(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_1

ID   ASHGO_1; SV 2; linear; genomic DNA; GRV; FUN; 693414 BP.
XX
AC   AE016814_GR;
XX
DT   01-SEP-2009 (Rel. 111, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) chromosome I, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016814.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..693414
FT                   /culture_collection="ATCC:10895"
FT                   /organism="Ashbya gossypii"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /strain="ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome I"
FT                   /chromosome="I"
FT                   /db_xref="taxon:284811"
FT                   /db_xref="taxon:284811"
FT   source          3065..58136
FT                   /clone="BAC clone bAG 1087"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          43901..90510
FT                   /clone="BAC clone bAG 2402"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          81769..144133
FT                   /clone="BAC clone bAG 1691"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          139741..216782
FT                   /clone="BAC clone bAG 1057"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          209191..272642
FT                   /clone="BAC clone bAG 1719"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          243125..310752
FT                   /clone="BAC clone bAG 1131"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          272646..345488
FT                   /clone="BAC clone bAG 1409"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          343611..404120
FT                   /clone="BAC clone bAG 1225"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          399219..464416
FT                   /clone="BAC clone bAG 1479"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          449530..533207
FT                   /clone="BAC clone bAG 1475"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          516353..602441
FT                   /clone="BAC clone bAG 1529"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          588526..653755
FT                   /clone="BAC clone bAG 1415"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          638852..687828
FT                   /clone="BAC clone bAG 2436"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   CDS_pept        8108..9067
FT                   /codon_start=1
FT                   /gene_family="HOG000066056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759125"
FT                   /locus_tag="AAL186W"
FT                   /orf_name="AGOS_AAL186W"
FT                   /product="AAL186Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50180.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124558"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI00002523C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB7"
FT                   /transl_table=1
FT                   /translation="MFPSSATLLSFYAATSYVAALYVFPGRRIYGHASRNDPKAIWYGM
FT                   KAVGCGVLANLLIIPWLQSRLASDGFSFVDCFFRLGLVPGAYAHFRGLHWDTLAYATDI
FT                   LRALSILGSLYAADLLDSAAYYLLVPDTSPVVDLVDRLSCTTGLRNYVFGPITEELVYT
FT                   SMVLQNYRLLQPTISRAMLLLATPMFFGVAHVHHARQLLATGHRPAQVALTSSFQILYT
FT                   TLFGTFTNYIYYHTAGNLWACILLHAVCNYLSFPSLSSDVFADYCAKVPPALRALWKMR
FT                   LLHAWGYTYRLCLLCGLLAFLDGIRTFSSSAGDLFLDA"
FT   CDS_pept        9537..12593
FT                   /codon_start=1
FT                   /gene_family="HOG000144432" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081542"
FT                   /locus_tag="AAL185W"
FT                   /orf_name="AGOS_AAL185W"
FT                   /product="AAL185Wp"
FT                   /protein_id="AAS50181.1"
FT                   /db_xref="HOGENOM:HBG057985"
FT                   /db_xref="InterPro:IPR013941"
FT                   /db_xref="UniParc:UPI00002523C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB6"
FT                   /transl_table=1
FT                   /translation="MKADYTARASKTRGGQKVGGVRRESAGQGMSMSEDEFQAAQVRQR
FT                   RSKSCAGPLEGVQERVLRAHTRQAKEKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDL
FT                   LMDPEMEFRMNGAAVSPSASPRNSLTEESLEWFQLSAEQEQGGELPLHAESIDAHSSAG
FT                   GSSDTARDELLTSASSVVPSEELSCSHPLSPPAAAKKSTLMSSRSKLGRQHTDTTHTKQ
FT                   ATGEPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRIGARHGRGDSPVQQSNTPVAN
FT                   GESSTASARSLVRKQSRLRKSFTEVEAIEESQFTDSIGSEIPVGKRMRVSSLKEITEEL
FT                   TRISNNAGLTDSDAITLARTLGIGSQSADEHATFSECVPSAEAEENEYASSILAKNGLA
FT                   IPARSSLRRSKFTTYRIRSAGSDSSPPENKSTSSSSLAAAYERNSRSPKMQKAAFKGSH
FT                   PRLSGENTSLAPQSPNSINDIYDHYNTSDTDDGSPELQGSPVTHTSDASFTSSPNIASG
FT                   EHCARNAHKISPISVSQLSATSSSSTSPGSSKSAESTKSWTFDQKSPLRSITLNSSTKG
FT                   HKISAEKKKGWSWFGNSRRPSSESVLLPGTDSEGCPMDESQPIQSEEYPLKHPISPVSD
FT                   ETPRRGNHSRNRHQTSSPEELEIGWTETSLTTLDGDTEQDGKPQHPKTKEKLEKKFMKI
FT                   FKKRSGTGLSQDTPNQGEESSLKATSRIRRSRESKRQTDEPSASLTTSVSLNNHNNGRK
FT                   SVSISRPTWQRTESSYNGDKGKGSITSLQPAVSVTSSRDSHEQTRQDPQPQSLVTKMDG
FT                   SSSNGVTVSSQRAGFSKKGRSKTSHSRSKLSTSHDIAPVDNRPSDVDQKSTEANNTLSS
FT                   RAEDSHPSLDPGKSALGPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPL
FT                   TVSTVIMFDHRLPIYVERAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQ
FT                   QIEEDKNQGIQFESTDNMASSSGVVPEKW"
FT   CDS_pept        12906..13244
FT                   /codon_start=1
FT                   /gene_family="HOG000141943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759126"
FT                   /locus_tag="AAL184W"
FT                   /orf_name="AGOS_AAL184W"
FT                   /product="AAL184Wp"
FT                   /protein_id="AAS50182.1"
FT                   /db_xref="HOGENOM:HBG058035"
FT                   /db_xref="HOGENOM:HBG203432"
FT                   /db_xref="InterPro:IPR015080"
FT                   /db_xref="UniParc:UPI00002523C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB5"
FT                   /transl_table=1
FT                   /translation="MATDNFYRMMILLEEPHKQHSTDGRKIENASHDFVDELLLPIQVD
FT                   DLEVLNTWFDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLD
FT                   EDSSSDAK"
FT   CDS_pept        13713..14846
FT                   /codon_start=1
FT                   /gene_family="HOG000023981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081802"
FT                   /locus_tag="AAL183W"
FT                   /orf_name="AGOS_AAL183W"
FT                   /product="AAL183Wp"
FT                   /function="heme binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="sphingolipid metabolic process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50183.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0006665"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG155463"
FT                   /db_xref="HOGENOM:HBG329706"
