"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC5"
FT                   /transl_table=1
FT                   /translation="MGDSKMASPVADVVDDHGANIIRVQNADELRLAQMGLGLGLITSI
FT                   NAGGPGALIYGFILVFILQCFLATSLAEFVSAYPVEGGMYHWIAAIAPKRYNSILSFAT
FT                   GWSTVFGWIFTTASTNLIYATNFMALIALYKTDLVIQPWMTFVAYQGFNILTGGTVMFG
FT                   NRFIPLINKFSFAQVCYLQLAWFVIMVTVAAAAPKHNDSEFVFRTWMNNTGWENNVICF
FT                   ITGLVNPLYSLGGLDGITHITEEMPNPGRNAPLALGELFPSLQPLTLQLMSRIACTLGI
FT                   AFVTGLTYLLSLMYSVQDYSSLASTQTGLPLAEIFRQATQTRGGAFALTFMLWVALGPC
FT                   MLGSQLSTGRVFWAFARDGGLPFSRIWAKVNPHFETPFNAQLCVGIITALLGCIYLGSS
FT                   TAFNAMMSSAVTINNLAYLVPILTNVLVGRRTMHHGPFYLGHAPGMAVNIITVAWLVFA
FT                   IVFFSFPYYMPVTAANMNYTCVCVGGFLLIALLWWVVAGDKYSKNMQKAREEEQNAARA
FT                   MMVTHEGKE"
FT   CDS_pept        join(1134819..1137998,1138058..1138588)
FT                   /codon_start=1
FT                   /gene_family="HOG000157872" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264372"
FT                   /orf_name="AFUA_8G04920"
FT                   /product="LEA domain protein"
FT                   /protein_id="EAL85260.1"
FT                   /db_xref="HOGENOM:HBG057693"
FT                   /db_xref="HOGENOM:HBG326505"
FT                   /db_xref="InterPro:IPR022124"
FT                   /db_xref="UniParc:UPI00005202A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC4"
FT                   /transl_table=1
FT                   /translation="MSSPSVRNPVQRNPGTTHKSRKGSGSSAASSRPEITTPKNKKTPR
FT                   KLQTRTPQPVEEDVDDEKPPTPSPQPTKKKFQPESVQPEVSLAPEGNRDEPEQQEEDKT
FT                   ALPARPKKKRSKPEAEQRGISSPLPGDVQPQASGSASRGDKATDLTGTAKALGGKVKDT
FT                   AQDTREEVKEDVPSTPLDLSALKGLEIGEGGQVVGKDGNPLGRVVEGEPEDLVGQEVGD
FT                   DGEILDEDGDLIGRVELLPDAAQNLADKAKDVPEQAENVASQAKGTADETANQAKDKVE
FT                   ETVDQADDKAEETTEQAKNTVTELANLDGLPVSEEGLIKNKDGQAIGKVAEGDPEDLVG
FT                   YTVNDKGEIVDEDGDLIGRVELLPQEAQDVTDKAREIPEQADDAVEQAKDKAEETTEQA
FT                   KKTVTDLADLDGLPVSEGGVIKDKSGQVVAKIAEGDAEDLVGYTLNNEGEVLDEDGDPI
FT                   GRAEIVSQQAKDVTDGFDDTEKLAPEDQSTQEDVAKQAVESVQQQDVDDTAEKAESAAD
FT                   DTKEEAEEQLPPLSSLEGMKCTKSGKIVDPDTGKPIGELVEGDAKKISRMGAQLDDKGQ
FT                   FWDNRGNVIGKAKSLPVEDYEGEPPFAGLEGLHVVEDGWVEDENGKRVGKIVQGDPKKL
FT                   LGRAVDEDGDITDKNGNVIAQAEYYESPDEPEPEKPDLSQLNGLKPNKLGFVIGPDGVP
FT                   IARVIEGNPKELAGKEIDDGQIWDGRKPIGRVELIPEEERDKKPEGVFAGLDNLVVNKE
FT                   GFVEDDEGNIVGKVTEGDPKKLRGRAVDEDGDIIDKYGNVKGHAEPYEPEEEEEEKPDL
FT                   SVLEGKIVNKAGNVVDAQGNIYGRIVSGDGKRLAGRKVDGQGQIWGDNGKVIGRAEIVP
FT                   GAEQEKPEGQFYGFDNVEVGKDGFVMAGGRIIGRVIEGDAKRLLGRKVDEDGDILDKNG
FT                   NIIGKAERLEPEEKKRDVNPMSGRKVNKEGEIRDADGNLIGKLTSGNLPTLVGKSIDDN
FT                   GYVVDNDGNKLGECTLLENLPEEEEPEPGLTQEESEAQKKAEQDRDLAKKMAGIIRQTL
FT                   DRLQPTCKRIAELLEKADRTPRDELDEEKLVKEVRPLIEEGGQVLQECNGAIRALDPDG
FT                   SIASTAKARAASHEASPEEYALAEKIKELSELVMTTIENGRKRIADMPHAKKKINPLWA
FT                   LLSDPLFQIIAAVGLLLSGVLGLVGRLLDTLGLGPLLNGLLGGLGLDKLLGGLGLSSLT
FT                   DSLGITGSKKD"
FT   CDS_pept        join(complement(1140235..1140601),
FT                   complement(1140117..1140150),complement(1139143..1140052))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264373"
FT                   /orf_name="AFUA_8G04940"
FT                   /product="Sn-1,2-diacylglycerol cholinephosphotransferase "
FT                   /function="transferase activity"
FT                   /protein_id="EAL85261.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG057695"
FT                   /db_xref="UniParc:UPI000051ED0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC3"
FT                   /transl_table=1
FT                   /translation="MPLKSYKYQSVDKSYISNHILKHYVLCPLFLPHTIRSRSDGKIVT
FT                   LVECICRSSPAMDCSKHGHTIGLPFHSRKCDAHRGAYARSYRTGTHRSNTKKSTHGLLT
FT                   LCPRVLPGCTIVSLLACGSSAEDRDVEWTGHGIDSLNCTLASLLETAAMGFGSSQLGAY
FT                   TALVPCLAMYFSTWETYHTHTLYLGYINGPTEGLLVAIGIMIASGYYGPQIWSRPIVEF
FT                   LNFPQIFGNYSVKDVWVPFLLLSFFVGHLPGCVFNVIEARKKQGLPVSTIFKEWVPMIV
FT                   FTICNIAWLFSPYSTLLAQNRLVLYCWTISFVFGRMTTKIILAHLLRQPFPYWTVQLTP
FT                   LIGGAILANLPHLGLPAVSAWVELLYLRAYLLFAFVAYMHWAFLVINRITTFLGINCLT
FT                   IKKDRSMAREQAYRNFGESLLEVPDATDPLKGGLKHH"
FT   CDS_pept        join(1141429..1143744,1143809..1144177,1144228..1145619)
FT                   /codon_start=1
FT                   /gene_family="HOG000157894" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264374"
FT                   /orf_name="AFUA_8G04950"
FT                   /product="Transcription initiation factor TFIID subunit
FT                   TSM1/127kD, putative"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="EAL85262.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG059691"
FT                   /db_xref="HOGENOM:HBG397545"
FT                   /db_xref="UniParc:UPI000051ED14"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC2"
FT                   /transl_table=1
FT                   /translation="MPGVVDTPGGPLWPGLGFTVAHQKVELEIDFATKSLKGKTEITIH
FT                   PHYKELRIIRLNFRQGELKRLNVNGKAPTIKYADPYESLQLYGPHYHQRLSTKIDSLLT
FT                   TTPEPDLLVTIPKSVRIEELDPFSQEAQDQMTLRASGAGEDTDGPLGSKLAETSLPRFS
FT                   ALTVYIEFTIENIRDGLQFVGVDSGDRRYPHAYTTNSLGYGAASPLFPCVDDPLSRCTW
FT                   EISVKCPCSLGDVFDRKTRDPSGAHRSKQTPGGSRFISPDDETLDLSVVCSGDMTDEIV
FT                   DPRDPSKKTVSFACMSPLSAKQIGFAVGPFEYINLSDFRESDQDEQLGQNAIPLHAFCL
FT                   PGRGDEVRNTCFPMAKAIDFLSLTYGSYPFASYKICFVDDAPENTLPTACLSICSNHLL
FT                   FPEDIIDPMYDSTRALVHALSCQWIGVNIVPKEPADTWVTVGVAWYITDTFLRKLCGNN
FT                   EYRFRLKLMSDRVCDLDYERPSIYDMGNILNLDPSEIEFIALKAPLVLFILDRRLTKAS
FT                   GKATMSRIISRMFLNARMGDIPNGAITSSQFQKICERLGHAKLDTFFQQWVYGAGCPRF
FT                   QATQRFNKKKLVVEMMIKQVQADQPSTRDLDKNTFMRDVKEEIRGVYAGNIQPVFSGSM
FT                   TIRIHEADGTPYEHIVEIKEGVTKFDIPYNTKYKRLKRNKRQKERAAAVSGGDPNAETQ
FT                   EDVLLYCLGDVLQTEEEMQEWRLADWSKEDEDRMGQESYEWIRMDADFEWICKLSLVMP
FT                   GYMYLSQLQQDRDVVAQLESLQYMAAQREHPLISTIFVRTLMDRRYFYGIREAAARALV
FT                   KHAKEETNWLGLFHLERAFQELFCLPGSPMTRSNDFSDRAAYALQLAIPEAISKVRDND
FT                   GKTPLRVKRFLYDKLKFNDNSNNEYSDHFYVATLMQSLCHAMLGKVESRDVDIDDFDME
FT                   RMLEIQAEEQLEKDAIAEFDRYRRMDEWSSSFQNVYSRAALRCQMQLMRAKILDVDIMQ
FT                   FLPYTRAGTYDLLRADAFECLVELDIFKSPELVKWFMFTMSSDSSLWLRRRLHDLFGKA
FT                   LAPVAFGREPENEPSATADSLIIEQESSTKVRQADLARKQTVTGAIEALKGEISGDQNF
FT                   KECLWAACNSPGIGILELSVFTDLCKVLYDSVTSVMVKLKYPRYWQVKHLGKVIPFQSW
FT                   ISNLILIASGPHAFLTVQPNQDYPRTLKRFLHKWEAQTRRERDASTWAPYHIQAIEAGF
FT                   KHPLSKSSSNLATHSEAAHPKPLRFAGTSATEDAGCSVDAVDTKWWRRRAQTETQIRAE
FT                   AEISCLPAMVFYRNFFTSVLFTSHLFETWRGMVEQASRRMAGRPVSNDLYMLTFIIFYD
FT                   GAACSLALGFIGFFV"
FT   CDS_pept        join(complement(1146358..1146387),
FT                   complement(1146216..1146287),complement(1146034..1146108),
FT                   complement(1145918..1145977))
FT                   /codon_start=1
FT                   /gene_family="HOG000223546" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751097"
FT                   /orf_name="AFUA_8G04960"
FT                   /product="Small nuclear ribonucleoprotein SmG, putative "
FT                   /function="nucleic acid binding"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="EAL85263.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000051F493"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC1"
FT                   /transl_table=1
FT                   /translation="MPQAQPELKKYMEKRVFCQLNGNRKVIGVLRGYDVFMNIVLDEAF
FT                   EEKQGGEKVAIGMVVIRGNSVVMLEALERISEK"
FT   CDS_pept        1146748..1147908
FT                   /codon_start=1
FT                   /gene_family="HOG000157907" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903138"
FT                   /orf_name="AFUA_8G04970"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85264.1"
FT                   /db_xref="HOGENOM:HBG057696"
FT                   /db_xref="HOGENOM:HBG328782"
FT                   /db_xref="UniParc:UPI000051EAE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCC0"
FT                   /transl_table=1
FT                   /translation="MPDNGPVVKRPNPLKSKQKSKLRLSFGPGETSMTDDGGQESEVVL
FT                   PKRHGLGRRALEKSALQRAGKPPGLGDQLPIRVPEQERPSYSEDYLKELRNSTPSTPKA
FT                   ATDDEKDKTVDVAAKFGEVMKVSAPSAIPSEAEIREKKARRARLAKELASGTEEQDFIS
FT                   LEENMSDEEWGLKKTEKEDMRDTRLIRDDEDFAEGFDEYVEDGRISLGKKAEREQKMKQ
FT                   REQMRELIEEAEAISDEDDSDLEEKAAYEAAQTRAAIGSGGRDHINRPRTPPKITSLPR
FT                   LSTSLERLRTMLAVLEKSRTQMINRMEDLRKEKADIAVREVEIQALIKEAGDNYERLRQ
FT                   EAGLTPGSEEDLSIATDIKNARGLESFGASIAGSAGDSGSQSPSST"
FT   CDS_pept        1149447..1150007
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264375"
FT                   /orf_name="AFUA_8G04980"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85265.1"
FT                   /db_xref="HOGENOM:HBG057697"
FT                   /db_xref="UniParc:UPI000051ED05"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB9"
FT                   /transl_table=1
FT                   /translation="MEIDYGRGAMKEKAIISDILEELLTLPLCPTNVTSNGYFLTHDRM
FT                   DDLVGNVTAALFSSMGITPSEGRDISQLNNSQLLMMYVEVLGFVYVYFFVVASVAMFLF
FT                   AAFTLLAHRHQRKLYVGIGVAVRLVLAALVLGMVSFVQHFALAYSFMTSPAILYAFTVI
FT                   LLTSESSWPSLHHGASSDVLSRM"
FT   CDS_pept        1152745..1154373
FT                   /codon_start=1
FT                   /gene_family="HOG000157929" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264376"
FT                   /orf_name="AFUA_8G04990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85266.1"
FT                   /db_xref="HOGENOM:HBG057698"
FT                   /db_xref="UniParc:UPI000052005C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB8"
FT                   /transl_table=1
FT                   /translation="MAGETSPYGSCHAQCPHVPCRCPVNPNNAHSPPVKLPMHVLHPPS
FT                   TTAIDDRSGELGNRKGNMASLKAMLRMLVSPDHSKTCLIFKKNPDSIDTEPASYLSGNR
FT                   EYLSQTKLCDQQSELCARKMINYDQAWTNHCTGVTEGLSEATVDTSNKLPMADEQTMEP
FT                   NVCSWSDMLTSFESGHGLAPEYCTCPANIQTLHRPTQPEKGITGPENSEQHDELKLDVA
FT                   IQDSDFRDEVAKSDNYHCGLMHSIPRPSLYMAADPFGSSSETNATSHTIPPSVSRESLP
FT                   DSFKGGLRKVHRPYGHIEGAMIFHDQSSPGSSVATTNYPYNPMANTCSGSTPIHWSRDG
FT                   QMVPWEMQTLGFELQNNCFSQLRHHGGRVAEIPRNPTLDACHGLPSVDCSQHYSQQPPS
FT                   VLYPFTPHEYNSTSANDRSAVDDGHCQLTYTNANLTYPQHRHEIMQSVHLESASDGALT
FT                   HQGRKSTRSISCHNEVRNAFLIECKRRGLSYKDIKRLGGFEEAESTLRGRFRTLTKSKE
FT                   QRVRKPQWKDKDVSDRKPSVPFVLS"
FT   CDS_pept        join(complement(1155880..1156225),
FT                   complement(1154887..1155827))
FT                   /codon_start=1
FT                   /gene_family="HOG000157940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903139"
FT                   /orf_name="AFUA_8G05000"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase, putative "
FT                   /function="catalytic activity"
FT                   /protein_id="EAL85267.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG057699"
FT                   /db_xref="HOGENOM:HBG328778"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019200"
FT                   /db_xref="UniParc:UPI000051E89B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB7"
FT                   /transl_table=1
FT                   /translation="MLLPVVKGEWVMSAFDVIVLVHVDSDSPQMPGQVLLRNLRSHRAN
FT                   NHFILFLSVPSGTESIAKRSTQTSTNMQLGLRESLPALVAKRFTAAKENGHLIFSHTHL
FT                   SIINSGGIAVGLLTAAFFKYQLRYCPALANKPSGAPKSDKDWPGPKPDPFENPSTDLLI
FT                   AQIPQENPKYTLVLNKFPVIPNHFILATKTWKSQTDILEKEDLDAAYACIKAWRDNQTE
FT                   QGDSGSNRLFAFFNSGDESGASQPHRHLQFLPVEDMSQGDSGNWQPLIDTISSQWVGPD
FT                   SEYRRLSQIPFAHFALPLPPNPTADTLHAIYLSLYRVALWTAKGSLEDHSRVTDGPAAI
FT                   SYNLAMTESMMMICPRRCEAARIPVDPSALPNVQEPGVVALNGTILAGTLMVKAEAEWN
FT                   ELRRNPDTLAGILASVGYPQPDSCGLALL"
FT   CDS_pept        join(complement(1158260..1158758),
FT                   complement(1156713..1158085))
FT                   /codon_start=1
FT                   /gene_family="HOG000157940" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903140"
FT                   /orf_name="AFUA_8G05010"
FT                   /product="C2H2 finger domain protein, putative "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85268.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057700"
FT                   /db_xref="HOGENOM:HBG328777"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0000520746"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB6"
FT                   /transl_table=1
FT                   /translation="MLALDSSRQQQTSYFQDVHMDPALVDPFGFQMDNLGGFGQTSGPT
FT                   SAPTSYYGTSPVYADSQLEPKTSAFPPMPPTPPSLPVPYSTEPYMSGLSSASGPSIASA
FT                   SSSAIGSPYSCTAHTFPESWVDTNHGIGLPAAVMDEFFPNEFMGSSLEADHTYQRKGPD
FT                   DFVEHSNFSANCGFFLQSPDQSHLPVAENYSADHLSQTGLAVSSPMPNSGPHSRSVSIY
FT                   DRRSSISSTNSRRSQLSPAASVADFDEESKEKGRCPHPDCGRVFKDLKAHMLTHQSERP
FT                   EKCPIVTCEYHVKGFARKYDKNRHTLTHYKGTMVCGFCPGSGSPAEKSFNRADVFKRHL
FT                   TSVHGVEQTPPNCRKRSPGASSVKKVSDYCQDATGKCSTCSATFSNAQDFYEHLDDCVL
FT                   RVVQQVEPSEVINQQRLAEVDCDEEVKKTMEKHKLLDAAGDVDDEPEEDDDDYNELNLQ
FT                   LRSSKGAFKSNKANSSLGSRPIMGNHNAVTKNGKARATISKRRNNRDRYPPSWGCPSSS
FT                   MKTKKRVLCVFDGQRRLWKDEMMLDNEFEVRLKLPGGAGDGTNREAYITDLDVETLKRA
FT                   EGVLSANEDEKGPWLEGPATHFMGQPAKMLPALSHTHEDVDIDDLMS"
FT   CDS_pept        complement(1170627..1172429)
FT                   /codon_start=1
FT                   /gene_family="HOG000157972" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264377"
FT                   /orf_name="AFUA_8G05020"
FT                   /product="Beta-N-acetylhexosaminidase NagA, putative "
FT                   /EC_number="3.2.1.52"
FT                   /function="beta-N-acetylhexosaminidase activity "
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="EAL85269.1"
FT                   /db_xref="GO:0004563"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG352302"
FT                   /db_xref="HOGENOM:HBG591688"
FT                   /db_xref="InterPro:IPR001540"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051E3EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB5"
FT                   /transl_table=1
FT                   /translation="MLISSICAVVLTVASSVAAVSVNPLPAPRNITWASSGPKRLAGHL
FT                   TLRTDRGSNSQIIWQGWDRAWKTIVSLQWVPAATEAPISSFEPFPTATPSSSKSKRAPS
FT                   SLQFVNVKVEDPKADLQHGVDESYTLDVKEGSDTIQITAKTVWGALHAFTTLQQIIISD
FT                   GKGGLIIEQPVSIQDAPLYPYRGIMIDTGRNFISVKKILEQLDAMSLSKLNVLHWHLDD
FT                   TQSWPVQINAHPEMVKDAYSVRETYSHADIRQIIAYARARGIRVIPEVDMPSHSSSGWK
FT                   QADPKMVTCADSWWSNDVWQYHTAVQPNPGQLDIIYDKTYDIVRDVYNELSGVFTDNWF
FT                   HVGADEIQPNCFNFSTYVQSWFAEDPSRTYNDLSQYWVDHAVPIFRNVSEKRRLIMWED
FT                   IVLSPEHAHDVPKDIVMQTWNNGVEYIQNLTARGYDVIVSSADFFYLDCGSGGYVTNDP
FT                   RYNVLSNPDPSTPNFNYGGNGGSWCAPYKTWQRIYDYDFTTNLTDAQAKHIIGATAPLW
FT                   SEQVDDVTVSSKFWPRAAALAELVWSGNRDANGKKRTTLMTQRILNFREYLLANGIQAG
FT                   NLVPKYCLQHPHACDLYYDQSAVA"
FT   CDS_pept        join(complement(1174083..1174416),
FT                   complement(1173733..1174025))
FT                   /codon_start=1
FT                   /gene_family="HOG000157973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264378"
FT                   /orf_name="AFUA_8G05030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85270.1"
FT                   /db_xref="HOGENOM:HBG126725"
FT                   /db_xref="HOGENOM:HBG205286"
FT                   /db_xref="UniParc:UPI000051E891"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB4"
FT                   /transl_table=1
FT                   /translation="MLRIPSPFTSRLSTRRLLFSSRSVTHFQRLYTSQPQPQHQVTKCC
FT                   SKKEKEKETEESVLTLSFWSSKQGWKRAAVNTLRCLAGCTLGDFSALWVLQSFYGHWGM
FT                   SAIMGVSMASGITTSILLETVLLRRGVDKLPWGLAFRTATGMSLVSMLAMETVQNLVDY
FT                   HLTGGVVLLDDPRFWAAALVSMGAGFLAPMPYNYWRLVKHGKSCH"
FT   CDS_pept        complement(1174836..1175786)
FT                   /codon_start=1
FT                   /gene_family="HOG000173607" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903141"
FT                   /orf_name="AFUA_8G05040"
FT                   /product="Dihydrodipicolinate synthetase family protein "
FT                   /EC_number="4.2.1.-"
FT                   /function="lyase activity"
FT                   /protein_id="EAL85271.1"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="HOGENOM:HBG358848"
FT                   /db_xref="HOGENOM:HBG370502"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000051ED15"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB3"
FT                   /transl_table=1
FT                   /translation="MTTNGTTTRRRPLVPGIYVPTVAFFKDDEEVDLPTVEKHAAYLAD
FT                   AGVTGIVVQGSNGEAVHLDREERKLITSATRRALDAAGATSMPLIVGCGASSTRETIQF
FT                   CKDAADAGGDYVLVLPPCYYKSLVNNAALLDYFRDVASASPIPVLIYNFPGASSGLDLT
FT                   SDDILTLAKHPNIVGVKLTCGNTGKLARIAAQAKPDFLTFGGSADFTLQTLIAGGAGII
FT                   GGVANLIPRSCVRLMELYRSGKIAEAQTLQAVVARADWLAIKGGFVAVKSALQSYRGYG
FT                   ALPRRPCVPPSAEEASALKNAFQEGMEMERSFEVA"
FT   CDS_pept        join(1175994..1176293,1176386..1176470,1176558..1176694)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903142"
FT                   /orf_name="AFUA_8G05050"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85272.1"
FT                   /db_xref="HOGENOM:HBG057702"
FT                   /db_xref="UniParc:UPI000051F93E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB2"
FT                   /transl_table=1
FT                   /translation="MVPVPTPFDAMMKIDRIKFNGRSTNIAASGNRVDTGKPPRLDPTE
FT                   WRPVRSRNPDCVGETLEYSVDQRAIVTLIDIIGGGVASDDIGACVGTDAAARFYSYGIE
FT                   RSFELLLWNEAVTPTDSSIMVAYEGERMIFLIGKNSDECSRGVIFEVEESLSRLVAHLP
FT                   LVVWGWGILL"
FT   CDS_pept        1177486..1179432
FT                   /codon_start=1
FT                   /gene_family="HOG000157984" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264379"
FT                   /orf_name="AFUA_8G05060"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85273.1"
FT                   /db_xref="HOGENOM:HBG057703"
FT                   /db_xref="HOGENOM:HBG328769"
FT                   /db_xref="UniParc:UPI000051F211"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB1"
FT                   /transl_table=1
FT                   /translation="MAVRSRPSLRFSVRRDDNASGHDDDDHQDNHDNTLLSSPPPAKRP
FT                   RLQQQQQQQQQRRQPPSSRRRKSSPDLLDTTIENSSHRAPPSSKPPQVVRPTAHSPVPP
FT                   PPHLSTRRPPAPSTAGDSVSFSSSSSSSNSACVPLPGTPHTAGRSHEHRHTPLSASAAL
FT                   YMHGGSGRESPDPLDIISPAPTKANSQPRKTPTTSTPTSTTRSTRRSRPRQSIASDVDA
FT                   QKPSEQTSSRRKPKSANPNTEPQSQPKEEPANPSSAAPEQRRSLRSKDSNSRLRSELAS
FT                   YFWNYEQILSLDPPKTVELLTENTTIKLIDDLTEPLTIQSSTPDSESPFGNPLLQLHDC
FT                   EKISLPEPEPEPRSDAAPGDVKEEDPLNDGYYFRAHRRMERQEKQLRNIERERAQHEKM
FT                   QLERLLDELKGHDWLRVMGITGVHEHEKKLYEPKRDYFMKEIASLIEKFQIWKEEEKRR
FT                   KLDKDKPSRRAEISPSTAPTNRDHTTSQKRKRSDRTPDTTAERPTHNGAATADGESDGE
FT                   PPDPSDVDAWAAHQLQQEARSATAGKRPKSSTEAPRRRKSSANKSSTAPPAVAKPATPP
FT                   PPDKPFTSFYAKPHLREAALSPHRKGRVRLAFGHPIPKMEVREFQPPADILTPEAIDSC
FT                   RRKRRRMRRESRG"
FT   CDS_pept        join(complement(1181417..1181601),
FT                   complement(1181260..1181346),complement(1180868..1181199),
FT                   complement(1180675..1180815),complement(1180405..1180619),
FT                   complement(1180152..1180352),complement(1179868..1180095))
FT                   /codon_start=1
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751098"
FT                   /orf_name="AFUA_8G05070"
FT                   /product="Neutral amino acid permease "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85274.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG051937"
FT                   /db_xref="HOGENOM:HBG332600"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000051F216"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCB0"
FT                   /transl_table=1
FT                   /translation="MIQSVNDPPLSNPENLQEKGIASRDASLAEDEKKYAATLAYRQDA
FT                   FGDESNAEVKYKVMKWWQCGLLMVAETVSLGVLSLPAAVAGLGLVPSVILLVSLGIIAT
FT                   YTGYVLGQFKLQYPWVHNMGLAGEVVFGSWGREILGAAQMLLLVFIMASHILTFVIAMN
FT                   TLTDHGTCSIVFGVAGLIVSFILSLPRTLAKMSWLSLVSFISIISAVIICMIGVIIKHP
FT                   GGKVMATVDTDLVHGFSAVTNIVFAFSGHAAYFGLMAELKDPRDFPKALMLLQSVDVCL
FT                   YIIAAIVIYVYGGDEIASPALGSADPLISKVAYGIALPTIIIAGVINGHVAIKYVYLRI
FT                   FANKKERIHKRDWVAVSSWVAIALSLWTVAWIIAEAIPVFSNLLSLITALFASWFTYGL
FT                   SGIFWLYLNRGQYLSSPRKMFLTIVNLFCLVFGAVLCGLGLYVSGKAIHDNPSSMSFSC
FT                   ANNA"
FT   CDS_pept        join(1181984..1182173,1183377..1183471)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751099"
FT                   /orf_name="AFUA_8G05080"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85275.1"
FT                   /db_xref="HOGENOM:HBG057704"
FT                   /db_xref="UniParc:UPI000051F6EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA9"
FT                   /transl_table=1
FT                   /translation="MDRVVAVGREKSHFGQQNESSISNVTKTVRNGGVHPENPQKNYPL
FT                   WDLGKKKSKTRGYPMSVCDTNSRLAESCKIIAVSISKHQCGDAPSVTAY"
FT   CDS_pept        join(1184841..1184991,1185050..1185661,1185721..1185957,
FT                   1186074..1186106,1186179..1186354)
FT                   /codon_start=1
FT                   /gene_family="HOG000158006" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207691"
FT                   /orf_name="AFUA_8G05090"
FT                   /product="MFS transporter, putative "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="EAL85276.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG057705"
FT                   /db_xref="HOGENOM:HBG328767"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000051F209"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA8"
FT                   /transl_table=1
FT                   /translation="MDRENQNDGSVEDVENSTSKESSFFTQKDASQVVGRLISTNYAVM
FT                   MAGLNDAATGVLIPYLQPAYDIGLLKVSMVYLINFAGWLVASFANIHVCSRLGSGGTLV
FT                   VGATIQCFGYVLMFWKPPYPLFMTAFFFTGMGVAFQDAQANVFTVTVRNAHRWLGILHA
FT                   VYGVGTIIAPLIANTIASRTPYWHYYYLAMFILGVINVVLLAWTFRRGLFKPNVSNAKD
FT                   ANAELKATLTNKVVWIFNGFFFLYVGAEVASGGWLVQFLVSVRHGDPKKVGYVASGFWS
FT                   GFTLGRVLLADITHKLGERRMVFFYIALSIALQVMFWLIPNIIANAVTVCLLVIPQELH
FT                   IGALGFTASLGQAGSAAFPFMTGAIASKTGVQVMQPIMVGLLVGIGIFWALLPRQLSTR
FT                   SAG"
FT   CDS_pept        join(complement(1188280..1188312),
FT                   complement(1187695..1188219))
FT                   /codon_start=1
FT                   /gene_family="HOG000158017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056405"
FT                   /orf_name="AFUA_8G05100"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85277.1"
FT                   /db_xref="HOGENOM:HBG057706"
FT                   /db_xref="UniParc:UPI000051E642"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA7"
FT                   /transl_table=1
FT                   /translation="MPSLQIPSVTIEDLQTFQAKHFPSSQQVTSLDYIYGETVDDDIDD
FT                   DDDGLGYYPDGVKRTLTDEQIRIFRHSEIHSLLRQKQLREEELAEVARESTPVRQAAGG
FT                   IAEGQEDRPSSIPGSQQEKIPNAKEGSGLESHEAKDSSITKRADEAGSQERLDYDDDAT
FT                   VQREAHARGPNFAGRRIISYED"
FT   CDS_pept        join(complement(1190134..1190398),
FT                   complement(1189861..1190086),complement(1189377..1189806))
FT                   /codon_start=1
FT                   /gene_family="HOG000235062" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264380"
FT                   /orf_name="AFUA_8G05110"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85278.1"
FT                   /db_xref="HOGENOM:HBG057707"
FT                   /db_xref="HOGENOM:HBG328765"
FT                   /db_xref="InterPro:IPR019146"
FT                   /db_xref="UniParc:UPI000051E892"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA6"
FT                   /transl_table=1
FT                   /translation="MALVQYSGTESDTEESEEKPPRPAKKSRHNSSSVDDRVSSLPPLP
FT                   TAFRDLYASSTRVSVRDDPSLHGGRKRVIPHVEGNWPTHIYLEWYPSKAELTVLDGILS
FT                   QVEVKLGGDAGEIHSLLRSDLGVQLPLHISLSRPVVLRTEQRQPFMDMFQTALQESVVP
FT                   AFSVSPCSLDWVSNYERTRWFLVLRVTKPTNDNLNRLLSLSNRSLAHFGQPSLYAGNPA
FT                   SPVHRLGRHENIKPHTQPEELSHCFHVSLAWSLIEPTTEQKERIDAVDIRRLRILSIHF
FT                   DCVKVKIGNNISSIPLSTVQSFSVI"
FT   CDS_pept        join(1191942..1192610,1192668..1192793)
FT                   /codon_start=1
FT                   /gene_family="HOG000158028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751100"
FT                   /orf_name="AFUA_8G05120"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85279.1"
FT                   /db_xref="HOGENOM:HBG057708"
FT                   /db_xref="HOGENOM:HBG328764"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniParc:UPI000051FBC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA5"
FT                   /transl_table=1
FT                   /translation="MMSSGDSMYMASYPSRWNQPSHYPVNVDMAMESGSDNPFLRYISP
FT                   SPTPSLSSSTPTLNTVTLERSPSVPSIYWSGELEHQPVEPRRRRNTYHPTYAQQSTQGN
FT                   RHRSRYRRGSFLVTPDVIDRLDNAGVFHYHHESPYDAVYAERNHDAKTSPIAALEDSNK
FT                   EALKATPEDKIADCLNSHRPLDGVAFYPPGTTDREGRTYEYEEGTNMMNDYGNFVRFPG
FT                   LRFTEEDFRNDPFYNSPLPKPFEIIRRAFNRHCRGWKRNKTT"
FT   CDS_pept        join(1193735..1193972,1194053..1194369)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264381"
FT                   /orf_name="AFUA_8G05130"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85280.1"
FT                   /db_xref="HOGENOM:HBG057709"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI000051E896"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA4"
FT                   /transl_table=1
FT                   /translation="MAEVRAHSPLTLRPVHPPKVEKRATKPSIARHVNIRVNDPLDHDA
FT                   PAILHEPRSYNFNESKGSAVVLVSGAGGGVSGPGSIYPSIADKLALLLGIPSIRLDYRR
FT                   PARTEYCSADIVASFTYLREHFNSTTFVLIGWSFGGSPCFTVAAQDDRVRGVATVASQT
FT                   ANTVGIKRFESTTGALAAWDR"
FT   CDS_pept        join(1195319..1196988,1197049..1197175)
FT                   /codon_start=1
FT                   /gene_family="HOG000158050" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903143"
FT                   /orf_name="AFUA_8G05140"
FT                   /product="Oxidoreductin"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on a sulfur
FT                   group of donors, disulfide as acceptor"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein thiol-disulfide exchange "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="EAL85281.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006467"
FT                   /db_xref="GO:0016671"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG436396"
FT                   /db_xref="HOGENOM:HBG521237"
FT                   /db_xref="InterPro:IPR007266"
FT                   /db_xref="UniParc:UPI000052074E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA3"
FT                   /transl_table=1