FT                   /db_xref="HSSP:1AQA"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="InterPro:IPR014430"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI00002523C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB4"
FT                   /transl_table=1
FT                   /translation="MVSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGG
FT                   DQYILDYAGKDITAVLKDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVME
FT                   VTPENLDTTTFVKELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYID
FT                   QIHRPRHYGKGSAPLFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCF
FT                   AAGVFVWTLIEYSLHRFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALF
FT                   VVLCAPFYRLVFSIFPEYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLE
FT                   HHYKNYELGFGVTSWYWDKVFGTYLASNSPVSRPKCE"
FT   tRNA            join(15918..15955,15985..16028)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        16155..19850
FT                   /codon_start=1
FT                   /gene_family="HOG000166512" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081803"
FT                   /locus_tag="AAL182W"
FT                   /orf_name="AGOS_AAL182W"
FT                   /product="AAL182Wp"
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS50184.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG505437"
FT                   /db_xref="HOGENOM:HBG526359"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI00002523C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB3"
FT                   /transl_table=1
FT                   /translation="MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAI
FT                   RFVLSDDYTNLKREERRSLIYQGTSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTV
FT                   GLKKDEYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEE
FT                   VIGAKSFERKLKESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKR
FT                   KMCQFALYDRELNEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGS
FT                   ELKMKESTDLQQAKDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQI
FT                   AVKEQQLARLSPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWID
FT                   QELSILKEELQCSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQ
FT                   ELTVLKKAHLFKIDERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNV
FT                   SEIAQRLNLPEGSVFGPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELY
FT                   NSKGGRVTFIPLNRVHVDSNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVK
FT                   DLNQGTKLAKQFRLNAITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGN
FT                   KSQLEEVKEKLHSIDQEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEET
FT                   MVQLISKEEKAKINQKLLQDKLDMYTEDLSRDFDTELTLTEREELDEIAKKLPDLENLL
FT                   NTTTDALSSVVVKIDSLKAELDSKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDER
FT                   KTLLERKSTVDNEVQKISEIIDTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKS
FT                   MLRKMTLSTRRDELQQKIRDIGLLPDDSADKYHNMSSSELLKELSSINDKISKMTNVNK
FT                   RALENFKKFDDKQKDVMKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQL
FT                   FEKMVPRGTGKLVIHRRENEPSKPSKRQQKKRKRQETEDVHFNDDQDENSSQDSIYSGV
FT                   SIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRT
FT                   AVAATVKQLSSQAQFICTTFRGDMIAVADRFYRVNFENKISTVVEVTKAEALNFVTGRE
FT                   KNENVI"
FT   CDS_pept        complement(20056..23721)
FT                   /codon_start=1
FT                   /gene_family="HOG000141978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081804"
FT                   /locus_tag="AAL181C"
FT                   /orf_name="AGOS_AAL181C"
FT                   /product="AAL181Cp"
FT                   /protein_id="AAS50185.1"
FT                   /db_xref="HOGENOM:HBG058083"
FT                   /db_xref="HOGENOM:HBG103704"
FT                   /db_xref="InterPro:IPR018844"
FT                   /db_xref="UniParc:UPI00002523C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB2"
FT                   /transl_table=1
FT                   /translation="MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSI
FT                   AGGRGEFSSGIGNTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCA
FT                   KMYPGLAEEPEIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEAAGDRTIYMK
FT                   KRKLNTGAAGVPAAGGSVQAAVLNVAKKRASIKTSALRVSTPLANQIYPPPTKKQVNSD
FT                   FEDDDVADKSILPPPPPQSPPIRISSGMDQKRINMNDNAVSKSETVDPNKSRQQRLPSG
FT                   TPMRPVSMVETPNRVSLTGPTVLSESTVSQKSTATPIITNIRITSGMLRIPEPRLSEVE
FT                   KELKEGPASPAVDLPARPSRIPMKKPYNPSMQQDEDLSSSSSSTEDNVPAVPYENELER
FT                   SGPTMATRQSSSTIADDQGSPTKKSRFEKNNIGLVELPSPRKSSLEKKVSKLNKGLASD
FT                   KGHEDSTGGITRKDHFSDEESEASQNGSVVVNRPETQREKSFQKSELLKIFNSKRFDLP
FT                   PRFKNSASEDEPTSSNQSRKKKPYVTVLNKDIDNSSPDPRNIIPRRTQRHAAQKAAQSI
FT                   SSGTSRSNVFSGEEKNKYSEENQGDNIASDDNEGVYVHESNALKKLNVHPLKESVVQDT
FT                   LTGAQDINNPVSSRTVHPSISEHAVTAAASGTLSSNPEYRVAPIVTPTLMSSAVPGKPE
FT                   AILSKQGDPPASTALKPQLAPARKVESTQKKQAGKKSDTNQPSRTNSKKTGLPADTAVP
FT                   SSQKTVRARAAQIDAQIKQTATSSQSPVAESQSSVLNSEEAVADKSEVDNNSSTQDKSL
FT                   QQKTSKRKTPVKRTANADKKAVTLKRSSNSKGKEKDTEKGKERIKEKEKEKEKEKEKEK
FT                   EKVYQTPEFVESSDDERADAKTPLEKHSSDRPKSGSPSKHENGQEKQDSFSGIILKKTA
FT                   IEKDKVVANAPHKVNEKPMTADAGSTNLSPSGKVSKLDELRSKFTKGRFPQGSSQKQIQ
FT                   QQKNTPKTSSKSIVPTVSDKFKPMDSTSGASSDDSADDDDDDSMDSSTEDEGISMKKPR
FT                   RGIVQPPKGSVSAPVKHVPQSLSSELEGVPQSTQIPNEATNTAPLTKLLDHISPPSTAK
FT                   TITSRGVTESKGTSNRSLSSLSDLASRGVPDVREKGVNYKKTAPNVVNNSSSDESEQET
FT                   NDGSDSSDSDNSDSDSSDSSDDGNNFISAKSASKALRKNKASSGFASLIRDSQKK"
FT   CDS_pept        complement(23977..24870)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760175"
FT                   /locus_tag="AAL180C"
FT                   /orf_name="AGOS_AAL180C"
FT                   /product="AAL180Cp"
FT                   /protein_id="AAS50186.1"
FT                   /db_xref="HOGENOM:HBG058087"
FT                   /db_xref="HOGENOM:HBG103703"
FT                   /db_xref="UniParc:UPI00002523C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB1"
FT                   /transl_table=1
FT                   /translation="MGSLQAREMEELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQ
FT                   DRYTLRLGTVETITGNLKIGCDTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSI
FT                   VATMYTGAGGPARERGGLPRELQGLREGLDMEYVWDCLRRLNLPLEQIDWAEFRELLES
FT                   MLAAKRVADDDCVTLRGVVALAALQATVQTSKRAVRSQLRAYDRRVRAASTPASTRTSS
FT                   PESLLPADSRESSVSSVHYTYGLPATQLDANFKTYFRSMAENFELFEEPALALRGRVAK
FT                   PRKKAAGRHGHRPVQA"
FT   CDS_pept        25509..26591
FT                   /codon_start=1
FT                   /gene_family="HOG000248497" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760176"