FT                   /translation="MRRTNSDMTTLFARLVASITKNTSRTVSDYVFVQIDPSATVSDAC
FT                   VSYVTIDSLNDQIYSLLQSITQETDFFSYYRLNLFNKQCPFWDDANSMCGNIACSVNTI
FT                   ESEEDIPLTWRAEELSKLEGPKAGHPGRKLQKERPSDKPLQGELGANVGESCVVEYDDE
FT                   CDERDYCVPEDEGASGKGDYVSLVDNPERFTGYAGPGAHMVWDTIYRENCFLKSPPEMA
FT                   LSPHPSLGGLQAVNDFRNVLQKEMKRSEQLPFDNECLEKRVFHRVISGMHASITAHLCW
FT                   DYLNKTTGQWHPNLQCFKERLHDHPERISNLYFNYALVSRAVAKLRKHLQNYTFCISDP
FT                   LQDRETKEKVSQLTAILADRPQIFDENIMFQDPSAPGLKEEFRNRFRNVSRLMDCVGCD
FT                   KCRLWGKLQVNGYGTALKVLFDYDETKNGENPPLRRTELVALINTLGRISHSLAAVRSF
FT                   HRAMDLGQGQTFAIMAGTPMLKQHPGGRKAKVLYKDGGSTFYYEDDEDDFKYATERLPW
FT                   ERRPYKESDTAWDSFTAEFEVVWNTFVYVLKSWWNLPKTLWEIFVLEANRAWSYWLGLP
FT                   VPPRSWRIRLPQRPQIRSHDEL"
FT   CDS_pept        join(1197851..1197905,1197995..1198510,1198586..1199349)
FT                   /codon_start=1
FT                   /gene_family="HOG000158061" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264382"
FT                   /orf_name="AFUA_8G05160"
FT                   /product="Peroxisomal membrane protein (Pex13), putative "
FT                   /biological_process="protein import into peroxisome matrix,
FT                   docking"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="EAL85282.1"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016560"
FT                   /db_xref="HOGENOM:HBG057712"
FT                   /db_xref="HOGENOM:HBG328763"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniParc:UPI000051F217"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA2"
FT                   /transl_table=1
FT                   /translation="MASVSPPKPWERAGTAGGGTVLSASPAGSSTMTPTAVAAAPPTAT
FT                   SSVSATTSTTSSSTAPSLPSRPDTLNAVVNRTASNYSPYGASRFGTTPYGTGYGGYGAY
FT                   SSPYPRFGTMGSMYGGYGGYGGMYGGMGGMYGGGMPGDPNDPNSLTNSFSQSTQATFQM
FT                   IESIVGAFGGFAQMLESTYMATHSSFFAMVSVAEQFGNLRNTLGSALGIFTIIRWFRTL
FT                   IAKITGRPPPADAASLTPSAFAAFMHGRSAPATLPDGSPAPPKPSKKPFFMFLIAVFGL
FT                   PYLMGKLIKALARSQEEQRKQMMLGPNGEPMQAPLDPSKLDFCRVLYDYTPESQESAGI
FT                   DLAVKKGDIVAVLSKTDPMGNASEWWRCRARDGRVGYLPGPYLETIQRRPAQQAITSGS
FT                   EAGSRTNTMASVIEKGQVGDEKKPVLKGKMGDISPESFQKSAFYS"
FT   CDS_pept        complement(1208042..1209382)
FT                   /codon_start=1
FT                   /gene_family="HOG000158093" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264383"
FT                   /orf_name="AFUA_8G05170"
FT                   /product="Autophagy protein Apg6, putative "
FT                   /biological_process="autophagy"
FT                   /protein_id="EAL85283.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="HOGENOM:HBG011748"
FT                   /db_xref="HOGENOM:HBG676980"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="UniParc:UPI000051F483"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA1"
FT                   /transl_table=1
FT                   /translation="MSFVMLTESQVGPPHTSSNNNGEGQSWANKRPSGVPNSEREPEEG
FT                   SFSDQVERSNRLFEIISARSDIDHPICVECTEMLVDGLQKRLVSATKERDAYISFLRDL
FT                   NSSAPTAEEIEAAEQSLKETLAAEEAAFEELVALEKEKAALDEEIAALEEESRQLDLEE
FT                   EKFWRDRNAFALTLSEFQNERDALNMRYDHDSRQLERLQRTNVYNDAFCIGHDGYFGTI
FT                   NGLRLGRLTNPSVEWPEINAAWGQTTLLLATIAEKLGFQFQGYRLKPMGSMSRIEKIEY
FT                   PRTSPAQSALGGGNAETSPAAKITTLDLFSSGDLPLNLPWLHRRFDAGMVAFLECLRQL
FT                   GEFVEKTPAPASSTRRGHGNAPVAGLKLPYEIKRDKIGDASIKLGFNQNDETWTRACKY
FT                   TLTCCKFLLAHASNVASAGSSNSAAVAAAAVAAGEQARLATASPTRK"
FT   CDS_pept        1210349..1211974
FT                   /codon_start=1
FT                   /gene_family="HOG000158094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264384"
FT                   /orf_name="AFUA_8G05190"
FT                   /product="Myb-like DNA-binding domain protein "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="EAL85284.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG057713"
FT                   /db_xref="HOGENOM:HBG328757"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniParc:UPI000051E646"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WCA0"
FT                   /transl_table=1
FT                   /translation="MERPRKRPRLSLGVHGEDPDDIDLQEARAQNDLRLKSIFERIFEK
FT                   YGKDFTDIGDEIDLQTGKIVVNNGHLQRMSSEGDTGEKDEAGWFFKEDLPTSTVQISKA
FT                   TLPGSVHDLEVATETGHDDTTDGVQLQRTLTSPQPLPALRLDRAYDEKRPPETGEADLD
FT                   DDSRSVDSLLDCALIVPNDSDKPDSQALPLESEAFPTKAITTAKPPVQSQQTRGVQANE
FT                   PVESIWRVPEIKGGFSTPVFYRSRPKLPLTAVRSVSPPKAGSLWALPGQSRCNTDGRKG
FT                   KRRKKPGVDQRKYKLQSSPVLHDWSFAKTPDGNESDDPLQEDYQPSPTPKTPIHIRAKS
FT                   HLENTPSRTKDERRRLPPQLNPGSQPTINALHGATEPRIANSAASQLEPETIEKRADQC
FT                   LSVDTHISAAKQHADPAIAQASTPTRAKRTLMTPDEAKLIIRMRQIEGKKWKEVHEHFP
FT                   QRKLISLIQWNQTHWTERHDKPPRISKPWSKEEVDKLQAFKDQQGLTWSHIRAALPGRS
FT                   HAEIEFALLRLWAELGQSTDVQGS"
FT   CDS_pept        join(complement(1213381..1213665),
FT                   complement(1213196..1213321),complement(1213090..1213147),
FT                   complement(1212415..1212978),complement(1212186..1212358))
FT                   /codon_start=1
FT                   /gene_family="HOG000217393" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264385"
FT                   /orf_name="AFUA_8G05200"
FT                   /product="Cysteine synthase, putative "
FT                   /EC_number="2.5.1.-"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="EAL85285.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG370933"
FT                   /db_xref="HOGENOM:HBG748215"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniParc:UPI0000520292"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC99"
FT                   /transl_table=1
FT                   /translation="MSDHSRVSIGTAFVAGILLAVGFSELLYPELKNRIRGTRSQPTKV
FT                   LQDGSADSLTVRSGPPAIVDGIEGCIGNTPLLRIKSLSDATGCEILGKAEFLNGAGQSS
FT                   KDRVALSMIEIVCDMWPRSLLMPKINLQRPSKKVRPEFHWLVLPEQRATSLTCAIVDRV
FT                   PPAPIVEKDNFVNRARALAQAQTLSPSGGRGFFADQFENEANWRAHYNGTGPEIYAQCN
FT                   GKLDAFVAGAGTGGTISGVALFLKPRIPNLSVVLADPQGSGLYNRVRFGVMFDIKEREG
FT                   TRRRRQVDTIVEGIGINRVTANFEAGKELVDDAVRVTDAQALAMARWLVEKDGIFVGSS
FT                   SAVNCFAAVKTAMKLGPGHRIVTILSDSGSRHLSRFWAKAGDVGGAVDTKLEDVLNAKD
FT                   DE"
FT   CDS_pept        join(1214105..1214246,1214331..1215301,1215356..1215565)
FT                   /codon_start=1
FT                   /gene_family="HOG000158105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903144"
FT                   /orf_name="AFUA_8G05210"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85286.1"
FT                   /db_xref="HOGENOM:HBG057714"
FT                   /db_xref="HOGENOM:HBG328756"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="UniParc:UPI000051ED16"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC98"
FT                   /transl_table=1
FT                   /translation="MHWLKRGDYPRDIEEELKTYPLVTAKDLRNRRERPRQVKMLTREF
FT                   IDDSLYNPHYGYFSKHATIFSPGEPFDFNNIEDGPAFHRMLGERYTEFENKLDETQPDV
FT                   ARQLWHTPTELFRPYYGETVARYLVSNYKLTLYPYHDLIIYEMGAGNGTMMINILDFIR
FT                   DTDYEVYQRTKFKIIEISPALASLQMKNLTDSVNAAGHMDHVEIINRSIFDWDTYVHSP
FT                   CFFLALEVFDNFSHDAIRYDCKTELPQQGGVLIDADGEFHEYYNAQLDPVASRFLRVRQ
FT                   AAARRPFPSPLGPKAMRQLRGALPFQSPYTLPEYIPTRLMQFFDILDSYFPAHRLVASD
FT                   FNSLPDAVPGINAPVVQTRYKRRTVPVSTPFVHQGYFDIFFPTDFNVIEDLYRAITGKL
FT                   TQVMSHEDFVRRWAYIEDTETRSGENPLLTWYKNASMLMTV"
FT   CDS_pept        join(1216035..1216482,1216539..1216651,1216698..1216921,
FT                   1216980..1217254,1217312..1217436,1217540..1217636,
FT                   1217718..1217822,1217875..1217990)
FT                   /codon_start=1
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264386"
FT                   /orf_name="AFUA_8G05220"
FT                   /product="Acetamidase, putative"
FT                   /EC_number="6.3.5.-"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="EAL85287.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG327754"
FT                   /db_xref="HOGENOM:HBG348222"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000051ED11"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC97"
FT                   /transl_table=1
FT                   /translation="MTPSPIPHWKSAVQQKRAAQLNAIPPSWRLPSTILTPPLPNTLET
FT                   IRSCGLLSAEELEWTETNDVTNLLSRLASREVSSVQLTTAFCKRAAIAQQMTKCLTEIF
FT                   FDRALARAKELDDQYEKTGILTGPLHGLPVSIKDRFDVEGMDTTVGWVGLIGKPAQRSS
FT                   SIARLLESMGAVLYVKTNIPQSLMMSDSYNHIFGQSINAFNHELISGGSSGGEGALLGA
FT                   RGSILGIGTDIGGSIRIPAALQGLYSICPTTGRVPWDCSFMHQHYLVPPVAGPMARSIT
FT                   TIEYFMQSLLDSNPWDIDPGCIPIPWRKELAAMPDRKLKLGVIFDDGVVKPQPPITRAL
FT                   REVTRKLAAAGHEEWNTSLHIRGTNLWKKAILADGGSHCKQLCDIVEEPLIEGMLVEEE
FT                   KWLFQEHYLKQWKDSGIDALLMPVTPWVVTVPVAHADPALDQPDQEWLAYTPRNQSDEF
FT                   NHGQYDIDLVKNMPICIQIVGGRFGEEKAVAVAKVVDGLIHS"
FT   CDS_pept        join(complement(1220106..1220254),
FT                   complement(1219734..1219992),complement(1218104..1219663))
FT                   /codon_start=1
FT                   /gene_family="HOG000053808" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19903145"
FT                   /orf_name="AFUA_8G05230"
FT                   /product="2-hydroxyphytanoyl-CoA lyase, putative "
FT                   /EC_number="4.1.1.8"
FT                   /function="magnesium ion binding"
FT                   /function="oxalyl-CoA decarboxylase activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /protein_id="EAL85288.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0008949"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG316485"
FT                   /db_xref="HOGENOM:HBG460149"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="UniParc:UPI000051F48A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC96"
FT                   /transl_table=1
FT                   /translation="MIKAKQRYRFLDVAVHNERLDFSGIIPGFASFGTSEVSQSISSSI
FT                   TIPRFTRMAVVTGAQLIARTLRDLGVTVIFGIVGIPVIEIAESAIDLGIRFIAFRNEQA
FT                   CSYAASVYGYLTGQPGVCLVVGGPGVLHALAGIGNASANNFPLLVLAGSAETSGVTKGA
FT                   FQEMDAISFLTPHTKFAVRPPSLAFVAGAVKNAYRTCWYGRPGPTFVDLPADLIQGKSA
FT                   PGFHLPQPEEILVPPPPKASGDPAMILKAAQLLKAARAPLLIIGKGAAYARAEGGIRKL
FT                   VEQTQIPFLPTPMGKGVVPDSHPLNVSSARSAALKHADVVLVLGARLNWILHFGEPPKW
FT                   SSRAKIIQVDICAEEIGRNAGTAELGIVGDIDLVVQQLLVSLSNWRYASSAAPSQFLAL
FT                   LADSAKKNEAKAQKAAFTPTPKNSPLTYQRAFQIIKTTLNSLAPFEDGNVVYVSEGANT
FT                   MDISRSVFPLNHPRQRLDAGTYATMGVGMGYIIAAHEAYNAFPASTAKPKKIVALEGDS
FT                   AFGFSAMEIETMARYRIPALIFVVNNSGIYHGDSASESSWKELQAQTAANDTKSDGRDD
FT                   GKKGLRSTSLLYETRYEQFGPMCGGKGYFVRSEEELETATREGFLSDTVTVVNVIVEPG
FT                   IGKKVGFAWQGNAHEGQAKL"
FT   CDS_pept        join(complement(1222365..1222535),
FT                   complement(1221965..1222292),complement(1221654..1221931),
FT                   complement(1220709..1221515),complement(1220484..1220609))
FT                   /codon_start=1
FT                   /gene_family="HOG000158146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207692"
FT                   /orf_name="AFUA_8G05240"
FT                   /product="Peroxisomal targeting signal-1 receptor (PEX5),
FT                   putaitve"
FT                   /function="binding"
FT                   /function="receptor activity"
FT                   /protein_id="EAL85289.1"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG136596"
FT                   /db_xref="HOGENOM:HBG505494"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000520293"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC95"
FT                   /transl_table=1
FT                   /translation="MSFLGGAECSTAGNPLSQFTKHVQDDKSLQRDRLVGRGPGGVQES
FT                   MRSRSMMGGQDQMMDEFAAQQPGQIPGTAPQPFAMEQLRRELDHFQTTPPRTGSPGWAA
FT                   EFDTGEHARMEAAFAGPTGPLMNNGSAFTPAEFARFQQQSRVGMPQTSSPATSVSPVMA
FT                   GYQRMGMMRPSYTPMGMQQQPAEAATQDKGKGRMVELDDENWEAQFAEMETAGNQTLDD
FT                   EANAAIEAELNDLDRSVPTTDTGNAQDYDAFESVWQRLGDYMFEEENVFRNVANPFEEG
FT                   VKIMREGGNLSLAALAFEAAVQKDPQHVQAWTMLGSAQAQNEKELPAIRALEQALKIDP
FT                   NNLDALMGLAVSYTNEGYDSTAYRTLERWLSVKYPQIIDPKDLSSDADLGFTDRQILHE
FT                   RVTDLFIKAAQLSPSGEHMDPDVQVGLGVLFYCAEEYDKAVDCFSAALASTESGTVNQK
FT                   EQLHLLWNRLGATLANSGRSEEAIQAYEQALTINPNFVRARYNLGVSCINIGCYPEAAQ
FT                   HLLGALSMHRVNQSTNLYDTLRRVFSQMGRRDLADMVVAGMDVNVFRKEFDF"
FT   CDS_pept        join(complement(1224012..1224139),
FT                   complement(1223497..1223922),complement(1223005..1223425))
FT                   /codon_start=1
FT                   /gene_family="HOG000158147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264387"
FT                   /orf_name="AFUA_8G05260"
FT                   /product="Nucleic acid-binding protein "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="EAL85290.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG057715"
FT                   /db_xref="HOGENOM:HBG328755"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000051FE2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC94"
FT                   /transl_table=1
FT                   /translation="MICSSHVTLSYSIRRTFLLNSILYFWLCSWSYTTNSFTRTRKMHC
FT                   FRRAASRLLSLPVTAPTWSARALAPRVPLPVLSPLQSQLALHTRWFSDNTASQEPTSSP
FT                   EHEHHGHSETVLAEPDTRDARPQKPKMRLRVLEENLRPRQTVYVGNLFYDVTAEDLKNH
FT                   MQQFGVVERVDLITDNRGLSRGFAYVHFDSIEAAKSCVEAMHLQIFEGRRITAQYASSG
FT                   GTRPLRPASRTLYLGNLSFEMTDRDLNELFRDINNVIDVRVSVDRRTGQPRGFAHAEFL
FT                   DVESAQKAFEILSGKAPYGRRIRVDYSSTNRRGDRIEGVPDEE"