FT                   /locus_tag="AAL179W"
FT                   /orf_name="AGOS_AAL179W"
FT                   /product="AAL179Wp"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="AAS50187.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="HOGENOM:HBG058091"
FT                   /db_xref="HOGENOM:HBG689653"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="UniParc:UPI00002523C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FB0"
FT                   /transl_table=1
FT                   /translation="MQISAVALSGAALLACASAHQHDRKKPHLVVVYGDVYVSGTDTFT
FT                   KYYSKMTDKLPASGSDGWSYSWSTATSWTSDSVSTEPSAEPTSTEPTNLPEVTSSPATP
FT                   VQPTSAPEETFEEPTESTSAEPTSSPEPVKSAEPTSSPEPVKSVEPTSSPEPVKSVEPV
FT                   KSAEPVKSPEPVKSPEPVKSPEPVKSPEPVKSAEPTSSPEPTGSPQRSRPAGGQNGASF
FT                   EEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENLAVGY
FT                   PTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLIC
FT                   SYDPAGNFLRRFGENVAPIA"
FT   CDS_pept        26881..27498
FT                   /codon_start=1
FT                   /gene_family="HOG000141941" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760177"
FT                   /locus_tag="AAL178W"
FT                   /orf_name="AGOS_AAL178W"
FT                   /product="AAL178Wp"
FT                   /cellular_component="extracellular region"
FT                   /protein_id="AAS50188.1"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="HOGENOM:HBG380262"
FT                   /db_xref="HOGENOM:HBG689653"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="UniParc:UPI00002523CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA9"
FT                   /transl_table=1
FT                   /translation="MRACLLIPLLLVAATARTVTVSVTATRTVTVISAAAVTTLRTTVF
FT                   TTAYRTQTTPLTETPLSRPTAVNNTFASAVLDLHNDYRRRHHAVPLRWNSTLYTHAQHY
FT                   ANRILCNGSLVHSGLPHGENLALGYSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLV
FT                   WRSTTSVGCAYVMCGPCYGLYIICQYDPPGNVADQYVANVLP"
FT   CDS_pept        27774..31370
FT                   /codon_start=1
FT                   /gene_family="HOG000246781" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760178"
FT                   /locus_tag="AAL177W"
FT                   /orf_name="AGOS_AAL177W"
FT                   /product="AAL177Wp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS50189.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG057930"
FT                   /db_xref="HOGENOM:HBG395610"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00002523CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA8"
FT                   /transl_table=1
FT                   /translation="MESQAAVEEPQHSVVIETPPTTAESSETPVADTATGAEPEGAGGA
FT                   AVVAPKRMPTRADFPPLSSVIFETQKVQWGPNMKKPESQSASPSPSPGPVGSGAKPMRS
FT                   KTMQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYN
FT                   AKRELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEADAYD
FT                   ADLDDQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEI
FT                   SEDVTVKAFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLID
FT                   AEDVREKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGK
FT                   NVAHAKNLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTK
FT                   TVRKQIINIVNRLTPSHVLAVDDLDYELFHKDIKQALSKAEIPFVQLGDHYEGDNTVLL
FT                   FAKVDEEDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVT
FT                   WNLVLENITSAGGHAQIKLHTPSEDEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVS
FT                   VPANTVSRLIGPKGTNLAQIRQKFDVQIDVPSESNDTNTEITLTGLEYNLQHAKTHIAS
FT                   EAKKWADITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRG
FT                   VNKAHAELKALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNT
FT                   KTAKEQNLDTVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGG
FT                   STLKDFISKAGGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASV
FT                   AKELNIPADRQGALIGPGGSVRRQLESQFNVRIEVPDKGKEGKVTIHGRPEAVEKCEKE
FT                   IFSTIIRDSYDQEIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQ
FT                   PIPIERVRGSEGEGTKLTIEEVSAPEASANDNIPWRLTYEHVDLSDILGEEGKHAMTKE
FT                   QALEAAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINVP
FT                   KKSDKVSDIIYVRGTKESVEKACKMICDALNK"
FT   CDS_pept        complement(31588..32205)
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777546"
FT                   /locus_tag="AAL176C"
FT                   /orf_name="AGOS_AAL176C"
FT                   /product="AAL176Cp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS50190.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1A2B"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00002523CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F92"
FT                   /transl_table=1
FT                   /translation="MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTI
FT                   KLADHDDAMIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNEL
FT                   KSKVGDEDLVIFLVGNKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILD
FT                   VFQGIGGKLYEQRRESLAAQPQHSSSIQLQRPTTNDATSCCV"
FT   CDS_pept        32874..35525
FT                   /codon_start=1
FT                   /gene_family="HOG000247977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081805"
FT                   /locus_tag="AAL175W"
FT                   /orf_name="AGOS_AAL175W"
FT                   /product="AAL175Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50191.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189621"
FT                   /db_xref="HOGENOM:HBG395762"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI00002523CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F91"
FT                   /transl_table=1
FT                   /translation="MIKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCW
FT                   TCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGEDRDGDGEQ
FT                   PAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKTWIIKRFGVFKGTDR
FT                   VKRKYVPRKRRKVNPVFADAMAREHRRKLEEREKQARRKRKGELQGSLGSGNATGAGFA
FT                   KAGPPAAESAGAMSPVSATPLFDFDFSTPGLVSSEWMAGELKDDTTLSSAMLRNTLSFP
FT                   TGLSVAQHGDGITADTAPPKSQSSIFPEQTLPLQSAGTMVPPSVDEVSKVYRLLLNNQG
FT                   TDCNSSTGYKGLSGVHTPYTVDNVAIHGPESRMPASAIESVPSIVPDPTIFTLAEHTNS
FT                   LIRLPRMGMQIHGLTRFLLSYYQQNVADLMSVVALPKNPWKTIYFPRAVKALGELGALG
FT                   YTSHSRNALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNACLSSTSR
FT                   QEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEKARCLHRIF
FT                   SFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGSSTPPLSTDSSSFTGRYVEQLNKDN
FT                   GRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPHEINETRIDTLSMDVLYGLPNSLILL