FT   CDS_pept        join(complement(1227298..1227419),
FT                   complement(1226818..1227244),complement(1226540..1226762),
FT                   complement(1226447..1226478),complement(1225620..1226393),
FT                   complement(1224860..1225564),complement(1224480..1224797))
FT                   /codon_start=1
FT                   /gene_family="HOG000158158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264388"
FT                   /orf_name="AFUA_8G05270"
FT                   /product="C6 transcription factor, putative "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85291.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057717"
FT                   /db_xref="HOGENOM:HBG325090"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00005204DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC93"
FT                   /transl_table=1
FT                   /translation="MSPTPPSTSSSIGAVSPDGQFRVIRKRNRVPLSCGPCRHRKSYIR
FT                   LKCNRAHPCENCVKRGDASSCTYAQASVRRKNATQNSASSSPDDMQNRIDRLESLVLSL
FT                   MTNGSQSAGPAAAMAAISGTSSSGGSLNQTHDIDLDEETSNAPEESDTEQVTKSFGIMK
FT                   VDNNKSYYISDAHWASLLNDIAEVRNYFQTCKKQYEEQAEKFNTSKLPSDVPGSTLLLG
FT                   AMKPASRAEIMSSFPSRYTSDMLIARYFNSYDPATHILHGPTFQAQYNKHWEDPSQSCI
FT                   VWVGMLFAMMRLAMLSYNHEGDEPPEFRGKSLDMAGSFRNLVAQCLTLADYTKPYPYLI
FT                   ETFIFHLHGDFRQTKEADISVWVLVGVVARLAMRMGYHRDSKVFPNITPFQGEMRRRVW
FT                   TFVRQSDLLFSFQVGLPSMIRTVDSDTELPRNLYDDDFDENCKELPPSRPANEPTPISY
FT                   LIAKARLAYVFGRVTELTSSVQSESYDKVMELDAELRRARDLIPEHLVIRPFEECQLDP
FT                   SNLIMSRFGIMSVYHKAQCVLHRPYIVLARGNPRFAYSRKTCIDSAMELLRFQSMLHTE
FT                   TRPTGRLRTKQNRINSLSSTDYLLAASIVCFDLYHGLKIQAGGRESSDTFAWGRERRQE
FT                   MIIALQRSREIWEELREESLEAWKAAGILGVMLAKLNLGFPDSNATAPAFEPQDEKQSA
FT                   AMTLGLLSSGINAANSGSPAFNETGFKVSETPSAPGAFGSTAEVPGALSPFSTMFGQMP
FT                   DMQLNLDWDSWDTYIQSSNLDIPNQWWPTFDGQQQQPSPQPSLHPSLQAQGSLSSTQLS
FT                   SMQQGNTVDNMRSLPRFSNVFSSDPVKYEGLGINGPYDNNSPQKSSNASGEGTL"
FT   CDS_pept        join(1229580..1229869,1229937..1231063,1231125..1231369,
FT                   1231424..1232905)
FT                   /codon_start=1
FT                   /gene_family="HOG000158169" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264389"
FT                   /orf_name="AFUA_8G05280"
FT                   /product="RNA interference and gene silencing protein
FT                   (Qde2), putative"
FT                   /function="nucleic acid binding"
FT                   /protein_id="EAL85292.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG057718"
FT                   /db_xref="HOGENOM:HBG328754"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014811"
FT                   /db_xref="UniParc:UPI000051F212"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC92"
FT                   /transl_table=1
FT                   /translation="MSSRGAGDSQPRRGRGGDRGWARGGDRGASGRGGGRGGTMELPFR
FT                   PSVPRGGSYREDSRGRGGGEFRGSGRGDSGGRGGRGGGFRGGRGDQGPRIFSQGDLVVA
FT                   PSPRVEQTEAAIAKTLITKRQKNVSQARYPERPGYGTQGSPVTLYANYFELKSVGKELF
FT                   RYNVDIVADSARAKPTGRKARQIIRLLLDEHLLQYQNSIATDYKSTLVSRVELPSQGQY
FT                   DVRYRDEHEDDYPEQPKVYRVNCQFTGRLNPGDLLDYLTSANASAMFESKAEVMQAMNI
FT                   VMGHHPKADRSVVSVGANKHFAIHPNAAERYDLGAGLEVLRGFFVSVRAATARILINVQ
FT                   IKYAACYQEGPLANVINEYQRSNSRDIYKLEAFLKKLRIQATHIVRKNKKGQVVPRIKT
FT                   IAGLATRADGASLPHPPKVARHGAGPNDVQFFLDAPGQKSEPGNSKGKKGKKPAKAGPA
FT                   PAGRYITVSDFFLQEYNKSLDSNMPVVNVGTRENPSYLPVEVCLVEPGQPAKSKLTPMQ
FT                   TRNMLSFAVRGPASNAYSIVSKGTAVLGLKNPLNPTLASFGIQPDLQLVTVPGRVLPAP
FT                   RVYYKDAKSNQRHIDTMGGSWNMKSIKFSTSTKLPSWTWLYINSERGIPRFENPGQLNT
FT                   SLQAFTAKLNEIGVAAAAPKPGMMIRLTGNDHEGEIDRAVGELMGRHTPTLILTILYSS
FT                   DVEAYNCIKKICDVRRGVRNVNVLAEKLRGANDQYYANVGLKFNLKLGGANQILKASEL
FT                   GIVAEGKTMLVGIDVTHPSPGSSAEAPSVAGMVASIDSSLSQWPADIRIQTSRQEMVSN
FT                   LDEMLKARLQRWARANKNALPENIIVYRDGVSEGQYDVVIEQELPLLKKACVETYPAAS
FT                   TKKNLPRISIVIVGKRHHTRFYPTRDEDADRSANPKNGTVVDRGVTEARNWDFYLQAHT
FT                   AIKGTARPAHYFTVWDEIFAHQKPVAPFQNAADILEDLTHRLCYLFGRATRAVSICPPA
FT                   YYADLVCTRARCYLSSVFDPTPAATPSVSEIGGIGRGGLVKGSDVQIHENVRDTMFYI"
FT   CDS_pept        join(complement(1234718..1235026),
FT                   complement(1233444..1234568))
FT                   /codon_start=1
FT                   /gene_family="HOG000158180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264390"
FT                   /orf_name="AFUA_8G05290"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85293.1"
FT                   /db_xref="HOGENOM:HBG057719"
FT                   /db_xref="HOGENOM:HBG328753"
FT                   /db_xref="UniParc:UPI000051F6F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC91"
FT                   /transl_table=1
FT                   /translation="MSLRDLYQRFLANPKSVPLAANASLIYITTATQFDGADAIVSHLT
FT                   KQETVVKKKAADIIDAIEGSNSLCLDVEVTLEFVSGGGAYLPSLDDNFLADRVAAFPTV
FT                   DVIGARGRGWPIRDGKDQTRLIKAAVASTPASEGPAEPQPPQKENSEDFRSKSASPSKR
FT                   HIKDPYAAESLEELLSPGKDRAQPVRAPRAPASAKPPPRDYSELFVGDDENDAPEPTPS
FT                   KSRAIAPKAGAGKNYHASRIFEDDEAGAKQQIAYKTNPKRFDHFELGADNSEREVKSKP
FT                   GRPMSRHVPHWDFEDFVTPEKPKRQPRPQEARHFGWSDDEVQPTPPVKPFVVQPRRDAE
FT                   THFDLTDNDDEQHKSRIISSFQNKGLNLYKTHMYNEEESPGKNAAEKAPLGVVPNGGNR
FT                   KKDFETHWSITGSSPADGKVSHENQKPMGTDRLKAVKMMEPSWEAYDESPQPSKTAPPP
FT                   QRRPLRHVNEKHWDFGDEE"
FT   CDS_pept        join(complement(1236942..1237190),
FT                   complement(1236804..1236884),complement(1236621..1236710))
FT                   /codon_start=1
FT                   /gene_family="HOG000158201" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264391"
FT                   /orf_name="AFUA_8G05300"
FT                   /product="RNA polymerase II subunit 7 "
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="EAL85294.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG328752"
FT                   /db_xref="HOGENOM:HBG347513"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000051F94F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC90"
FT                   /transl_table=1
FT                   /translation="MFFLKEETKVISLHPSYFGPNMREYLINRLNEEEEGRCTGDHFVI
FT                   CVMDMVDIGEGRVLPGSGQAEYTIKYRAIIWKPFRGETVDAIVTSVKPTGIFTLAGPLS
FT                   VFIARKYLLSTRIMPTRSSKRGPVYGSKSSVSSLT"
FT   CDS_pept        join(1238056..1238088,1238144..1238167,1238226..1238285,
FT                   1238342..1238794)
FT                   /codon_start=1
FT                   /gene_family="HOG000263779" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264392"
FT                   /orf_name="AFUA_8G05310"
FT                   /product="DUF962 domain protein"
FT                   /protein_id="EAL85295.1"
FT                   /db_xref="HOGENOM:HBG097682"
FT                   /db_xref="HOGENOM:HBG688529"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniParc:UPI000051F218"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC89"
FT                   /transl_table=1
FT                   /translation="MALNLEKQLLFYGAYHNNPVNLAIHITCVPILLFTGIALASNSSA
FT                   LFNLPEAISFEYLPANLGTIAAFIYATFYILLEPVAGGLIAPLLIASAAYANYLLSTYG
FT                   TTVNYWAAGIHVVSWLLQFVGHGVFEGRAPALLDNLVQALLLAPLFVWLEILFFLGYRP
FT                   ELRARYEESVKKEIAAFRSKKGGAAK"
FT   CDS_pept        join(1239645..1239716,1239895..1240064,1240194..1240250,
FT                   1240308..1240428,1240491..1241741)
FT                   /codon_start=1
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264393"
FT                   /orf_name="AFUA_8G05320"
FT                   /product="Mitochondrial F1 ATPase subunit alpha, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="EAL85296.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI000051EF96"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC88"
FT                   /transl_table=1
FT                   /translation="MFRNALRQSSRTVAAATATGRIASVRAAVPGPLAGASKQVRSYAA
FT                   EAKASPTEVSSILEQRIRGVHEEAGLAETGRVLSVGDGIARVHGMTNVQAEELVEFASG
FT                   VKGMCMNLEAGQVGVVLFGSDRLVKEGETVKRTGEIVDVPVGPELLGRVVDALGNPIDG
FT                   KGPINTKAKSRAQLKAPGILPRRSVNQPVQTGLKCVDSMVPIGRGQRELIIGDRQTGKT
FT                   AVALDAMLNQKRWNNSSDESKKLYCIYVAVGQKRSTVAQLVKTLEENDAMKYSIVVAAT
FT                   ASEAAPLQYLAPFTGCAMGEWFRDNGRHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAY
FT                   PGDVFYLHSRLLERAAKMNDKHGGGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLE
FT                   SELFYKGIRPAINVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDA
FT                   STKQTLARGERLTELLKQKQYSPMAVSEMVPLIFAGVNGYLDGIPVNKILTWESDFLAS
FT                   VKSNQPEILETIDKEGQVSKELEAQLREVIVNFNKSFNA"
FT   CDS_pept        join(1242642..1242802,1242987..1243617,1243679..1243783)
FT                   /codon_start=1
FT                   /gene_family="HOG000158212" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751101"
FT                   /orf_name="AFUA_8G05330"
FT                   /product="Methylenetetrahydrofolate dehydrogenase "
FT                   /EC_number="1.5.1.15"
FT                   /function="binding"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NAD+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85297.1"
FT                   /db_xref="GO:0004487"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG152981"
FT                   /db_xref="HOGENOM:HBG328751"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="UniParc:UPI000051FE21"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC87"
FT                   /transl_table=1
FT                   /translation="MATHADSVHPACKVVLSKNVANSLVAEVQEGVKTLEKPPHLVGFL
FT                   ANDDPAALIGFRYSLRQVSRDDIEDAILAANADSDVDGIIVYYPIFNNRQDQYLQQIVD
FT                   VSKDVEGLSHRYIFNMYQNIRFLDPETKRQKCILPCTPLAIIKILEYLNIYNTILPYGN
FT                   RLFGHTICVVNRSEVVGRPLAALLANDGACVYSVDITGVQKFTREGLKKRRHEVVDLEG
FT                   KTIKDVAPLCDVVITGVPSESYKFDTSLLREGAVCVNFSSEKNFGPEVKEKASIFVPSI
FT                   GKVTIVVLLRNLLVSDI"
FT   CDS_pept        join(complement(1245081..1245123),
FT                   complement(1244676..1244974),complement(1244344..1244616))
FT                   /codon_start=1
FT                   /gene_family="HOG000158213" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056406"
FT                   /orf_name="AFUA_8G05340"
FT                   /product="Signal peptidase complex component, putative "
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="EAL85298.1"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057720"
FT                   /db_xref="HOGENOM:HBG328750"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniParc:UPI000051ED06"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC86"
FT                   /transl_table=1
FT                   /translation="MATSEPKVPVYSINDLKSTTDDALVPYLCTLPQPYTFKQDHSKSN
FT                   VRFLLGYSAVAIAAFTFYADRKLGWEATTSPWVIAAVCSYFILNTGLTFWIWAVEAGEV
FT                   FRGKRESGETISIRSSVKKHSPLYKLRVQYTSPSNKILQEKEIDAPFMNWFSADGTFHP
FT                   EPLRRWLSTEIEVLRLAAKETERKTGGVGSVVGVQDTKNKK"
FT   CDS_pept        join(1245440..1245489,1245548..1245581,1245642..1246008,
FT                   1246069..1246230,1246323..1246516)
FT                   /codon_start=1
FT                   /gene_family="HOG000158234" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264394"
FT                   /orf_name="AFUA_8G05350"
FT                   /product="DUF850 domain protein"
FT                   /protein_id="EAL85299.1"
FT                   /db_xref="HOGENOM:HBG500347"
FT                   /db_xref="HOGENOM:HBG626693"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniParc:UPI000051FE24"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC85"
FT                   /transl_table=1
FT                   /translation="MALQGVEQTILRDPALFYWILFPITIVMILTGILRHYATVLMTTP
FT                   PKPPATLAESKERLSLMRGVNLRNNAPAVLSREGFEMRKNYLISSYKSGAFLKDPSSRG
FT                   QPPANPMTDPAGMEAMMGMMKGNMMMMIPQTLIMSWINAFFSGFVILKLPFPLTIRFKS
FT                   MLQSGVMTRDLDVRWVSSLSWYFLNLFGLQSVFGFILGSDNAANHMAQQMASMNPGAGV
FT                   NPLQPGQDPDKLYQSEAENLEVTEFFSILDGIEERVLHNYASKEIR"
FT   CDS_pept        join(complement(1247008..1247619),
FT                   complement(1246860..1246952))
FT                   /codon_start=1
FT                   /gene_family="HOG000158235" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20751102"
FT                   /orf_name="AFUA_8G05360"
FT                   /product="FAS1 domain-containing protein AFUA_8G05360 "
FT                   /cellular_component="vacuole"
FT                   /protein_id="EAL85300.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="HOGENOM:HBG057721"
FT                   /db_xref="HOGENOM:HBG328749"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000051E3E3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WC84"
FT                   /transl_table=1
FT                   /translation="MRRTLFVLFVVAFCFIGSVIANLSLPPGFSLRKRLPRSLVDILHL
FT                   RHEQGLRDDTELRNWLSKQQPAMNKMFSSSSRENGSEKPVVSDVLPKNRAINIFASLTR
FT                   QFEPIESRLNDSSKNITVLAPRNSAIQSLPRKPWENPEDYEKFGGVSAYEGQEGEDRAK
FT                   QNLQRFVEAHIIPASPWREGEEMETLGGEKLKWIKKGDKIYIQPGNVEVDNIAETVING
FT                   ELWILNSVLNYR"
FT   mat_peptide     join(complement(1247008..1247556),
FT                   complement(1246863..1246952))
FT                   /product="FAS1 domain-containing protein AFUA_8G05360 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WC84 "
FT   sig_peptide     complement(1247557..1247619)
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WC84 "
FT   CDS_pept        join(1247899..1247980,1248039..1248312,1248413..1248510,