FT                   FSDCVSLVRHRFYFKRHNTAQPTSFGLFCVKIEQRLLSWKPEWIFWKDDSKAEFINDTV
FT                   EGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELGNIIEHKDVKIVPLM
FT                   WQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWRRRMTDGKCDNWYS
FT                   VYCDWEMNLMLA"
FT   CDS_pept        complement(35718..37988)
FT                   /codon_start=1
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081806"
FT                   /locus_tag="AAL174C"
FT                   /orf_name="AGOS_AAL174C"
FT                   /product="AAL174Cp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAS50192.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG326669"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI00002523CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F90"
FT                   /transl_table=1
FT                   /translation="MASLEDLIPTVNKLQDVMYDAGIDSLDLPVLAVIGSQSSGKSSIL
FT                   ETLVGRDFLPRGTGIVTRRPLVLQLNNIKADSPLITAYTAEEAEPTLENRLRGQSGARD
FT                   TWGEFLHLPGRRFYDFTEIRGEIENETARIAGKNKGISRIPINLKIYSPHVLNLTLIDL
FT                   PGITKVPIGEQPPDIERQIRNLILEYVAKPNCIILAVSPANVDLVNSESLKLARDVDPH
FT                   GKRTIGVVTKLDLMDSGTNAWDILAGKLYPLRLGFVGVVNRSQQDIQENKSVEDALARE
FT                   EEFFSKHPAYRTISSKCGTRFLAKKLNQILLNHIREKLPDIKARLNTLIGQTEQELASY
FT                   GGSNIISPESRAGLVLQMMNKFATNFVSSIEGTSSDISTKELCGGARIYYIYNNIFGNS
FT                   LKSINPTANLSITDIRTAIRNSTGPRPSLFVPELAFDLLVKPQIKLLLDPSQRCVELVY
FT                   EELMKICHNCGSPALARYPRLQAKLIEVVSDLLRERLGPTRSYVESLIDIHRAFINTNH
FT                   PNFLSATEAMADIAEARRQKQQNAKRSADLKKKRQQELEKAAAVGEPTNGNPSPKVDSD
FT                   STITSSDSEGEDERDPKQNKDSFLNYFFGKDQQRKDGDDIAPSFSDKQERTMDSFFQQE
FT                   ADFMAMETLKIQDTVAAPVEAEHPELTEREELECELIRRLIISYFGIVREMVEDQIPKA
FT                   VMCFLVNFCKEEVQNRLVSKLYKESLFEELLMEDETLAQDRAKCIKLLEGYKQASVIIG
FT                   DIL"
FT   CDS_pept        complement(38265..39527)
FT                   /codon_start=1
FT                   /gene_family="HOG000001105" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760179"
FT                   /locus_tag="AAL173C"
FT                   /orf_name="AGOS_AAL173C"
FT                   /product="AAL173Cp"
FT                   /protein_id="AAS50193.1"
FT                   /db_xref="HOGENOM:HBG057951"
FT                   /db_xref="HOGENOM:HBG202612"
FT                   /db_xref="InterPro:IPR013178"
FT                   /db_xref="InterPro:IPR016849"
FT                   /db_xref="UniParc:UPI00002523CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F89"
FT                   /transl_table=1
FT                   /translation="MGLKELLAEALPAGHDFDVLHLQSPATERPPLTEASGCSPTTIAA
FT                   QHFFTLSNNSKVFYALQVVVYICIEGTSGDRMLFVSKADTNGYCDVRVDVRRATRALLQ
FT                   FLLSIDPSHYLQRVRRMRIDPAACKGLITPATNAVDALRILAQRYRTGNLDVRAAADRA
FT                   RYTSFPCPPQYTTRLALFTRAEPHYLFSESAQNPAKHVLPGDRLLRWWLASVDDLLVTL
FT                   FDPATDAALLIPGEDSAVTAHYLRPVRFPRWRVGHVFGGSAEDPALTRIPRFPDDPKGR
FT                   FLDDLAHEGRNPSLRAFWTELVARQEFRLGVVVGVVGAAGLYTGPCARPAPEDLLCPAS
FT                   PADYVHVKHYVTAEEYATAAGASEAHRNLVDCLLLRYGVAMPRVRGAHSTTPRPAPTQD
FT                   ATKRPAVNDLTARCVRKKPRC"
FT   CDS_pept        join(complement(40286..40350),complement(39647..40229))
FT                   /codon_start=1
FT                   /gene_family="HOG000091079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624989"
FT                   /locus_tag="AAL172C"
FT                   /orf_name="AGOS_AAL172C"
FT                   /product="AAL172Cp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS50194.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG314521"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HSSP:1G0U"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI00002523D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F88"
FT                   /transl_table=1
FT                   /translation="MDGIQVDINRLKKGEVSLGTSIMAVKFRDGVILGADSRTTTGTYI
FT                   ANRVTDKLTRVHDRIWCCRSGSAADTQAVADMVQHYLELYTMQYGEPSASTAASLFSTI
FT                   CYENKDHLTAGIIVAGYDDKNKGEVYSIPLGGSVHKAPYAIAGSGSTFIYGYCDKHFRE
FT                   DMSKEETIDFMKHSLSQAIKWDGSSGGVIRMVVLTEAGAERLIFYPEDYENL"
FT   CDS_pept        40611..43586
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777547"
FT                   /locus_tag="AAL171W"
FT                   /orf_name="AGOS_AAL171W"
FT                   /product="AAL171Wp"
FT                   /protein_id="AAS50195.1"
FT                   /db_xref="HOGENOM:HBG057961"
FT                   /db_xref="InterPro:IPR013665"
FT                   /db_xref="InterPro:IPR018907"
FT                   /db_xref="UniParc:UPI00002523D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F87"
FT                   /transl_table=1
FT                   /translation="MDDSAPSASSDGTMLPDISYAGTMEELGYSTNDLIASDAHYSTGS
FT                   LVHKSIQELMQNLKISRNRRYFEPSLTGQEPEYIYWDNNFLQRSSGLSNQAVLSPLFEE
FT                   PYEDHSGGGGGGGDGGGVEDEQDTVLQRLYNMVQVFLVRHGLSLDFAKVLKKYVALLHE
FT                   GGSEPLQDQYILALQNELQQSYELSPIMDSILTAFLLRPENIPMKLALVEYRHQLQLVR
FT                   KWFLSWRLKWNITTNLGVCESIWGNYLLKKYLYRWTEKYKLVAEYWEEDASNADELRLT
FT                   ASMFDTWAKQYSIRKTKEKMADNFHVVDYVERFRSRYMRMTECNDKAEVFHAHNLKTKF
FT                   LARWRLAGRTKSVAPVFTVLTQRMTLAKVLQHFNSMNELNSFGCFAEKALTLRPLLIKW
FT                   VSRLQRQDIQQRQLDAAELTFVKKKAYKIWRKQFHYRLSELHLQATLDNNLLEFIFNRV
FT                   WSIRYTERKMLYQVLSDKNKLLMKKQFSAWRLTTSLKVKSETQRNSNVAKKALRALILG
FT                   AKLQQHNKLTEVKLISSYLSVWRKRHTEEQNVRVVGKMLVQRYWEHEFKRKYLAFDDLN
FT                   YITDKSYHSHLVKLMFSCWQQAYARKAVLYDKASLFQRLKAAQRLKKAVAKIDAVRFRE
FT                   TYYDDIVSNIYLKRYVDVWRQNASIRKDVRLEIILDNYECKNNVKLKRRFLRKMKERWS
FT                   FYSNECVRVANRKNRRDMGKLLLSRIIGKMELRKLWLKQAGRLRSSMLLLNGFMYWLDR
FT                   MDKIQQLYAVVQLKVEEKDVNLVVKCISKWNMKTLKFKRNEETGQMFRSRWNRALLRYV
FT                   VTLWKDKTKKLANQRPLDVFRPYRNSISHDFMTPLKADKVTIPGSERVKKNKMERIKNR
FT                   YRGARRAIPSPIKSSDILDSTTKRKLSKIGKIQTPLQNAYVDDPNTTPIPKLKLEQEGR
FT                   RYSLRVRNIDFNRIPELDPFSRPDSRDRASTFIIDRPILPDDTFIVDESPTKMKAPRSP
FT                   LS"
FT   CDS_pept        43827..45236
FT                   /codon_start=1
FT                   /gene_family="HOG000093925" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624990"
FT                   /locus_tag="AAL170W"
FT                   /orf_name="AGOS_AAL170W"
FT                   /product="AAL170Wp"
FT                   /function="dolichyl-diphosphooligosaccharide-protein
FT                   glycotransferase activity"
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50196.1"
FT                   /db_xref="GO:0004579"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057967"
FT                   /db_xref="HOGENOM:HBG396766"
FT                   /db_xref="InterPro:IPR007676"
FT                   /db_xref="UniParc:UPI00002523D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F86"
FT                   /transl_table=1