FT                   1248566..1248705,1248756..1248944,1249005..1251413)
FT                   /codon_start=1
FT                   /gene_family="HOG000158249" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207693"
FT                   /orf_name="AFUA_8G05370"
FT                   /product="DNA repair/transcription protein, putative "
FT                   /function="binding"
FT                   /protein_id="EAL85301.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG057723"
FT                   /db_xref="HOGENOM:HBG328748"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051E3F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC83"
FT                   /transl_table=1
FT                   /translation="MSALQTFMLVVDHDKVEAKQIAERVAQDVEYKRTTLIEVVQSLGE
FT                   YINDEDPILRGKAVSYLTAVIRALPPKYLSRQQIQVLTTFFCDRIEDGGAVTGLDTLQK
FT                   LDRFNDTLAEEVAQAIFERLQDLQSRSQSQRFQVYQLLNELMSNHRAALHKMGDTSLVG
FT                   IVDLMTGEKDPRNLMLVFSILKVVMIEWDISNHAETLFEAVYNYFPITFRPPPNDPYGI
FT                   TAQDLKDRLQDCISSTSLFAPYAVPALLDKMDSTSPNVKKDALNALTACIRSYDPDTVS
FT                   KYSIQIWDVLKFEILNAQEEFLSELSLQALNSIAKRLSEGIAAISEQSPLAQFLRPITK
FT                   ECNEQLREPQQKQAKPAQQILNSTSSASTASFTVIVQAVVAPLLTVYQEADGLAKQRAI
FT                   LETLGGLFDSAIEVFGKWDSPELEPAAENALVEFKDQFSDVFGQALMGAAKEEVSFRVT
FT                   ALEGFLRLSILRDYFQDNEIGLFVQYLDEILLKEECAGRGDLKKKAIAALAEISKHKPR
FT                   LIMDITFPAFVATLPDSDEGPNTDYITTLENLAQISVERDIFETLVRRLLSKLTILLQK
FT                   ERAGSIAYPRAILMTILYVMKQRNLDKDPNLELYYDKIVRGLCRGVADAATGKSTNRIL
FT                   NDAVVIDILGRLCNVIVRCLSKQKQDEVAQNVYTLFASSSTFTPVPFSQAANEDQQRTM
FT                   IISTYLLAGLPADCAHLPYSGRDLAPLLSDLVTRSLTECEPPTHLAFLRHSALLVNKFL
FT                   PRPELSVATNILNKLFSAGAEEKKVPSGTIKTIFWLSKALIIRLAPTTTEILTSLLSLL
FT                   SSHDELTSTTAARGFAILLKDDDVLSADNGANIRLLAKQRVFTTLTPLISNRIREVNVA
FT                   GDDSSTPAHIKPAHLTALSGILSTISPSLVMPELPTLLPLLLQSLDLQNADSQGVRAAT
FT                   LETLAVIIRENGVGIIEECGHVQSLVTRLLKTAAYNPTPSGSDQQAAGAGPVNGPRLRV
FT                   EALRCLNLLAQTPKTDAPAVAKAGKLSPLLPVKSQVVRSLRMILDDPKRDVRKAAVDAR
FT                   GAWLRNVDDAPDEED"
FT   CDS_pept        join(complement(1255826..1255882),
FT                   complement(1255483..1255581),complement(1255052..1255399),
FT                   complement(1251837..1254992))
FT                   /codon_start=1
FT                   /gene_family="HOG000158260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751103"
FT                   /orf_name="AFUA_8G05380"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85302.2"
FT                   /db_xref="HOGENOM:HBG057724"
FT                   /db_xref="HOGENOM:HBG325675"
FT                   /db_xref="UniParc:UPI0000F5186B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC82"
FT                   /transl_table=1
FT                   /translation="MATKQRLTLASMWAFEAIGVLVTKGNVESFVVKVASAFSGFIEEQ
FT                   KDKDLLDTPRVRQLDVPAVLSDEGLPAMSSPEKHQGPNLLALEDDSDEDIVPYSRNHAT
FT                   KFWKSPNGGLGCFSSNFRDVLTGVAIATGTEIAILDESQGIRVFGTTEDVDDALMKLTQ
FT                   IEKPLSFSLAPNVTNIMITPHKDDSRFRIQNYSSVNPDALRRVREDPKMCSAIDFGRMC
FT                   VTVGLSFNKESQVWTIPDNRLNPLPISEEAGPSRIWNDFTFQEIGKADEFVDIEAIIEN
FT                   DPSKPQTLISGIAPPHPFLTADKVKQVNQWVVERAEMQPTEHEPEPEPEPELESDFEPQ
FT                   PEYEGRDIHQLKLKRETAIIPQSKRPPGMKTRKAAITAKVAPPSEQSLATETKPVAIGL
FT                   KETTANPRKRWTMLYSSGAEDASPDDSDALNSGISNLNDTLELPGDFLEFAKPQTSENK
FT                   VRLPGNFDAGKYGLNQSSRQTSKEGKHSPSFKKIVQVKSKKNSSDPNELIDVFEPGNNT
FT                   VVGTLSRIPFNQPPLIPDSLVNESTSNTRKMCLQETSDSNSKNTKNGLLSCGMGDHSTP
FT                   SGSGSTESMFGRAAAGDENHQEQENRLSFLKNFLQERTDNISYHGGYGQTHTSRYEFNK
FT                   LLVKESLAKLETVHRDQDRQGSDETSTREFYRTMGHKTAKPTNKAKSKSEIKSKRQATL
FT                   EDAWGFFKKPVKKPSAVAQTLKTTRQSIQESERETVHMASRKNELAAEPAENSMARDVE
FT                   NLFEALKQTLEAAEYFQGSLNLEVHLGLILIPLLPKTCSEGSTIYLTEWTKIFQSQTGI
FT                   PSPTTRFISRLTTSGIDIDYLVDLKTATPEGKRRIFEQDFREYSVFYEFHCHTRTGQVL
FT                   VLSVDEQGKFNIKNPNFGLGAVNLHFPHQVWDASIVLSGTPNDAAVDQEFEEAAKYIIE
FT                   HLWVRPDTSLVQIFTRLPPGDKITIEKVYMKRWTRHRFIHPPKSIIAANGASHIRSNSA
FT                   RIVETDLNSNSADRRQTSAENEAETMENQDIFLQVMEVQDLCIGSSPSDVRAVTACCVS
FT                   LPEMMGSGRQWYEASLVSSAIEAILRTNANLEIGERTDEWRSSDLLGRDAVLLDGNAAK
FT                   PDGPNTPLSPVAKAIGIAGLGDLLRLTKTVVEEMDGVGFWGHGLDHDSVQAPSITGSVG
FT                   TLDQMVRLEPRSLDFDDFESIKKFGSVMATTLTKKSSGGSSAKDKEQLEIDYW"
FT   CDS_pept        join(complement(1258225..1258444),
FT                   complement(1257303..1258129))
FT                   /codon_start=1
FT                   /gene_family="HOG000158271" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264395"
FT                   /orf_name="AFUA_8G05400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85304.2"
FT                   /db_xref="HOGENOM:HBG057726"
FT                   /db_xref="HOGENOM:HBG325676"
FT                   /db_xref="UniParc:UPI0000F51866"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC80"
FT                   /transl_table=1
FT                   /translation="MARLVRSKKNAARAESDNADPETLASPTLDSPRPPRVSLPHVETR
FT                   LNMHQYNGLFDVNSPECQKATIAVETSPDSTSVSARTTSNPPNGDAATAEWSSAVGHAT
FT                   TGKSGRVIHNLQEEIARLTRECSVYRSRAEETQRMNDAFKMQVQNMTERLRNLEHANET
FT                   NLQSIRRKDKKIEELRAEVQSEKERRRRAEGETDKFQQLMNEARDEFNRKCAELQEIAN
FT                   HSRTQYDVLAKAGQRERADQQRKLKAIRDDFLALKAEHEKRDVHLERLDTVISQKNREI
FT                   EIGRERFDQLFEDYEAYKKAHDEEVRALIERNYQGAANIDSALASLKETEEKMKWAIQV
FT                   KNEIKDAQ"
FT   CDS_pept        join(complement(1260064..1260207),
FT                   complement(1259473..1259994))
FT                   /codon_start=1
FT                   /gene_family="HOG000158282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264396"
FT                   /orf_name="AFUA_8G05410"
FT                   /product="Extracellular matrix protein, putative "
FT                   /protein_id="EAL85305.1"
FT                   /db_xref="HOGENOM:HBG057727"
FT                   /db_xref="HOGENOM:HBG328746"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniParc:UPI000051F494"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC79"
FT                   /transl_table=1
FT                   /translation="MFCLSTILATWVCLAQLGAAQMLAFTTWPTHIDHGQPATVTWLGA
FT                   PDVPVTIYLRKGDATNLDHVQVLTTDAKGGSFTFVPDDSLPDGSDYALQIQQGAEENYS
FT                   GLITLGDPGSKPPSPSKPPKPTENVKPQNISTPAAQDDASPHNSTDTSSDDEWETEVAK
FT                   GNNAQFTNVEDMSKGSTSNFTHGKSAMAAKLETSGATIEKVYLGWILATAGLLFYVAE"
FT   CDS_pept        1262624..1263115
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751104"
FT                   /orf_name="AFUA_8G05420"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85306.1"
FT                   /db_xref="HOGENOM:HBG057728"
FT                   /db_xref="UniParc:UPI000051E3EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC78"
FT                   /transl_table=1
FT                   /translation="MEHAVAVASSEKEILYLLERMEEEVSARQRRRRRKAQSITEKMRA
FT                   RIEAIPVSVTDTLLDDLKRGVFALDVFCDYHPGDPVAEANEMLCENNLEYPPHPSLGTI
FT                   GPYDYRRMQESQQSATLDAFMPLATHPGNTYYHYVERLMNQDDSFSGWTATEGFSTDSW
FT                   "
FT   CDS_pept        join(complement(1264473..1265146),
FT                   complement(1263379..1264414))
FT                   /codon_start=1
FT                   /gene_family="HOG000158314" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264397"
FT                   /orf_name="AFUA_8G05430"
FT                   /product="Ribosome biogenesis protein Noc4, putative "
FT                   /protein_id="EAL85307.1"
FT                   /db_xref="HOGENOM:HBG058768"
FT                   /db_xref="HOGENOM:HBG402827"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="UniParc:UPI000051EADE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC77"
FT                   /transl_table=1
FT                   /translation="MPLPTDAATGSKKRKNAKEGGVPSSKRRAVAETRSDGDMVKIQEL
FT                   EDQISESRKYYNNIVTLISMLNADGNEGRPNLAVAVSLCRVFSRLMALGNLTETSRAAE
FT                   NEKIIVAWLKERCREYQKALVSILRKADPSSQVCHAGFPTFSWHFLIAWQVTALTLCMR
FT                   IINERATHLPGDDTQVWLSGLFKNVFEAVVEAKDGQVLRSEFLDQFAKVYEDVRYYTFV
FT                   QVSDYAETKRSSEVLDVLISMLSECDNVPGAEHKFENFHTKTSKQNKKLLSVNSHKKQA
FT                   QNAWLAILQNDLSHTQRKTLLRNMVYTIEPWFNRPELLMDFLTDSYNVGGATSLLALSG
FT                   LFYLIREKNLDYPQFYHKLYSLLDADLLHSKHRSRFFRLMNTFLSSTHLPATLIASFIK
FT                   RLSRLALNAPPTAIVVIVPFIYNLLKNHPTCTFMLHRVVRDEQTKATLEAEGMDDPFDV
FT                   NEGDPTRTMAIESSLWEIETLQSHYHPNVAAIARIISEQFTKQAYNLEDFLDYTYQGML
FT                   QAELGTEDKPFKRIPVVEYHIPKRIFTDRLLEEDGGQDTAPGNFMRGLWNFA"
FT   CDS_pept        join(1265282..1265411,1265477..1265922,1265985..1266207,
FT                   1266265..1266290)
FT                   /codon_start=1
FT                   /gene_family="HOG000158315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207694"
FT                   /orf_name="AFUA_8G05440"
FT                   /product="Mitochondrial ATPase subunit ATP4, putative "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /function="hydrolase activity"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="EAL85308.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG057729"
FT                   /db_xref="HOGENOM:HBG328743"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniParc:UPI000051F6EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC76"
FT                   /transl_table=1
FT                   /translation="MASVYRTVQSPIPTSFSSVPFIHHNLQGLLIVTMASRLAKSAIGA
FT                   TRLRPTLPVRSVAANLTASRSASNVPAEDPKKKAQSIIDSLPGSSLVSKTAILSAAAGL
FT                   SVAAISNELYVMNEETVAAFCLLSVFTAVAKYGGPVYSEWAQGQVQKHKDILNAARADH
FT                   TNAVKARMDNVKELSNVVDITKQLFAVSRETAQLEAQAYELEQRTALAAEAKSVLDSWV
FT                   RYESQVKQRQQRELAESVIAKIQKELENPKVLQQILQQSVADVERVMSAKAQ"
FT   CDS_pept        join(1267174..1267776,1268090..1268515)
FT                   /codon_start=1
FT                   /gene_family="HOG000158326" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056407"
FT                   /orf_name="AFUA_8G05450"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85309.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG057730"
FT                   /db_xref="HOGENOM:HBG328742"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0000520299"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC75"
FT                   /transl_table=1
FT                   /translation="MPLRNILHKKDKINDSGSQYPPDGPSNAVPEIKFIRSDTISHEVI
FT                   DPSSFGGDVSEHKGDHGQSDLLEPSRPSSSTHRRSLNIFSRSRSPSESSEPASPSRPRG
FT                   EHRLSQLLHRDRGSRSASSSSVNIPSDLPQISDDKVDEQEREAQWEKRATILAQQSPLF
FT                   GSPAASLRSSPNRLETNSAGGARSRSSSHSQINDPEGDYGGFTKVYLFSLFLKCLTLNR
FT                   SPRHGWGCPQDPDKAVTYLSYAAANSASIESQALQAGMKKGGAAKGELVLAIFELGNCY
FT                   RNGWGVKKDPVAARQYFETAANLGDTDAMNEVAWCYLEGFGGKKDKVRYYLTPNCPSGR
FT                   AR"
FT   CDS_pept        join(complement(1272123..1272928),
FT                   complement(1270918..1272038),complement(1269550..1269734))
FT                   /codon_start=1
FT                   /gene_family="HOG000158337" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19056408"
FT                   /orf_name="AFUA_8G05460"
FT                   /product="BZIP transcription factor, putative "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85310.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG057731"
FT                   /db_xref="HOGENOM:HBG328740"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI000051F6F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC74"
FT                   /transl_table=1
FT                   /translation="MARYSQPPFDFYHQSPSTMGTKPSYPEEDEMSVLDDKILDSTSPE
FT                   LSTIPDHRRSSYDHAPDAFSHRDSVWSDFSQSVSSTQSRHNSQVGHGLYDANPNPFMRV
FT                   DGAHPASAYGQQTSWSLSRDSGSCTPTAMYDHFHPDLENNSSAPFSGGAVGPVSTINIA
FT                   SMSYRPGMGFAPPGAIAMSPQSSQGWIPASTDMPDAISRPTKSPTYRNSSPLSVRRDGI
FT                   RKKNARFEIPAERTLSNIDQLISQSTNEEEIKELKQQKRLLRNRQAALDSRQRKKLHTE
FT                   KLEEEKKHFTQVISELEEALQNMKLREAELLREKSEWMAAQQQINQYIEGLHMDKDEML
FT                   RVHTLETAELRKKNNILKETVEKLERQMGSSATNNLNTDFSDFENFTMDNAPWEDFTIS
FT                   NSLPLEAESTPATSTMQSSAMVMSASDRVTEKSTNTACDYPFSWNAFYMCLLFGAFLAS
FT                   NGPSLSSRSIPQLSEEYRAESANVLKAVLAASPPELAQANTQQAVASSSSAAPMPTTIS
FT                   GAEMAQMTTGTAQSSNLDELHNNLAMPTKEQEREQVFSLNADQYNALTTFDESHVDYKS
FT                   QPSNLQQALAAMRNNAAFNKLPNKATSDVYTRSLMWDRVPEKVIRDFQRMVQEFGASPI
FT                   KEEQSGFIRRITRTQLYTCQLETWAAAADPRLLLTLRLKIANVAGYRIKKVQYERPDIN
FT                   LSTSSCLAT"
FT   CDS_pept        join(complement(1273567..1273576),
FT                   complement(1273259..1273458))
FT                   /codon_start=1
FT                   /gene_family="HOG000048585" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903146"
FT                   /orf_name="AFUA_8G05470"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85311.1"
FT                   /db_xref="HOGENOM:HBG057733"
FT                   /db_xref="UniParc:UPI000052004B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC73"
FT                   /transl_table=1
FT                   /translation="MPGSQRGYMDFSPPSSLALVPSYNINQLQSLISKEDLLVITRVLL
FT                   FSSFFFFVVFFFLIFICFSFYISK"
FT   CDS_pept        join(complement(1281094..1281139),
FT                   complement(1280462..1281037),complement(1280296..1280407),
FT                   complement(1280187..1280242),complement(1279477..1280045))
FT                   /codon_start=1
FT                   /gene_family="HOG000158348" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264398"
FT                   /orf_name="AFUA_8G05480"
FT                   /product="CCCH zinc finger protein "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="EAL85312.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057734"
FT                   /db_xref="HOGENOM:HBG325678"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0000F5184F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC72"
FT                   /transl_table=1
FT                   /translation="MTEDQELMAKISQLAGQINRHKNQTPQAQAPTYQGSELHAGPYVS
FT                   RHTRARGGWAPYRGRPYGRGRSAAPHRHRTLVLNNVNSGNSTSSTPVPTNENAGESRSA
FT                   TPNGWVAKRDRHMQLINSAIYDKEAQARAKAMEQTRKAKAEKKARIEQAKVLRYAQGFG
FT                   RPHLATTAASQVSATTQPHGEYQVYLNDIPFKIAKGGSKLVRVSDDPNTANITPKKVTV
FT                   AGVTFVRSKNGNLHRLGAVTSKRKPTAVKKRNELCKRFTSTGACYKGPSCLFIHDPNKV
FT                   AICKEFLQTGNCSAGQNCDLSHEPSPHRSPVCVHFLRNRCSNPDCRYSHVRVTPGAPVC
FT                   RDFANLGYCDKGAECEQRHVHECPDYAASGVCNKKRCRLPHVDRAGQIRKNAASKADAA
FT                   DEEESDESSEDEEYDAIDSDDVDSDDLDDEPEYVEGADNGEQELFQQHDFIRF"
FT   CDS_pept        join(complement(1282612..1282875),
FT                   complement(1282266..1282533),complement(1282019..1282215),
FT                   complement(1281565..1281960))
FT                   /codon_start=1
FT                   /gene_family="HOG000158361" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903147"
FT                   /orf_name="AFUA_8G05490"
FT                   /product="Transcription initiation factor iif, beta subunit"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIF complex "
FT                   /protein_id="EAL85313.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005674"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG059604"
FT                   /db_xref="HOGENOM:HBG328737"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000051EADF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC71"
FT                   /transl_table=1
FT                   /translation="MFAQVKPDPDAPTPYIKPDPDNKDTVLADIDEDIYDDDGDLDFSN
FT                   AGQNVWLSRIPRSLWEHWASLDDDEEIQIGTMRIEGPPNDIKRVSIRLNEREDNRDIPK
FT                   DYILQRQTINPGNLTSHATQNTYLFTEKDIPGHENRMVVFGEARSALYEAMKRDARKKE
FT                   RRKKWEPYVRRTVPKQTALVGGVSEEFNCLPVENEEFRRLSEKRALEALKPKRETVFID
FT                   KVPGKLLQARNVLPGEKGAFVQATKPVKAKAQENKTTRMPQNELLDLIYQCFREYKYWP
FT                   FKTLKARLRQPEAYLKQTLEMVAHLVKSGDFAMTWELKPEAMESNYANALSYGNAKEEL
FT                   PPGTDYNFDDGSEEEANASGMVTDNDEMKFEDVV"
FT   CDS_pept        1284171..1285424
FT                   /codon_start=1
FT                   /gene_family="HOG000158382" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056409"
FT                   /orf_name="AFUA_8G05500"
FT                   /product="COP9 signalosome subunit CsnD "
FT                   /function="binding"
FT                   /protein_id="EAL85314.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG177408"
FT                   /db_xref="HOGENOM:HBG316871"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="UniParc:UPI000052004C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC70"
FT                   /transl_table=1
FT                   /translation="MASQRIASALAEIESSTNPQTKLQQYNNLLSEITSTSSEHELGQD
FT                   LIYYLDSVLSEEISIVAARPLLDSFIAVLRKLTPETQIKVGQHAVTLLQSRSSSVEEQD
FT                   SQIREILADAYESQEEYAAAARALQGIHIDSSQRLVSDAAKVRLWIRIVRLYLEEDDTT
FT                   SAEGFLNKIKNLPSKIEDHELKLHFKLSQARILDARRRFLDASQEYFNVSLAGGVDESD
FT                   RLQALAAAIRCAVLAPAGPQRSRILATLYKDDRATSVEEFGILEKMFLDRLLDPAEIAA
FT                   FSERLAPHQLARTADGTTVLDKAVVEHNLVAASKLYENITTDALGAILGLKESGDMTAG
FT                   EKAEAYAARMVEQGRLNGSIDQIAGVIYFDSSEGGSATATGRHIRQWDAGVQGLAEDVE
FT                   RVAASIRDAFPVCAHSVW"
FT   CDS_pept        join(complement(1287103..1287289),
FT                   complement(1286979..1287049),complement(1286128..1286916))
FT                   /codon_start=1
FT                   /gene_family="HOG000158383" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207695"
FT                   /orf_name="AFUA_8G05510"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL85315.1"
FT                   /db_xref="HOGENOM:HBG057735"
FT                   /db_xref="HOGENOM:HBG333979"
FT                   /db_xref="UniParc:UPI000051EF8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC69"
FT                   /transl_table=1
FT                   /translation="MAITSRGKSMIAIVSVLVGLSVLAVILRVFARIKRRVKLGVDDYL
FT                   CFLSIVMLIAMEIELVLWVAIGGNGQHQADLDMETMMNFGKIFLSNQFTYFILCPAIKI
FT                   SIICFYRRLFNTKSFQLVTFALNILIASWGAGIFLACAVQCRPLRAYWDKSIDGHCFDG
FT                   NKFFIVNQAFNVIMDFVILALPIPMIWGLQRAWQDKLALNGVFALGAFVCFASIYRIVV
FT                   LFWIKTSDTTFTVYQATLWTHIEPSIGLICSCLPIIRGLFPTLKLSGSRKTTAPYYIRT
FT                   DYTGSHLATLSSPKSPASAYFKMEEGLMSRATTDTEVPPDDYLSPKDIAVRTDIKISQD
FT                   AASLRSQT"
FT   CDS_pept        join(1289899..1290377,1290463..1290856,1290915..1291360,
FT                   1291413..1291557)
FT                   /codon_start=1
FT                   /gene_family="HOG000271509" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751105"
FT                   /orf_name="AFUA_8G05520"
FT                   /product="Aldehyde dehydrogenase family protein "
FT                   /EC_number="1.2.3.9"
FT                   /function="aryl-aldehyde oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85316.1"
FT                   /db_xref="GO:0018488"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI000051F6ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC68"
FT                   /transl_table=1
FT                   /translation="MASNSASSAPVPPSVIPLIINGKEEVTPTTFDVISPYTNKPCWTT
FT                   ASATPQDAVRAVEAAEDAFPAWSQTKPTVRRDILLKAADILESRLVQNAEYMRTEMGAD
FT                   VGASQFFIVPLGIRMLREIAGRITSICGSVPVVEEEGQSAIIYKEPMGVILGIVPWNAP
FT                   YVFGIRSAACALAAGNTTVLKSSELSPCSYWAIARAFADAGLPAGCFNLISCRPQDAPD
FT                   VVNAMIEHPAVRKINFTGSTAVGRKIARACGQNLKPCLMELGGKNSAIVCEDANIETAV
FT                   KAVLAGAFLNSGQICMSTDRILIHSSIAPAFMDALKKALGSNLDPSAPPPTLVNVASKA
FT                   RVEGMIDRALESGAHLIHGSLDKTVGKSGVRMAPVLLGGVREDMEVWQEEAFASLAACM
FT                   VVNSDEEAIRIANSSGYGLSAAVFTEDLRKGLAIAKKIQSGAVHINSMTIHDEPVLPHG
FT                   GVKNSGWGRFNAAQGLEEFLVTKSVTWMD"
FT   CDS_pept        join(1293416..1293455,1293528..1293596,1293664..1293901,
FT                   1293964..1295411,1295464..1295561)
FT                   /codon_start=1
FT                   /gene_family="HOG000227327" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264399"
FT                   /orf_name="AFUA_8G05530"
FT                   /product="Fumarate reductase Osm1, putative "
FT                   /EC_number="1.3.99.1"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="succinate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85317.1"
FT                   /db_xref="GO:0000104"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG437347"
FT                   /db_xref="HOGENOM:HBG678063"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="UniParc:UPI000051F495"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC67"
FT                   /transl_table=1
FT                   /translation="MATPPRVIVVGGGLSGLSAAHTVYLNGGNVLVLDKQAFFGGNSTK
FT                   ATSGINGALTRTQVELGIQDSVKTFYEDTLKSARDKARPELIKVLTYKSAAAVEWLQDV
FT                   FNLDLTLVSRLGGHSQPRTHRGHDAKFPGMAITYALMQRLEELSEKEPERVQIIKKARV
FT                   TKVNKSGDTITGVTYELNGETKTADGVVILATGGYAADFGDGSLLKQHRPDTFGLSSTN
FT                   GTHATGDGQKMLMAIGANGIDMDKVQVHPTGLVDPKDPTAKFKFLAAEALRGEGGILLN
FT                   SDGQRFSDELGHRDYVSGQMWKEKEKGKWPIRLVLNSKASNVLDFHTRHYSGRGLMKKM
FT                   TGKELAKEIGCGEAALKKTFDEYNLIAEGKKKDPWGKRFFHNMPFDINDEFHVSLMEPV
FT                   LHFTMGGIEINEHAQVLNSEKKPFNGLYACGELAGGVHGANRLGGSSLLGCVVYGRVAG
FT                   DSASQYLFKKLTSGSTTAQQRLGQISLHIDPSTPGKISVEWNGAAASGAGGAQVTAAPE
FT                   AVQTGGQGAPAPAAAASKPNDISNFKIPEKEYTMEEVAKHNKKDDLWIVVKGVVLDVTN
FT                   WLDEHPGGANALFNFMGRDATEEFAMLHDDEVIPKYASQIVIGRVKGQTPSLEF"
FT   CDS_pept        complement(1295968..1297071)
FT                   /codon_start=1
FT                   /gene_family="HOG000158394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751106"
FT                   /orf_name="AFUA_8G05540"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85318.1"
FT                   /db_xref="HOGENOM:HBG057736"
FT                   /db_xref="HOGENOM:HBG328733"
FT                   /db_xref="UniParc:UPI000051F955"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC66"
FT                   /transl_table=1
FT                   /translation="MSDNSAKRGTGEKSPNDPRKQADSRKSDPESQNSPSLANRIQNSA
FT                   AGLAWSAFNAAGSSADAAQVLGSGSKAGPSSSASSSALAAAEQYRETATPTSSNRVLAN
FT                   HPAASFRSSSAGQQGAFELPPLTEDEFQCTYDESQVHDRIDFPPSTETETDTEKGKGKA
FT                   SEALSAFSNIEPSSSSSGLNTTWQNTLPTTATPLPSDGEAVVSLLSDASFDPEFPSTAE
FT                   EPFEPVETELLPPQLTPSEIQMIESFRRHAALETSTPTPATEPLSLTHRLTSLSLVPDI
FT                   QSVLDSVPAAQATDATALRDAVLKGLPGVAEWIAVEERYHDEVWGYLRPTLEAAAKEME
FT                   ERKEQGAPVEDGPAVRRLKMILRHMQT"
FT   CDS_pept        join(1298493..1298536,1298742..1298782,1298889..1298986,
FT                   1299046..1299694,1299758..1300419)
FT                   /codon_start=1
FT                   /gene_family="HOG000089745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056410"
FT                   /orf_name="AFUA_8G05560"
FT                   /product="Protein phosphatase PP2A regulatory B subunit,
FT                   putative"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /function="protein phosphatase type 2A regulator activity "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="protein phosphatase type 2A complex "
FT                   /protein_id="EAL85319.1"
FT                   /db_xref="GO:0000159"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008601"
FT                   /db_xref="HOGENOM:HBG025071"
FT                   /db_xref="HOGENOM:HBG443924"
FT                   /db_xref="InterPro:IPR000009"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018067"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000520742"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC65"
FT                   /transl_table=1
FT                   /translation="MVDREPGTPTWKFTQCFGDKGDVEDITEADIISTVEFDHTGNYLA
FT                   TGDKGGRVVLFERNETKKTCEYKFHTEFQSHEPEFDYLKSLEIEEKINKIKWCRRQNAS
FT                   HFLLSTNDKTIKLWKVFDKSLKVVAENNLSNELTPAGAVGGGGAPRAPRLSFKDASALK
FT                   LPRMTHHDTVVAAVPRRTYANAHAYHINSISVNSDGETFISSDDLRINLWNLNIQDQSF
FT                   NIVDIKPANMEELTEVITAAEFHPISCNWFMYASSKGTIKLADMRQRALCDEHSKLFEQ
FT                   EEDASSRSFFSEIISSISDVRFSHDGRYIVSRDYLTVKIWDVNMERQPVKTIPIHEHLR
FT                   PRLCDTYENDSIFDKFEVVFSGDAENVMTGSYNNNFMIYPTDPSKETEIVLQADKSAFK
FT                   AKKVGVPTPMNKNGKKNGSRAGSPAGPGSRMKKETDADQIDFNKKILHMSWHPYEDSIA
FT                   IAATNNVSILALHFPSCYHSCDFAKVLIQSEQLFVFSAL"
FT   CDS_pept        join(1302301..1302801,1303026..1303102,1303149..1303848,
FT                   1303916..1304401,1304602..1305462,1305519..1306757,
FT                   1306816..1307445)
FT                   /codon_start=1
FT                   /gene_family="HOG000158405" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903393"
FT                   /orf_name="AFUA_8G05570"
FT                   /product="Transcription factor (Sin3), putative "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85320.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG057737"
FT                   /db_xref="HOGENOM:HBG738583"
FT                   /db_xref="InterPro:IPR003822"
FT                   /db_xref="InterPro:IPR013194"
FT                   /db_xref="UniParc:UPI000051E64B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC64"
FT                   /transl_table=1
FT                   /translation="MQHPSPQSLNRERERDSRERELIERQRQQEEMVHREREQRERERE
FT                   QLERQQLERQREQQHHPVQSHTGSIPLHQPVASKVPNSIHGPNGLLSNLGSNPPNGPQG
FT                   AMQPSGAPGGLYGSQMQHGEGTPRTYMQHPAGPPGQPMMFNGSGGPIPGNVAALAQGQQ
FT                   PILNVKVRFVDQPDVYNRFLDIMKDFKSQAIDTPGVIQRVSTLFNGHPALIQGFNTFLP
FT                   PGYRIECGTEDNPDAIRVTTPSGTNTLNMPRPRPSMDPAGDMGPAGGMGSHGRTDYYEQ
FT                   ARPGWQQQPQGQQQQGNLPASYSPGSRMMGPGMFGQGAQGQPQDHHFDYPTQQEQQAAA
FT                   GAAAMAHQQDQRGVSQLQGAAAASAAMGRAGMMQVSPASAQASGMNQPMNSLAGIGSGM
FT                   LQGSQADLNKRGPVEFNHAISYVNKIKNRFASAPEIYKQFLEILQTYQRESKPIQDVYA
FT                   QVTQLFNTAPDLLEDFKQFLPESAAHAKQQAAARQAEESIPISNVRGEPGYPSAGGLPS
FT                   QTPGRDMKMPPLGQFNVKDSAKDGKKRRGGPGAPSTMTSSISGPSAGAEAARVADAQAG
FT                   RPSALQTSNANKRAKVHHTKPSQTDVPAVSPTLIPALPEPIQPTQTMTPSQEEFAFFDR
FT                   VKKYIGNKSMFNEFLKLCNLYSTDLIDRNVLIKKAAGYIGSNPELMAWFKRFMHIDEPE
FT                   DKVIETKPKQESGVVNLSHCRSLGPSYRLLPKRERQKPCSGRDQLCYSVLNDEWASHPT
FT                   WESEDSGFVAHRKNQFEDALHRIEEDRHDYDHHIEACTRTIQLIEPIVQQFLVMSEAER
FT                   AAFKLPPGLGGQSEAIYQRVIKKVYDRQRGARIIREMFERPCHVLPIVLFRLKQKCEEW
FT                   KASQREWDKVWREQTQKAYWRSLDHQAIASKATDKKLFVAKHIQNEIQSKFEDARGLRK
FT                   SGFKVPRHQFEFTFDDPAVIIDATQLLLLFIDRNSAGFGADPSKVMAFIKDFVPIFYGM
FT                   DRDTFHMYMNEISSDAPSGEDGDDESLAAEDASTWRNRRGVNAKKMDLLRDVLERRSEK
FT                   ANRSDKDRNTPASRDGTPDAVLVPSTPVPEPAEAFDVAELKWMEHPGQGNFNLQREYAL
FT                   NESYVKKVHHLYANLNIYCFFRTFEILYSRLLRIKMHEKDAHEHVRRALIPKPARDLGL
FT                   IDKLPTDFFYDCDPKANLYQQIVRMCEEVIKGDMDASHLEETLRRYYLRSGYQLYNLEK
FT                   MFAGIAKFAGSIFNGDSKDRSADIINLFFKERDREETTHNQEIQYRKQVERLVKDGDIY
FT                   RITYNPQTKKTTVQLLTPEDATLENEELNQEARWSYYVSAYTMRDPTEGVPFSQMRMPF
FT                   LKRNLPPKLEQEEEYNRYYRPLVHQDGLIIRICANSYHILYEPGSCDWWWRPKALSEES
FT                   PEDIAKEEAAVKERRRDRFMEKFVNNPSWAQGLSKDQVDESNQRFRSWIRGPESEKEKE
FT                   KASVGATEEAGFEKKADNEDAEMPDADPTAPESKEQ"
FT   CDS_pept        join(1308874..1309016,1309079..1309319,1309369..1310334,
FT                   1310382..1310609)