FT                   /translation="MMILSYPIALVLSVLCRFAVGEVDASFTPRPVWENIDYARKVNLV
FT                   KSYPHEAVHLTIKNTGSQPESIYYFGIRDDVYEKLSMFAAFFKDMKVYVDNVPLPKSSE
FT                   IDGQPVRYIMIKLPAPVEPGEKVQLEVDYAHNAGRVPLQERITLGSGHYMRLTTNKLPF
FT                   TSYPTAKYSLEFIGARELRELGATSSTPAGDEEKQSLKLSPSLNTADTASANVTVTYRR
FT                   DLPFPRVVNLRRDIWVSHWAGTLQFEEYYELTNDAAKLKGGFSRAEFIKGRHALKTGPY
FT                   LVGFEMYLPTGATEHYYTDLVGMVSTHKVVDDRFFLKPRFPIFGGWFYNFTVGWTNELS
FT                   QFLHSDASNEEHVLRVPILNGPPDSFYDNVELSVYLPEGAQVLDVQLPLALQEKGVTTE
FT                   YSYFDLTSGHVKMTVKCKNIIDTVQKGTMFVKYRYSKQLMYWKPVPIALYVFVFLVSYF
FT                   LLKRVDFSIGK"
FT   CDS_pept        complement(45296..47227)
FT                   /codon_start=1
FT                   /gene_family="HOG000001104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760180"
FT                   /locus_tag="AAL169C"
FT                   /orf_name="AGOS_AAL169C"
FT                   /product="AAL169Cp"
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nuclear origin of replication
FT                   recognition complex"
FT                   /protein_id="AAS50197.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005664"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG057972"
FT                   /db_xref="HOGENOM:HBG202610"
FT                   /db_xref="InterPro:IPR010748"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="UniParc:UPI00002523D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F85"
FT                   /transl_table=1
FT                   /translation="MNVRDFADSQKTHYTIVPSAKRRKLDSYDTNNVPFVRLFDGEEPE
FT                   SMVLQRWELYHQLYYEFHSQVDDILHEIQRDVYGSIPRAIAKGLSQCNGKYFSTLFLLG
FT                   ADGSTQVEAPEDDNKQINVVVDLTPKESPNLRMILRRSMFKLHSALDTKLHGNQDEADG
FT                   EEVLDVEESDEQQTGSATPFTEAEEEIDGVLYDLSMIERFSKKFPKRLNLIFNFKDVDS
FT                   FYFQVLEDFIWLLQATLENDQVRICFVFNINTNISNFEKNLKQNCVRLLKKNFTKLDLS
FT                   HNKGHKYVNSVFKSFLNTVDGKLNLSPRFVKFILDKMNNKSNQNLPLLIKILDYSLMAY
FT                   FFQNPYSMFIDLTNINHFDDKYIQGLVKCNTFMSFIEIMIKEQAPSDDILSLLENRDKA
FT                   LEEFFAEFLVRENPINGHLNHVVDFLEQKLGVTDFNVIELYHHMLLGTLDDFLKAWPQC
FT                   NGHMEQLSFEPLEIVFQELFTLDNNNGLLTQALFPFLRSNMEDNLLNCERIFPAPTRLQ
FT                   TAENKLEMELNQLLDPPICRLFKLYREANAVINVYDFFTAFKETLPSKEILELLRKAVE
FT                   QDELKLQPDQRDTLVKFFSGSNDDEIFDKLALVWFVQSVSECQYIGIFRTHQYKSYEAI
FT                   EKIIWRGI"
FT   CDS_pept        complement(47497..47862)
FT                   /codon_start=1
FT                   /gene_family="HOG000217274" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760181"
FT                   /gene_name="COX16"
FT                   /locus_tag="AAL168C"
FT                   /product="Cytochrome c oxidase assembly protein COX16,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50198.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057978"
FT                   /db_xref="HOGENOM:HBG398300"
FT                   /db_xref="InterPro:IPR020164"
FT                   /db_xref="UniParc:UPI00002523D4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75FA7"
FT                   /transl_table=1
FT                   /translation="MSLGSRTFRSKRQMAAFEKSLQGRYLKLLRRNPFLFYGVPFCTLM
FT                   AVGSYCLSDFTAVKYEREDKKVRSVQEDELVKLRANRRTVDLKEEFYRLQGLADQDWEP
FT                   VRVPRLPGESENVWDVE"
FT   mat_peptide     complement(47500..47769)
FT                   /gene_name="COX16"
FT                   /locus_tag="AAL168C"
FT                   /product="Cytochrome c oxidase assembly protein COX16,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75FA7 "
FT   transit_peptide complement(47770..47862)
FT                   /gene_name="COX16"
FT                   /locus_tag="AAL168C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75FA7 "
FT   CDS_pept        48049..50940
FT                   /codon_start=1
FT                   /gene_family="HOG000141747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081807"
FT                   /locus_tag="AAL167W"
FT                   /orf_name="AGOS_AAL167W"
FT                   /product="AAL167Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50199.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057986"
FT                   /db_xref="HOGENOM:HBG202609"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR022257"
FT                   /db_xref="UniParc:UPI00002523D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA6"
FT                   /transl_table=1
FT                   /translation="MRHRAKRIMNRSAALENEYFHYFSRFIYSYVDLSDNTALLMLKFY
FT                   PDGVHNPYRTPYNYTAQIYSNFLNSTRTGSAQRDYGINFETFLSGVLISVIYCLCQTLL
FT                   FSYLRTRLPRIYQPNVFLTEHPVAPVVLFRNFKTKLFSWVHPTWNTPLESYKKYGLDSF
FT                   FFLRYLKVLCLYFLILSVMTIPVLIPIHYTSGYQVLDVPGNSREFGIRHRHTTEGDRLL
FT                   TQFSLKSTGLDEISMSNISPRHSSRLIFHFILGIFAVVWFHATLITELDYFVTQRNSAF
FT                   LGEDPAAQKQQCAMFLNNIPDMFMSSERGLLDFFHSMIPDSVHQIVFIPKEYRELKDKR
FT                   KLEGKLFNEIEQVCYDIIRKRFYMSPKSESVYLPYKEESSTGSTILAPTAWASVENTLP
FT                   EGVLPHSTFLNSYDEIFKPKNTTQSGFRFKLARWKYTLRTILTFDFIFGLRMKICTLKY
FT                   NKLKILIPCIVYDVNRHIEKKLERLETTITQYNRLKQRGYKEITVYHSEQERPPTRNSS
FT                   PPLKSKQAVVVFKNVILAHFFDQLLLSASTSSMKEKILGIKPEDIHWKNITLTNRLVLM
FT                   SRVALSNFLSVMVIVGWVIPVAFVGLISQIPFLAKLVPLPSWSANSTSILDKSLSSIVP
FT                   VMTLIFLTEGVPFLFRWFGWLKCCRSGSSTELDVQKWFFAFLFVHIFLVVTISSGISVI
FT                   VEKLVNNPVSIPDLLGTNLPKSSNFFCSFMLIRGLSYFGGNFMQVKSLLFELFYYRWKV
FT                   YTPRAVFERNVNVQQYQWGSVYPMFSVLACIGIIYCVISPIILLFASFSFALVMFSFKY
FT                   SIKYQYNPVNNSESYGKYYPTALMQLYAGIYFLEICLIGLFTLSNCYRLSIGMIIVLIF
FT                   TISAHFQIWSNYKYHLDHMPAQLCMEAIQNTPYNFRIPSLEGHERQVWLPNDTVGVSSS
FT                   LKILLEEKYELPCQQNDCHLDENGKLVLTGYSS"
FT   CDS_pept        complement(50981..52315)
FT                   /codon_start=1
FT                   /gene_family="HOG000201075" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930512"
FT                   /gene_name="MMM1"
FT                   /locus_tag="AAL166C"
FT                   /product="Maintenance of mitochondrial morphology protein 1"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50200.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG192227"
FT                   /db_xref="HOGENOM:HBG397194"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI00002523D6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75FA5"
FT                   /transl_table=1
FT                   /translation="MKGVENTLSQSESVNRGYNGWMGMESETSARATHSSEQMISLEEY
FT                   VREMLPMHLQKLLMERIIEAEQTGAAHTSVFAAPTGVAAQYPAMGPPMLPGQTFSSRSF
FT                   AEGLVVGQLSVIVVLIFFIKFFIFSDGPAKTGGGGGSSAESRSSGFTGSPLTSTTSRLL
FT                   STLIKRGGKEGTEFAEDSENERTRQINAILEKTYYDVETHSPESLDWFNVLIAQTIQKF
FT                   REEALQKDNIVHSLNDFISRKSSQLPNYLDAVKITELDIGDDFPIFSNCRIKYSPPLNK
FT                   KRLEAKIDIDLSDRLTLGIETRLLMNYPKYLTASLPVKLTVSMLRFQACLTVSLTTAEE