FT                   /codon_start=1
FT                   /gene_family="HOG000172597" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056669"
FT                   /orf_name="AFUA_8G05580"
FT                   /product="Acetyl-coA hydrolase Ach1, putative "
FT                   /EC_number="2.8.3.8"
FT                   /function="acetate CoA-transferase activity"
FT                   /function="hydrolase activity"
FT                   /biological_process="acetyl-CoA metabolic process "
FT                   /protein_id="EAL85321.1"
FT                   /db_xref="GO:0006084"
FT                   /db_xref="GO:0008775"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG001544"
FT                   /db_xref="HOGENOM:HBG289696"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="UniParc:UPI000051E64C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC63"
FT                   /transl_table=1
FT                   /translation="MAASALLKSRVRRPSYLQKLAKAEDLIDLFPHGSYIGWSGFTGVG
FT                   YPKKVPTALADHVEKNNLQGKLQYTLFVGASSGAETENRWARLNMIERRSPHQVGKEIA
FT                   KGINNGQIKFFDKHLSMFPSDLVYGWYTLNKPKNRLDVAVIEASAITEDGGIIPGASVG
FT                   ASPELIQMADKIVIEVNTASPSFEGLHDITMSEVPPRRKPYLIMQPEDRIGTPHIPVDP
FT                   EKVVAIVESDYPDQTQPNAPEDATSQAIASNLIEFLKHEVRHGRLPQNLLPIQSGIGNI
FT                   ANAVIGGLSKGGADFTNLKVWTEVLQDSFLDLFDSGNLDFATATSIRFSPDGFKRFYDN
FT                   WEHYAGKLLLRSQQVSNSPEIIRRIGCIGMNTPVEVDIYAHANSTCVMGSRMLNGLGGS
FT                   ADFLRNSKYSIMHTPSTRPSKVDPTGVSCIVPFCTHIDQTEHDLDVVVTEQGLADVRGL
FT                   SPRERARVIIKQCAHPDYQPILTDYLDRAEYECLKKGMGHEPHLLFQAFKMHQNLQEKG
FT                   TMKITGWD"
FT   CDS_pept        1311088..1311951
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903394"
FT                   /orf_name="AFUA_8G05590"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85322.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000520295"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC62"
FT                   /transl_table=1
FT                   /translation="MTTQTPHLVSINKLTGTRVLVIGGTSGLGFAVARAALEHGASVLV
FT                   ASSRPEKVQSAVSRLRTLYPDEQFTTRIAGTTVDLGDESTLESNILTLLDKATQPDLFP
FT                   TNLSPNNADTPGKSEKVLLDHIVFTAGDALQIRPPTDPALDPAYIRALTTVRLLGGLIL
FT                   AKHVPTYMVQSARSSLTLTSGAVAMRPPPGYSVGAMLGNAINGLGRGLAVDLAPVRVNV
FT                   VAPGAVRTEMFDGLPEEVIERLKGRTLTGELGRPEDVAEGYLGVMKDGFVTGTVVQSDG
FT                   GMSIKT"
FT   CDS_pept        join(complement(1312403..1312489),
FT                   complement(1312218..1312342),complement(1312126..1312165))
FT                   /codon_start=1
FT                   /gene_family="HOG000158416" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903395"
FT                   /orf_name="AFUA_8G05600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85323.1"
FT                   /db_xref="HOGENOM:HBG057739"
FT                   /db_xref="HOGENOM:HBG328730"
FT                   /db_xref="UniParc:UPI000051F20A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC61"
FT                   /transl_table=1
FT                   /translation="MTQSSSSSSSRLQNDFGADLWVRSGTERRHPTAGRGLFAGLQDVK
FT                   HYNVDHGWAKRSQDQPQGLFSFLWSRFTGGAYRPPTDS"
FT   tRNA            complement(1315262..1315335)
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        join(1318148..1318160,1318274..1318591,1318712..1320231)
FT                   /codon_start=1
FT                   /gene_family="HOG000158427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265373"
FT                   /gene_name="btgE"
FT                   /orf_name="AFUA_8G05610"
FT                   /product="Probable beta-glucosidase btgE "
FT                   /EC_number="3.2.1.21"
FT                   /function="beta-glucosidase activity"
FT                   /function="cation binding"
FT                   /biological_process="cellulose catabolic process "
FT                   /cellular_component="cell wall"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="EAL85324.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0008422"
FT                   /db_xref="GO:0030245"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG024245"
FT                   /db_xref="HOGENOM:HBG057740"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI000051F203"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WC60"
FT                   /transl_table=1
FT                   /translation="MITSIPPKSLPSQEIKRGHRAPSFKSALSTTASLVQRAFLGLCNI
FT                   FTFLSTMRGAILATAAALAGTAMADVAHMRRHGHDSFHQRRSPLAEADATCGCTTEVVT
FT                   VWGPPTLIPVASPTPSTVTSEAVTTLHSTSTTTVTVIASASTPAASPSPATDKVPLPTP
FT                   AITNFPSTGVYTIPATTVTVFDTTTVCGATTTELPAGTHTYGGVTTVVETATTVVCPYA
FT                   TVEPSGTTVTSVIKTTTYVCPSAGTYTIAPTTTTVPTSTVIVYPTPAVITPGTYTQPEQ
FT                   TVTVTRTDYTYVCPFTGQDEPTSAPAAPSTTAVPATTTAAPETTTAAPDTTTAVPSTSS
FT                   AAPSSSSTAPASTGAVSGQMGMTYTPYTKGGDCKDKSSVLSEVAALKSKGFTHVRVYST
FT                   DCNSLEYIGEAARTSGLQMIIGVFISSTGVSGAQDQVTAISKWAQWDLVSLIVVGNEAI
FT                   QNGYCDASTLAGFISSAKSAFQAAGYTGKVTTTEPINVWQAHGSTLCGVCDIVGANIHP
FT                   FFNADVSADQAGKFVAQEIKVLESICPGKDVLNLETGWPHAGNANGKAVPGTSEQAIAI
FT                   KSIADEVGSKSVFFSYFDDLWKEPGQFGVERYWGCFDTFN"
FT   CDS_pept        join(complement(1323526..1325383),
FT                   complement(1323168..1323475))
FT                   /codon_start=1
FT                   /gene_family="HOG000158438" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265374"
FT                   /orf_name="AFUA_8G05620"
FT                   /product="Chitin synthase activator (Chs3), putative "
FT                   /function="binding"
FT                   /protein_id="EAL85325.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG057741"
FT                   /db_xref="HOGENOM:HBG326779"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000052051F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC59"
FT                   /transl_table=1
FT                   /translation="MTSSVASDYPQPISSPPPVYLRSSPPLSPSQSQSTPRSIPQQRAT
FT                   QHIARKALPGSQSENGYPPVPPVYIHTDMNLSQSSNMTHEDTRNGHVANSMPTTALANM
FT                   SLEDQSQNPQNSNGPFPPRRDSYAPPPAPASRKAGHTPASSGSWSVIDDQLKDEANGPV
FT                   QPSSDPAAPSDSQNNSSRGSLDSEARTENFEPLHYHHQPYRNSKVALKSPSGAASAENL
FT                   SGSNGHLSARRHGIPRPNSTYSFVSDMGGDGRNLSPGASPYLHARTSPRNSSSPDVRPL
FT                   SFVDLLNTPYPQPGPTPGQLDNSHLKSWVGNNASLLSHKQTFDMYLANVKKTDDPAVQY
FT                   EFAVFMVNAMLEMPPDDHEARKDAVYGGKAAGITRHSLLKEAKSIFQRLADRSYPFAQY
FT                   YLADGYASGLFSKGKEDYDRAFPLFLAASKHGHVEACYRTALCYEFGWGTRVEAARAQQ
FT                   FYRQAASKNHPGAMLRMAKACLAGDMGLGKRYREGIKWLKRAAESSDAQYNSAPYELGL
FT                   LHETGFGDDVFPDPAYAAQLFTKSADLGHVEASYRLGDAYEHGKLACPRDPALSIHFYT
FT                   NAAQSGHVLAMMALCAWYLVGAEPVLEKDEGEAYEWAKRAAELGLAKAQYAVGYFTEMG
FT                   IGCRRDPLEANVWYVRAADQGDERAKQRIATIRAAAEGRSPAQNGKEGQKEKQKSLGAF
FT                   NDPSCYLKLIHGTDAGKSGKSKRFTIF"
FT   CDS_pept        join(1330219..1332872,1332954..1333759,1333814..1333902)
FT                   /codon_start=1
FT                   /gene_family="HOG000158449" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265375"
FT                   /orf_name="AFUA_8G05630"
FT                   /product="Chitin synthase F"
FT                   /EC_number="2.4.1.16"
FT                   /function="chitin synthase activity"
FT                   /function="heme binding"
FT                   /protein_id="EAL85326.1"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG057742"
FT                   /db_xref="HOGENOM:HBG333864"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="UniParc:UPI000052004D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC58"
FT                   /transl_table=1
FT                   /translation="MSLPQRPGKVSPRREETQAFRDTSRRRRRDIESGDNETLSSPHRH
FT                   HHRRHSQSSRKTRDMDEERLEPGGHRKSQVRPERSRIDENHPNYHYRQKSQNMPVYPST
FT                   TGNEPLIEGDELNRDSSQSTEHRGREGDFATHGNINKPMERAPSRHRSKRKKSRKLSRR
FT                   AATEEKRRQKAMEQVRPPSPWSAYCAIITFWAPNFILKCFGMPQKAQREAWREKIGLIS
FT                   LILLIAAFVGFLTFGFTATVCSAPPLRLKINQVDRGYMIFHGEAYDLSKSKHPAAAGIP
FT                   ADSNVLYDLPHKYGGQDGSFFFQQVNGACKDLITLKPGSDIPSNSDGDLAWYFPCTAFN
FT                   QDGSSKPNFTSPYYNGWGCHTSGAARKAFYGLRSSGDVYFTWADTRNKSRNLAVYSGNV
FT                   LDFDLLNWLDESQLNIPAKFTELRTNPDVRGVDLTYYLQAGEDKRIGKCLSQIIKVGTI
FT                   DTDTVGCIASKVVLYVSLIFILSIVIVKFVFALFFQWFLSPRYAASKTSMGADSKTRKQ
FT                   EIEDWSNDIYRPGPRLADQHLPDRPNKRASFLPTTSRFSSPYTVSNGGKQKPQYITMAS
FT                   QNSTSRLLPSTAGSMYKQSHNSSGGSLHLEPSRLNPAASGTSLAVGAESDVLGSSAYIH
FT                   EAVVPQPPPEWQPYGFPLAHALCLVTCYSEGEEGIRTTLDSIAMTDYPNSHKTIIVICD
FT                   GIIKGKGEEYSTPDIVLRMMRDPVIPTDEVEAFSYVAVATGSKRHNMAKVYSGFYDYGE
FT                   TSVIPPEKQQRVPMMIVVKCGTPAEATQAKPGNRGKRDSQIILMSFLQKVMFDERMTEL
FT                   EYEMFNGLWNVTGIPPDFYEVVLMVDADTKVFPDSLTHMISAMVKDPDVMGLCGETKIA
FT                   NKTDSWVTMIQVFEYFISHHQSKAFESVFGGVTCLPGCFCMYRIKAPKGGQNYWVPILA
FT                   NPDVVEHYSENVVDTLHKKNLLLLGEDRYLSTLMLRTFPKRKQIFVPQAVCKTVVPDKF
FT                   MVLLSQRRRWINSTVHNLMELVLVRDLCGTFCFSMQFVVFIELVGTLVLPAAIAFTFYV
FT                   VIISIIKKPVQIIPLVLLALILGLPGVLIVVTAHRLVYVLWMFIYLLSLPIWNFVLPTY
FT                   AYWKFDDFSWGDTRKTAGEQDKGHEAGEGEFDSSKITMKRWRDFERDRRLKMQSGWAQP
FT                   AVGGGYPAQYEPYSDY"
FT   CDS_pept        join(1335431..1336466,1336529..1337967)
FT                   /codon_start=1
FT                   /gene_family="HOG000158460" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207967"
FT                   /orf_name="AFUA_8G05640"
FT                   /product="WD repeat protein"
FT                   /protein_id="EAL85327.1"
FT                   /db_xref="HOGENOM:HBG057743"
FT                   /db_xref="HOGENOM:HBG328063"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000051FE25"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC57"
FT                   /transl_table=1
FT                   /translation="MPGPSDFAFTTSASSSPSYFFTSPSEHPTHPRYRNRTSHASSCDA
FT                   PGPSRLRPVDMSFGQASFYDDQDSDEMSREGDEHAALRTDIDEFPIVATISESHQVGLT
FT                   PTNDLGSSDAGISAFTAVSQYPNAFDNDSNAFAVTEVVNAVIGREEYLRGEGRHVRAAS
FT                   VGRSSSPPADLYMSDSETTDVLGHQGGVPIGPYMADGGMTMDNILADDPTLEHHFSTIP
FT                   EESDEDDVGDLIMDYESPMTRDGFSVSDHEEDPDDTQKFYVDHDDDYYEEHIDRPRTRE
FT                   ATAQLTDVDFNDFYRAFDYDPFLVMEAAPTGNHGDHNNLPEGEATEGLPGVDLAHLPAS
FT                   VLHGTTHERNFTIDQFISQWLLESTRHSPPTLPLTSRLLPPYPISRILGWTPPEKIIRP
FT                   NNYNRDFYDIQQIPWWEALRVKRSDARELRDLWYTSYHNVDYPHPQLDGKLPQEEFYFR
FT                   EKSMHTKHRASIEHFQLRNLMSVPAYNTVHFSHESKVYSWVPAHDDLSCLIDLSKPPIN
FT                   SGFRGPVKISTMKSAHNICIAGGFTGEYALRPAGKEGAKVEGYVTTNANGITNHIDIVP
FT                   SRTSHTPMGIFASNDQHLRVLDCETNTFIADHELSRAINCTATSPDGRLRVVIGDSPDA
FT                   WVVEADTGRPVQPLRGHRDFGFACAWSPDMRHIATSNQDKTVIIWDARTWRILQTIESD
FT                   VAGYRSVRFSPVGGGPRTLLLAEPADRIAIVNAQTYQTRQVHDFFGEIGGADFSPEGST
FT                   IWVANTDEHFGGFMEFDRRQWGQPYGPRGLPNEWIREADLDEDERCVLSERERQMRFWW
FT                   NLSDEEHEALLL"
FT   CDS_pept        join(1338439..1338873,1338951..1339085)
FT                   /codon_start=1
FT                   /gene_family="HOG000158472" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265376"
FT                   /orf_name="AFUA_8G05650"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85328.1"
FT                   /db_xref="HOGENOM:HBG174412"
FT                   /db_xref="HOGENOM:HBG328064"
FT                   /db_xref="UniParc:UPI000051F947"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC56"
FT                   /transl_table=1
FT                   /translation="MSFSNIIQDALSGHSHSNNNSRHDNNYDEFNPAVRYAESHANTSD
FT                   SSLFTSALSFLNENKHRLSNDNDINEQEMIHAHQSLYDGRDSERRHDSSSVGAGAAMQA
FT                   LKMFTSSSEGEKSGMDKNAFIGLAMAQAKKMFEEKEAKGEVNGDKQSAINAAAEMALKM
FT                   YLKSGGGGMTGTGGPGGLLQLASKFL"
FT   CDS_pept        join(complement(1343670..1343726),
FT                   complement(1343401..1343640),complement(1343269..1343314),
FT                   complement(1342723..1343205),complement(1340973..1342670),
FT                   complement(1340829..1340920),complement(1340529..1340779),
FT                   complement(1339958..1340478),complement(1339492..1339907))
FT                   /codon_start=1
FT                   /gene_family="HOG000260265" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265377"
FT                   /gene_name="myoA"
FT                   /orf_name="AFUA_8G05660"
FT                   /product="Myosin-1"
FT                   /function="ATP binding"
FT                   /function="actin binding"
FT                   /function="motor activity"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="EAL85329.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="HSSP:1MND"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="UniParc:UPI000051E64D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WC55"
FT                   /transl_table=1
FT                   /translation="MSTVNPHNQLQMKLFLTQKGHSRRPAGGEKKSRGFGRSKAVADVG
FT                   DGRQTGGKPQVKKATFESTKKKEIGVSDLTLLSKISNEAINDNLKLRFEHDEIYTYIGH
FT                   VLVSVNPFRDLGIYTDNVLQSYRGKNRLEVPPHVFAVAESAYYNMKSYKDNQCVIISGE
FT                   SGAGKTEAAKRIMQYIASVSGGTDSSIQHTKDMVLATNPLLESFGNAKTLRNNNSSRFG
FT                   KYLELEFNTNGEPVGANITNYLLEKSRVVGQITNERNFHIFYQFTKAAPQKYRDLFGIQ
FT                   QPQSYLYTSRSKCFDVPGVDDSAEFRDTLNAMNVIGMTEGEQDEVFRMLAAILWIGNVQ
FT                   FAEDDSGNAVITDQSVVDYVAYLLEVDAAQVNKAFTIRVMETARGGRRGSVYEVPLNTV
FT                   QALAVRDALAKAIYFNLFDWIVQRVNASLTARGEVANSIGILDIYGFEIFEKNSFEQLC
FT                   INYVNEKLQQIFIQLTLKAEQDEYAREQIQWTPIKYFDNKVVCSLIEDKRPPGVFAALN
FT                   DACATAHADSSAADNTFVGRLNFLSQNPNFENRQGQFIIKHYAGDVSYAVAGMTDKNKD