FT                   FVPTMAATTDTDAGDSEGHYLVFSFSPDYRMEFDIKSLIGARSKLENIPKISSLVEYQI
FT                   KKWFMDRCVEPRFQFVKLPSMWPRSKNTREEKSDMQEEDPSRAPE"
FT   CDS_pept        53020..55020
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081808"
FT                   /locus_tag="AAL165W"
FT                   /orf_name="AGOS_AAL165W"
FT                   /product="AAL165Wp"
FT                   /protein_id="AAS50201.1"
FT                   /db_xref="HOGENOM:HBG057994"
FT                   /db_xref="UniParc:UPI00002523D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA4"
FT                   /transl_table=1
FT                   /translation="MSRLDPGKQNLEVKSLDPNHSRLNPEASRLRINDIIKDLSINHAH
FT                   PVSPQANTLTVLSSVFKNCDEQVLLQSLVSNSYFWCRFFALVAKYAYSNSLLHASLVVL
FT                   RATEHMLLTMKGVPSDTLKTYCDSFHGNLNIISIFAGELMGSGEASKINMEIIRVVGNY
FT                   IACLNKLAKKSVTSAALAMGEVYLTMRTTGFLTAISYLIEESSDDKLYDSIVKVFVTPL
FT                   RSMKVIMTSNHVSEATMKLSKELNSAVESAFYLNKAAKEQFLAINEDYSDPTTLTLLQI
FT                   VDAITVLRDDNLSLKKRMAEQLMFDKHPFPLLAGCVGVTDMLFNHFSVNSENKDIPRHI
FT                   TQLMLNKDAVMFAVVHKLTLYWSSSKAKSSEDLACLLVLLKHLMDKVDSTVNSNAGVDE
FT                   TPIIEKTLDIINNMSYESLRQLQLKQVKAKHYQKWNQYGSNFNTMLSHQVEDYVRQQRI
FT                   YQLQTGTWVYAEDPTSDRRYKHPKVYFLVLSDNHNNLLAREFKYRLEKTPTVDQNEILT
FT                   SDVEGIVGNTTLMIPLRRVTDFQSRELKWNKELPKHRRLINIISKAVFTEVQLMGKTGK
FT                   PLITFYLDNRDASFIWLDGLQLLASSQKKPKLSKSTKNQIDTLIDIRKNIQLIGLSDYN
FT                   FSLGYNLAASEEEQYYDIDTLSTLTEDFFYD"
FT   CDS_pept        complement(55223..57427)
FT                   /codon_start=1
FT                   /gene_family="HOG000265456" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760182"
FT                   /gene_name="DRS1"
FT                   /locus_tag="AAL164C"
FT                   /product="ATP-dependent RNA helicase DRS1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50202.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00002523D8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F95"
FT                   /transl_table=1
FT                   /translation="MGTKKVNQFKDFVPTISDSEEDIPDLDASDDEYETAGKVKSRKKT
FT                   KKGRKGGAVIADDEDAHADLNPEFHFNDEGAEGTTDFSGWDFVGDGERAEQKDVDLDGI
FT                   IRRKGGLVQLAGVEESEEEVEEAESAAGASDDEELALDGFGMGAVAQREAAGAADESDS
FT                   ESDKDSDNSAEEAVELDGVEFGDEQEEAREEDTAEEMAQFYAPSNEGEEAKNVVHSTFN
FT                   SLSLSRPVLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIERL
FT                   LYKPAKIASTRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALKL
FT                   RPDIVIATPGRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQ
FT                   TLLFSATMNSRIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHL
FT                   LRKLDSTGQKRIVVFVARKEVAHRLRVILGLLGMKAGELHGSLTQEQRLQSVNNFKSLD
FT                   VPVLVCTDLASRGLDIPKIEVVINYDMPKTYEIYLHRVGRTARAGREGKSVTLVGESTQ
FT                   ERSIVKDAIKSVDGSKGSGRACGRVVDWKQVEEIHKLVQAKEDVIGEILEEEKQEKEIL
FT                   RAEMEIRKGENMLKFKEEINARPRRTWFQSESEKKNSSILQALSKNKKVTNSKKRKREE
FT                   AQQEVGSRQYKKTQKDRTTNQELAFRKQKKGGNKKKKVRK"
FT   CDS_pept        57819..58418
FT                   /codon_start=1
FT                   /gene_family="HOG000000813" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777548"
FT                   /locus_tag="AAL163W"
FT                   /orf_name="AGOS_AAL163W"
FT                   /product="AAL163Wp"
FT                   /protein_id="AAS50203.1"
FT                   /db_xref="HOGENOM:HBG058004"
FT                   /db_xref="HOGENOM:HBG446678"
FT                   /db_xref="InterPro:IPR019185"
FT                   /db_xref="UniParc:UPI00002523D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F94"
FT                   /transl_table=1
FT                   /translation="MASIRRYLRIPQELKPSEIFRQSSLSPSKIVLQIVLLQVFYYLTA
FT                   YVLFYGWANLCGYEFEASKWIFSWELIDFSNSLGLSLTLLWLLDALVCVFFLTVIVGRS
FT                   KLAWDFAVTIHAINLLVVWFHTKQLPSFSWFFLQLCSSLILVFLGTWTTRWRELRDTFF
FT                   EGLIDQEPITGGAESPYHGSSQNRQQFEMKDLEAQK"
FT   CDS_pept        complement(58565..64189)
FT                   /codon_start=1
FT                   /gene_family="HOG000112124" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081809"
FT                   /locus_tag="AAL162C"
FT                   /orf_name="AGOS_AAL162C"
FT                   /product="AAL162Cp"
FT                   /function="phosphorus-oxygen lyase activity"
FT                   /biological_process="cyclic nucleotide biosynthetic process"
FT                   /biological_process="signal transduction"
FT                   /protein_id="AAS50204.1"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0009190"
FT                   /db_xref="GO:0016849"
FT                   /db_xref="HOGENOM:HBG190577"
FT                   /db_xref="HOGENOM:HBG397746"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="UniParc:UPI00002523DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F93"
FT                   /transl_table=1
FT                   /translation="MDRKAHRAGERRAAGRTDGRGGWERGADGLAAGSRRDSVDDSWSS
FT                   LSSNSQEAPLEHEVRSGGRIVEPGSDLPPHMKHSRGLHHASFARVSQHPSSPLAKQLRP
FT                   VRNVTMQSAAEDDDARATGAPPPIRRIPSRAGSFFKRLTGRKSSINGSETSAAADADVA
FT                   AAPSSLRRKVNTFIHGNEARRDSKGTISTSSADSRRGSTASGGSASIIQLPDGQRLSLQ
FT                   EYKPVSPTTTALSSASSAAAQQGGDRSTGSPVHVPWDNAEASNEHESGVNTTFFNLDMD
FT                   LNNLSDITSAYQQQTETTTNANLEVNMANAGKPVVHMPRPQKLPAREVRHTKGAAQWTA
FT                   PESWDVDDPVIKPSKQKQKCHNPAHRHHRHHYSPRSDMTGTSGDNNRLSADPNRYSNLE
FT                   DSPNHSRLTAAFSRSPIHRDMSPLSIMSSDSIVSSNSDSCSFSVVSNPEDTPKDITHPD
FT                   NASTSSIHAQELENNDIEDDKLQHHLEKYYNHFSDIDYHKKYTIRIFNTDDTFTTLSCR
FT                   PETTVKEMIPQIKRKFNVPPGNYQVSLKVGKLSKVLRPTAKPILIQIRLLLFNGYKKTD
FT                   RLNIMGIEDLSFVFSFVFHPVITSQLTYEQEQRLSKGEFVHVDLRNMDLTIPPIIFYQH
FT                   TSDIESLDVSNNANIFLPLDFIESVIKLSSLRMVNIRASRFPSNICEATKLITLDLERN
FT                   FIKRVPDQMSKLTNLTILNLRCNELDRLPRGFKDLKSLQLLDISSNKFNIYPEVINSCT
FT                   NLLQLDLSYNKIRSLPDSMNQLQKLAKINLSNNRITHVNDLSKMTSLRTLDLRYNRIES
FT                   IKCRVPNLQNLFLTENRLTMFDDDQLMLRTLELQRNPLSILTLKNDYLEHLTSLSISKA
FT                   KLAVLPESLLRRLPRLEKLELSENSLTVLPPDIKHLKKLVHLSVAKNKLESLPDEIASL
FT                   KNLKMLDLHCNNLMTLPAALSTLSLTFVNISSNMLSGHHELYRTFQGTSNIAKSLMFLS
FT                   AADNQMGDKFWEIFNTFKTLKVLNLSYNNFMALPELEMENLTELYLSGNHLTTLSGEAF
FT                   LKLKSLRVLMLNANNLQSLPAEISQLSQLSVIDVGSNQLKYNISNYHYDWNWRQNTELK
FT                   YLNFSGNTRFEIKSAMEYGTNMHLSDLTVLKQLRVLGLMDVTLNTSRVPDDGVNFRLRT
FT                   MGSTINGMEYGVADSLGQTDSVSTRDVTFERFRGNEDECLICLYDGINDNTNTGHKISQ
FT                   VIRDIYDRILVRSLEKYGDSTPAEIRDALRFSFLQLNKEINSSILAAGNNKNSNGNTNN
FT                   NNNTNNNNNNGNNNTNSNGESVVLTAADSLSGASVTVVFMKGKNIYTANIGNATAILSK
FT                   GNADYRILTRKHVPTDTEEFERIRLSGGYVDNKRVNGVSEISRAIGFFDLLPHIHASPD
FT                   ISETTLTYTDDMLVIATQSLLSYVSLEKICDIARENKSQPMLAAERMKDYAIAYGCTDN
FT                   ITILCVSFNKNVGKQKQFSLNKSDLLGRRLNFEDVSLRRLRPEIAPPTGHLAIVFTDIK
FT                   NSTFLWELFPNAMRVAIKAHNDIMRRTLRIFGGYEVKTEGDAFMVAFPTPTSALVWCLT
FT                   IQLKLLELDWPEEITSIKSGCMITDDSGNTIYQGLSVRMGIHWGCPVPEVDIVTQRMDY
FT                   LGPMVNKAARVSATADGGQITLSSDFLAELNKIMKLHHMVVQDKKPLKEVYGEEFVGEV
FT                   LEREIQMLDNVGLVLEELGEQKLKGLETREFITIAYPKQLAARHTMSTGEKSTNIVNDK
FT                   YVLQLKVISTTLENILSTVNGGLIEIDNSVLQLPTHMTRDKKVDKALSQNTEYDWISLL
FT                   DHLVTRLESTVAMLQLRQRLEGGLEICRPGNNTKKSVFELLDLLCTGTGFKRDTPSENK
FT                   "
FT   CDS_pept        64596..64790
FT                   /codon_start=1
FT                   /gene_family="HOG000195037" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760183"
FT                   /locus_tag="AAL161W"
FT                   /orf_name="AGOS_AAL161W"
FT                   /product="AAL161Wp"
FT                   /function="copper chaperone activity"
FT                   /biological_process="copper ion transport"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="AAS50205.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="GO:0006825"
FT                   /db_xref="GO:0016531"
FT                   /db_xref="HOGENOM:HBG429228"
FT                   /db_xref="HOGENOM:HBG558801"
FT                   /db_xref="InterPro:IPR007745"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniParc:UPI00002523DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA3"
FT                   /transl_table=1
FT                   /translation="MPESSSVPGVSQGSSTDKPKPCCVCKPEKEARDSCLLFNGVDAVK
FT                   CQELVQKYKDCMKGYGFEV"
FT   CDS_pept        64921..65880
FT                   /codon_start=1
FT                   /gene_family="HOG000228986" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760184"
FT                   /locus_tag="AAL160W"
FT                   /orf_name="AGOS_AAL160W"
FT                   /product="AAL160Wp"
FT                   /function="transferase activity, transferring pentosyl
FT                   groups"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="AAS50206.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016763"
FT                   /db_xref="HOGENOM:HBG205650"
FT                   /db_xref="HOGENOM:HBG286690"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="UniParc:UPI00002523DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA2"
FT                   /transl_table=1
FT                   /translation="MTGSENLETYEGRVELGIIGGTGLYQLGCLEPVATLATVETPWGR
FT                   TSSPVTVGRVRTEGADAFYVAFIARHGVDHEIPPSRVPNRANVACLKRLGCRAILSFSA
FT                   VGSLQHQIKPRDFVLPQQIIDRTKGIRESSFFNDIGLVAHVPFGEPFSEAFAKYIHRFR
FT                   DVLENPDSEEPCELHFDRDTTVVCMEGPQFSTRAESKLYRQFGGDVINMSVLPEAKLAR
FT                   ECEIAYQIVCMSTDYDAWRDELEPVTVETVVGNLTANARNANALASKVIAAMAAERPPF
FT                   LKNADGLHGVVQMSISTKPSAISEEGQRQLDYLFPGDA"
FT   CDS_pept        complement(65961..67118)
FT                   /codon_start=1
FT                   /gene_family="HOG000141748" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760185"
FT                   /locus_tag="AAL159C"
FT                   /orf_name="AGOS_AAL159C"
FT                   /product="AAL159Cp"
FT                   /protein_id="AAS50207.1"
FT                   /db_xref="HOGENOM:HBG104469"
FT                   /db_xref="HOGENOM:HBG124403"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniParc:UPI00002523DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA1"
FT                   /transl_table=1
FT                   /translation="MSGISGSARKVFETPMRPISREQFQSMREKVVKLSPELYRTRILS
FT                   DPTVNKFPLRAPGVVAANVFERVDSDPIEAAKSQVVHVPVLPPTTQDDDLLPEQEVAMA
FT                   TRMATGMRAETVGSGCDASSAKPLGNYENPALAAFTRRVVNKEQEIKRIIANVWTLLIW
FT                   NLVYKFLGLFLQSSRTGRFIYQSLSHFFYANVVFKLNPHARLDSGWFRFWTLENISHLI
FT                   HMLLLINIALSLYMLLVKAQHITVGDLGLNERQKELLGVSASSDTRNSIIEDVTNPRPL
FT                   LHRVSSKGSMSEHILPSDAAQPQPFLFKSLQTPLRSLKGHPSPTVQSELPYTGGGRESL
FT                   FPAASSLVSQKLATPAQPANRPGSGYIPSSKYAYMMDSPSARKRL"
FT   CDS_pept        67892..69328
FT                   /codon_start=1
FT                   /gene_family="HOG000211190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624991"
FT                   /locus_tag="AAL158W"
FT                   /orf_name="AGOS_AAL158W"
FT                   /product="AAL158Wp"
FT                   /function="phosphatase activity"
FT                   /protein_id="AAS50208.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG058029"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00002523DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75FA0"
FT                   /transl_table=1
FT                   /translation="MGFISSLLCCSGSKQSYNKRSSSPAPSVARKQVGNKTSIRRSQAS
FT                   SKASSCNALSSSADSMDKAAELCVSPAPATAPAGSAVHSDNIARVAAVTSTDAPGGSDT
FT                   RRNQDEGQSDARVQEDIISTPNVSEVPAQEAGKLGRPECSEEQCVGQKTEEGLLKAPDK
FT                   IATYGNSLGVVHSGDCEKQGGNLDDCGSSDKETFFGDKQLVTVYHGETDTSTGTTDNDK
FT                   QDVSNNVIHGVTTTVKERQDSSSTEGITTDASNNDEEPRQEEARSDPELGYEGEVLLDL
FT                   SSLQPEQAHAPGYDTLLPPQRPEFRGRKCLVLDLDETLVHSSFKYLHTADFVIPVEIDN
FT                   QVHNVYVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAVHHRLFRDSC
FT                   YNYEGNYIKNLSQIGRPLSDLIILDNSPASYIFHPQHAVPISSWFSDAHDNELLDILPL
FT                   LEDLSSRKVPDVARILDVTI"
FT   CDS_pept        complement(70077..71516)
FT                   /codon_start=1
FT                   /gene_family="HOG000210082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081810"
FT                   /locus_tag="AAL157C"
FT                   /orf_name="AGOS_AAL157C"
FT                   /product="AAL157Cp"
FT                   /protein_id="AAS50209.1"
FT                   /db_xref="HOGENOM:HBG038618"
FT                   /db_xref="HOGENOM:HBG436413"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007287"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00002523DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F99"
FT                   /transl_table=1
FT                   /translation="MKIKTISRNADEYVPVKSTQESQLPRNLDPALHPFERAREYTKAL
FT                   TATKLERMFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELC
FT                   SFRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSD
FT                   TGDGALLKTFYGEHAFQSIDHHRRNPNFVTGGAQIQLWDVNRKKPLSNLSWGVDNVSFV
FT                   RFNQNEEDILASTGSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNFAIANEDH
FT                   NAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVY
FT                   HTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLWRAKAWERSHVKTTKEKNKLEYDEKLKE
FT                   RFKHMPEIRRISKHRHVPKVIKKAQEIKNIEIASLKRREGNERRTRKDMPFVSERKKQI
FT                   VGSVHSYEEKSSKADKEDDDQ"
FT   CDS_pept        complement(71775..73298)
FT                   /codon_start=1
FT                   /gene_family="HOG000141749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760186"