FT                   QLLKDLLNLVGTSGNQFVHTLFPEQVNQDDKRRPPTASDKIKASANDLVATLMKAQPSY
FT                   IRTIKPNDNKAPREYNVGNVLHQIKYLGLQENVRIRRAGFAYRQTFDKFVERFYLLSPK
FT                   TSYAGDYTWTGDAESGARQILKDTSIPAEEYQMGITKVFVKTPETLFALEAMRDRYWHN
FT                   MAIRIQRAWRNYLRYRTECAIRIQRFWRRTTGGLEFIKLRDQGHQLLNGRKERRRMSLL
FT                   GSRRFLGDYIGVGNKGGPGEMVRNGAGISGSEEILFSCRGEVLVSKFGRSSKPAPRILA
FT                   LTNRHVYIIAQNLVNNQLVISSERTIPIGAIKAVGASNLKDDWFSIVVGSPQEPDPLVN
FT                   CVFKTEFFTHLNNALRGQLNLKIADHIEYNKKPGKLATVKVVKDPAVARDDSYKSGTIH
FT                   TGPGEPANSVSKPTPRPKQVSARPVTKGKLLRPGGPGGGPSKLAARPTPAAQPLPRATP
FT                   QPAEPQPAARAVPQPVAAVAASHTRTGSTASVRAPPPPPPAAAPAPKKPTAKVLYDFNS
FT                   QQSNELSIKAGEIVQIVSKEGNGWWLCMNMTTSAQGWTPEAYLEEQVAPTPKPAPPPPP
FT                   AAPRSTPAPATNGAAAAAKAKPAPPAPPAKRPNMAARKAVPTPPPAPRDSAVSMNSHDS
FT                   SGGSGRGTPNSMSNASLAGGLAEALRARQHAMQGKQDDDDDW"
FT   CDS_pept        join(complement(1346712..1346771),
FT                   complement(1345853..1346674))
FT                   /codon_start=1
FT                   /gene_family="HOG000158483" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903396"
FT                   /orf_name="AFUA_8G05670"
FT                   /product="OPA3 domain protein"
FT                   /protein_id="EAL85330.1"
FT                   /db_xref="HOGENOM:HBG057744"
FT                   /db_xref="HOGENOM:HBG396659"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniParc:UPI000051ED0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC54"
FT                   /transl_table=1
FT                   /translation="MSLTLKLSSLVIRTLSKPIALWKTYTFKNQIKAQAREHERFRRVC
FT                   VSIAQSLHRIDMRLRLGNLRDNAAAQKRAAAEAEVRKHKPTVPTVKTEAETKAEEEAIA
FT                   KAKAAASEAAKPAPTPHIRPLSESKAIESGATFISETFLFLVAGGLIVFESWRSRRKET
FT                   TRREDVEARLVELEQSEKAARKALVALEKEVIHLKAKAGESVKPPIRILPREVWEVEQE
FT                   EEADELTELDWWSRITSIFTFRQTTEQKPGDEPKPVVKSTQSSSSNSAARIQFDQSPAK
FT                   SVAQESPSVKNP"
FT   CDS_pept        join(1347493..1347801,1347874..1348316,1348375..1350427,
FT                   1350483..1351037)
FT                   /codon_start=1
FT                   /gene_family="HOG000158494" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265378"
FT                   /orf_name="AFUA_8G05680"
FT                   /product="Serine/threonine protein kinase, putative "
FT                   /EC_number="2.7.1.-"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85331.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG057746"
FT                   /db_xref="HOGENOM:HBG328066"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000959"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015728"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000051FBD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC53"
FT                   /transl_table=1
FT                   /translation="MEALSPRSTNHLIRPKISMERKVLDKNAAAAAAQKAASSKIHAPP
FT                   PPSLVIEPAEGGERYSTGAFLGKGGFAICYEGTLLRNGRVFAMKVVRSEMGQKKMQEKF
FT                   RTELQIHSKMRHPHIVEFHRAFAFDKCIYVVLELCPNGSVMDMVRKRKCLSLPEVRRFM
FT                   IQLCGAVKYLHKRSVAHRDLKMGNLFLDRNMDIKVGDFGLAAMIISEKDEKRRKTLCGT
FT                   PNYIAPEVLDKSKGGHTQKVDIWSLGIICFAMLTGYPPFQSKTQEEIYKKVRNLSYVWP
FT                   SGTQCANHIPDEAKSLVSSCLNLSENERPDPDDIVEHPFFNMYDGCIPRRLDPTCTVST
FT                   PIWLRSDEPRGDRMMLGHSLEYDEKLAGYIEQVDDPTQRYLICRTAFYSLCGVGRKPDG
FT                   TARKCVGKNCSKSAFAECVSEEEKGIQPVMPLPEDMVYRYPSDPDGDWSMPSPGLALSK
FT                   DDSSLDGIRSSGKRTVSMRSNPTSLSRTQAALAAAQQRRKEPQSHAATLRQQAMGARSS
FT                   VRKIAAICDPPAVVEPDSAAPVMPTGGLAERPIRARRGVAVSYSGSTRDLDRRIVPSTS
FT                   DPGMLTVGKTRSQSRRLGAESNEARSAPAVIKERSVSSALDNLPTKLRQSSARSVAREE
FT                   ALQYSKRHELEAEEEVKAREVPSGDGRLRTEAAVSRSSNKTASTSSSKRSTLGLYPLLH
FT                   PDDHCEMMPRTSLEDVNTDLRLMLSNLVPPVSGRRRVSSRRTPHAYVIKWVDYTNRYGI
FT                   GYVLDDGSVGCVFKAENGQPASGVLLRNGERHIRRKARSLSKQKDGASTYSEADQLVPR
FT                   NGKPVEFYENCEITSSDGLTGIRRALIPPSVFEVKPSSDGSSGAGIKVRTNSGLERARA
FT                   DAEKIKRVKLVDQFGKYMIGSLGRHDDDDISEDDKPTDGPGQFIKFYQRLGNVGVWGFG
FT                   DGAFQFNFPDHTKLVISPGRTRASSPWIDFYHLSPSAARYLSAKGKMHPSGFDTRAVAS
FT                   DEATAFLSIAHGSAMSSVDERIRDVLESNFFLEKISFIREVMKSWVKHGRLGGGPSQDQ
FT                   TSADAPMMLWEGTQERAQLGGGKFVWVTVGAPGGDGEYRSISLKERESEGRENDPEMES
FT                   LRERLRILATKP"
FT   CDS_pept        join(complement(1353425..1354022),
FT                   complement(1353125..1353357))
FT                   /codon_start=1
FT                   /gene_family="HOG000158505" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265379"
FT                   /orf_name="AFUA_8G05690"
FT                   /product="Acetyltransferase, GNAT family family "
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="EAL85332.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG057747"
FT                   /db_xref="HOGENOM:HBG333712"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000051F948"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC52"
FT                   /transl_table=1
FT                   /translation="MRCKSCNIRGAICSTPAHSSNVLAHRISISSRVSLAAFPSYQTNN
FT                   NIQIEYTAKEKREKEMPFELLPADPTDSPALTTVFLSAFSSPFNQRLFPRTPDVITYWT
FT                   AQFTSFINNPHKAVLKITNSEDGSIVAFAVWQLPVPSSPEDVHLKHSHSPPHSHAHAQA
FT                   GDEHPYPASSDRELCEVFFGGMEEMKKRIMGSRPHYYLEMLGTRPEYAGQGLASKLLRW
FT                   GLERADEVGLETYLSASPAGRPLYEKFGFRVVEEREVVAGYVQGYMLRAGRVAN"
FT   CDS_pept        complement(1354137..1355003)
FT                   /codon_start=1
FT                   /gene_family="HOG000158516" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903397"
FT                   /orf_name="AFUA_8G05700"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85333.1"
FT                   /db_xref="HOGENOM:HBG057748"
FT                   /db_xref="HOGENOM:HBG328076"
FT                   /db_xref="UniParc:UPI000051F956"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC51"
FT                   /transl_table=1
FT                   /translation="MAERPRPTVLRRVLTAIIDPVDREEQGYHQYPTMRGLHDPENEGL
FT                   YMGSANNPQLARRLTVATTHASTLIPPSDKLLVFRALTGIDTVPALAIPHHHPRSAPNV
FT                   GIYTRVVRAEQAAAQQFRFFSILMNTCLGIQIVVAAALTALGAARGPHNAVTAFGAINT
FT                   IMAGILTYLKGSGLPDRLKHYQNEWRNIREYVEQREREFCLDGCQLDVQAEVVFIESMY
FT                   EGVKREIEATKSGENRSSAGPGQMRRSFLPQARAPELQKQPGKPVAGSPVSVPEPVLEK
FT                   NQPYERV"
FT   CDS_pept        complement(1356780..1358408)
FT                   /codon_start=1
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16265380"
FT                   /orf_name="AFUA_8G05710"
FT                   /product="MFS sugar transporter Stl1, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85334.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG330944"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000051FE22"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC50"
FT                   /transl_table=1
FT                   /translation="MWTTTSGLSGRSLRLSITFAAVVGFSLFGYNQGMMAGLLNGDEFV
FT                   NSFPILKMPDNPTAGEKHYIDVIRGAVTSCYELGCFFGALFSMFCGNRLGRTRLIFMGA
FT                   SILIVGALLTTVCYTGKWEVGQFVIGRVVSGIGNGMNTATIPVWQSECSGAHNRGFLVC
FT                   FEGAMIAGGTFIAYWVVFGISHAADSVQWRFPVALQIFFALVVATGALMLPDSPSWFVS
FT                   RGLDNEACEVLGKIKGTSPDSDQVLHDFNLIKTDMESTKSEQSNWKTVFTFGKTQEFQR
FT                   LLIGCSGQFFQQFTGCNAAIYYSTLLFQENLHMEKYLSLIMGGVFASVYALATIPSFFM
FT                   IERVGRRKLYLIGFLGQGLSFVITFACLIKETEENSKGAAVGIFLFITFFAFTLLPLPW
FT                   IYPPEINPLRTRTVGASASTCTNWMCNFAVVMFTPLFAGQSPWGVYLFFALFNFVGLIF
FT                   GYFFYVETAGRELEEVDIIYAKAHVEGKMPFRVAHDLPKLSFEEIVQQSRELGLDTNDH
FT                   VMLEKKELGLSSDSAQETEEVYEKQ"
FT   CDS_pept        join(1362558..1362879,1362932..1363203)
FT                   /codon_start=1
FT                   /gene_family="HOG000217386" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265381"
FT                   /orf_name="AFUA_8G05720"
FT                   /product="DUF567 domain protein"
FT                   /protein_id="EAL85335.1"
FT                   /db_xref="HOGENOM:HBG057749"
FT                   /db_xref="HOGENOM:HBG329434"
FT                   /db_xref="InterPro:IPR000007"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="UniParc:UPI000051FE26"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC49"
FT                   /transl_table=1
FT                   /translation="MASQQLSPVPKPLALFDRFIAQQTETMALKEKVLSISGDSFDVKL
FT                   ANGQPIFQIKAKHMSLSGRKSVFDMAGNHLFDIVKEHLHIHTTFAAVDPHGKKLLEVKS
FT                   SFSLVGSKTIATFTSSKTGSIETLKMKGNWLDTKVDIVDEATGAVVAQINRKLWQGREV
FT                   FFDQQTYAVSVARGVDLALIAALCVCFDEKNNEK"
FT   CDS_pept        1365197..1365565
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751332"
FT                   /orf_name="AFUA_8G05730"
FT                   /product="Beta-glucosidase, putative "
FT                   /protein_id="EAL85336.1"
FT                   /db_xref="HOGENOM:HBG057750"
FT                   /db_xref="UniParc:UPI000051EF8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC48"
FT                   /transl_table=1
FT                   /translation="MWFPGICNGTIPEWRLNEMIRQILTPYYYSSQDHEYPTIDPSSYA
FT                   VTAATYGILPAGEVTPAGRDVRGNHSLLIRKIGSAGTVLLKNKDKTLPIRPAWVIGVFG
FT                   NDAPDINGGLLPEQQLRA"
FT   CDS_pept        join(1366522..1366672,1366764..1367401)
FT                   /codon_start=1
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056670"
FT                   /orf_name="AFUA_8G05740"
FT                   /product="RTA1 domain protein, putative "
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85337.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123771"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI000051E650"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC47"
FT                   /transl_table=1
FT                   /translation="MANSGYYPYEPSKAGATVAMLLFGSSAFVHLWQILKARTWFFTAF
FT                   LIGAFSYIFRLISARSPDSLVPYIGQSMFIILPPSLYAATIYMTYGRIVVYVGKPHLSI
FT                   ISPRKVTKLFVLGDVSAFLLQLGGGGMQTIDSMRNIGQKVLVVGLFVQLIFFGFFLYVS
FT                   VSFQIRLRRSGFDLIGGLWRRLLQILFLVSALIIARCVFRIIEYVEGTGGYLYSHEAFM
FT                   YLFDMIPMFFVQAIFHFYHPGKILVAKSFPDDQHVSLQEM"
FT   CDS_pept        1367743..1368972
FT                   /codon_start=1
FT                   /gene_family="HOG000217387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903398"
FT                   /orf_name="AFUA_8G05750"
FT                   /product="C6 finger domain protein, putative "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85338.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG053035"
FT                   /db_xref="HOGENOM:HBG331057"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000051F943"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC46"
FT                   /transl_table=1
FT                   /translation="MVASNASAVISRYRRSTSLDPQGLTEADTARQCDESRPVCANCNI
FT                   SNRHCSYEDLVSKAYTLVKSPSKLPTSRGPKGADKTTLKSPSRSSIDAGTANDSLPVNK
FT                   LHLELFHHFISEILTVVGFERLSDGCSTVKMIKIILTAPFLMNQILAFAALHLSIIRPL
FT                   QRKFYRDHAAQLQTHALSEFNGANMDLTPDTCLPMFLFSSILALHMLSEKLVYCKDAFE
FT                   DFLDDFIQSLRLYRGVRAVTNQSWHLLRESPLKSVLEVEAHALDQGVSEHECLELMSRI
FT                   ESSPLDSNIKDIYRQAIEYLQKAINASHTHPSKLSTIGPILSWPVIIPDQYIDFLSERR
FT                   PQALVILSYFGALLHLHRDMWTFGDGGLYIISSVKGYLGPSWADWLRWPNQVMDEPSIM
FT                   SEIDGYPTHK"
FT   CDS_pept        join(1370024..1370171,1370221..1370287,1370352..1370635,
FT                   1370683..1371266)
FT                   /codon_start=1
FT                   /gene_family="HOG000136697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207968"
FT                   /orf_name="AFUA_8G05760"
FT                   /product="Dehydrogenase, putative "
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="EAL85339.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG057751"
FT                   /db_xref="HOGENOM:HBG328077"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F496"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC45"
FT                   /transl_table=1
FT                   /translation="MGDAALVKEQLLIAFMHDLPATIIEDIRAKFPTAEITIIHLERMA
FT                   PIPSEYARKATIIVTFTNLPNIEDSANIKLIHTLSAGVDHLLTHPILKDSKIPISTSSG
FT                   IHGPPIAEWTVLNWLAASKGFVRTYENQKQHVWGNVDEYMYGLHDQVGKKVGILGYGSI
FT                   GRQIARVAVALGMTVHAYTASPRPTPESRRDTGYIIPGTGDKDGSIPVSWHHGTDKASI
FT                   HSFLRLGLDHLVVCVPLTAQTHHLLGAEEFAVLSSHIPAGHPKPYLTNIARGKVIDQEA
FT                   LIASLRSGELSGAALDVTDPEPLPADHPLWDLPNVRISPHISSLGKEYFPRSLDIAREN
FT                   MWRLERGEPLVNEYKRTRGY"
FT   CDS_pept        join(complement(1372556..1372977),
FT                   complement(1372001..1372490))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056671"
FT                   /orf_name="AFUA_8G05770"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85340.1"
FT                   /db_xref="HOGENOM:HBG057752"
FT                   /db_xref="UniParc:UPI000052074F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WC44"
FT                   /transl_table=1
FT                   /translation="MDGLSIGASVIGIATAAIQSVQVLARTIDNIKNVPDTIATIKVEL
FT                   QAVEPLLRRLNVELQRDDSQIILSNEIRFAVLNCDRACKAFRTLLDHWMSKSTDEKTFW
FT                   MDRWRVGLFGKERIMTLKGQLNDCKGTLNVALLTATTIATTRQENMMNELRDAILRQNE
FT                   AFLQQEISRADGQCAEIQLSLQQVEASDNGQQNGDLEQSRNELLQEIRQQQASHDAFRI
FT                   TCEGELSRTVYERTGQKIKGVKATNHSSSLAGFINTSGDELTIDQDISDVTADNWSVAA
FT                   AGVIKNLNFKDLRSTATSRQTP"
FT   CDS_pept        join(1373477..1373600,1373675..1375118,1375239..1375929,
FT                   1376047..1376136)
FT                   /codon_start=1
FT                   /gene_family="HOG000048584" [ FAMILY / ALN /