FT                   /locus_tag="AAL156C"
FT                   /orf_name="AGOS_AAL156C"
FT                   /product="AAL156Cp"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS50210.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG124405"
FT                   /db_xref="HOGENOM:HBG202623"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniParc:UPI00002523E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F98"
FT                   /transl_table=1
FT                   /translation="MSVLGKTRIWLYTVTASVVTTLLLAAIFVAATWNTLITDRWKRKH
FT                   RLRRRVIPTVQEAVVSDKDRIRVTVRRSVSATSESPFLGSDGKRHESDEEPGSAESGAA
FT                   PGSGGNPFRDAMAAEDIKLVPDLAYYYRQYGIEIEEYEVTTDDGFVLFLWHFVGQGSVT
FT                   QGPPMLLLHGLLQSCGSFASSGRKSLAYYFYESGYDVWLGNNRCGLNAKTVPSQVDEHE
FT                   KWDWDMKEMVKYDLKAMVEYVLQKTARKKLTLVAHSQGTTQGFMGLLHGEALYGGTSFR
FT                   LMDKLDNFVALAPAVYPGPLLYENVFMRFMASTIDVPWVYGVRSFLPIMMQVRALVVGN
FT                   RFFSVVCYLFFNYLFDWNDLLWDKPLRDRHFMFSPVHISVNLMKWWLSKDPGRRSFRNY
FT                   SHCIFPEEGAWFPLVDGNSDSHTLLDGQVRRNAPTEYPRILLFVPKQDRLVDGKRLIDH
FT                   FTNHEDERIYKIWYFDDYSHLDVLWASDVSDRIGKSMLEELRAPQGSSS"
FT   CDS_pept        73598..74134
FT                   /codon_start=1
FT                   /gene_family="HOG000115599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760187"
FT                   /locus_tag="AAL155W"
FT                   /orf_name="AGOS_AAL155W"
FT                   /product="AAL155Wp"
FT                   /protein_id="AAS50211.1"
FT                   /db_xref="HOGENOM:HBG058044"
FT                   /db_xref="HOGENOM:HBG202624"
FT                   /db_xref="InterPro:IPR018854"
FT                   /db_xref="UniParc:UPI00002523E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F97"
FT                   /transl_table=1
FT                   /translation="MIYRELQKAIPPALWGLDESAQNELELTAVHFTNKTLLHIRFNGE
FT                   MDATYEVQPRGAGGLAADVGGLHGGAASSLRAEGNDEDEFVEDHLSKYNVSMKMGNSND
FT                   MKLPVVVMQIAELYERAVYPSVLGAEARAGPDLGLLVTLSSRFWRSASAGGPGSGSDFD
FT                   RLMFVLQSIREMYGI"
FT   CDS_pept        complement(74156..75007)
FT                   /codon_start=1
FT                   /gene_family="HOG000216685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081811"
FT                   /locus_tag="AAL154C"
FT                   /orf_name="AGOS_AAL154C"
FT                   /product="AAL154Cp"
FT                   /protein_id="AAS50212.1"
FT                   /db_xref="HOGENOM:HBG056098"
FT                   /db_xref="HOGENOM:HBG333702"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018023"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniParc:UPI00001516C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F96"
FT                   /transl_table=1
FT                   /translation="MFVSFSYRPSMALALLEAIFNDSGSETQWISKSSRPMGVINQPSG
FT                   QIKLTNVSLVRLKKGKKRFEVACYQNKVQDYRRGVETDLDEVLQINQVFLNVSKGQVAS
FT                   NEDLNGAFGTKEQEVVIKEILSRGEIQLSEKERQQMHGKITNELLTLVSAKCVNPNSKK
FT                   RYPPTMIHKALAELKFNVVTNKPAKLQALEAIKLLVQRQIIPIARAKMRVKAVLPREGN
FT                   AEAIAQAASLIAATEAAPESATTWMCTGLIDPMNYRELVTLCGKCGTLQVLDMAVLDDA
FT                   NQ"
FT   CDS_pept        complement(75086..76345)
FT                   /codon_start=1
FT                   /gene_family="HOG000113121" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081812"
FT                   /gene_name="IZH3"
FT                   /locus_tag="AAL153C"
FT                   /product="ADIPOR-like receptor IZH3 "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50213.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058055"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniParc:UPI00002523E2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F81"
FT                   /transl_table=1
FT                   /translation="MSHPNTHMPRTHAVHGRAAPQRRGCRTSVEKTDQSGHSRSSLAES
FT                   AMEQAQLRSRGEAGGGRSVLCASGEPGSAHKWAGAVTCSGAEEQPLHWAESRARGLARH
FT                   LHYWELPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGWHNETINIWSHLVGAAVLAYL
FT                   LCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVCV
FT                   DYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEARP
FT                   LRIAVYVGLAALGLVSFVHVWMQVRWASAHLMAPLVYKSLVWYGIGVVFYATLVPERWR
FT                   SDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWHVFVVLGVVG
FT                   HYRAVLQMSRIVWLDAGRAF"
FT   CDS_pept        77508..79871
FT                   /codon_start=1
FT                   /gene_family="HOG000246511" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081813"
FT                   /locus_tag="AAL152W"
FT                   /orf_name="AGOS_AAL152W"
FT                   /product="AAL152Wp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS50214.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG058059"
FT                   /db_xref="HOGENOM:HBG202593"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00002523E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F80"
FT                   /transl_table=1
FT                   /translation="METAAQAERIRGQMSTTEHTTDPWAGSVDYGSASRRNSNMDPELA
FT                   SIVSSLSALSTGPGAGAPQQLGGFRRASMNSNSSDVESELLFAGMSPTVRRTTLSVGGG
FT                   AGGGGRLAMLGHYPASIAGTLPAGGQGGTFFERFGRTLAEATREVETGLGTYSVRQALR
FT                   ESAASSAQDLLARPGVAAATSDENALRKMSVSSETVESVSESMSMHNESNPSHNIWNVA
FT                   NAPVFRPNHGDSGGDPYSSVYGGFPYGMFGQYPSGTGLGGGGAFAAGGTVAKGEEASRE
FT                   EPQGDAATATNGQFAFPAGAPFLYFPVGSNGGSGAAIPAVLPPQPSRHSPSESQKGKSK
FT                   GNPYLQQHPRGYKAPGMPLQNSNSKAAPQTSISGKGHHGHHYSSSKQSSTQNQHQANQQ
FT                   QSQYQHQSSSGATKRNGKNQQPIMRSPLLEEFRTNPTNKTYKLHEIYGSALEFCKDQHG
FT                   SRFIQQELATASNIEKEVIFNEIRDHAIQLSHDVFGNYVIQKFFEFGTKTQKDILVEQF
FT                   RGKLEALSLEMYACRVIQRAFEFIDEDQKIDLVMELSSSVLTMIKDQNGNHVIQKTIEC
FT                   IPMSKLPFILESLRGQIYHLSTHFYGCRVVQRLLEYGSKADQEEILNELDQFIPYLVQD
FT                   QYGNYVIQHILQHGGDNPAENHIDKSKQDIVDTISKTVVEFSKHKFASNVVEKTILYGS
FT                   ASQKRQVLDKILPKDEEHAATLEDTSPLILMMRDQYANYVVQKLVGVGTGNDKKLIVIA
FT                   IRSYLERLNKNNTLGNRHLASVEKLAALVEKVKL"
FT   CDS_pept        complement(80213..80533)
FT                   /codon_start=1
FT                   /gene_family="HOG000246672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930513"
FT                   /locus_tag="AAL151C"
FT                   /orf_name="AGOS_AAL151C"
FT                   /product="AAL151Cp"
FT                   /protein_id="AAS50215.1"
FT                   /db_xref="HOGENOM:HBG058064"
FT                   /db_xref="HOGENOM:HBG397082"
FT                   /db_xref="InterPro:IPR008504"
FT                   /db_xref="UniParc:UPI00002523E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F79"
FT                   /transl_table=1
FT                   /translation="MANPVSADILSSRSVSFNKKRLLYVHDITSLVFGCGAGILQLESL
FT                   QGFIMFAVSYLSISAIFAMRLCKFEPSKYFQNPVQDIILTSLFRELAGFVMAWTFTYAL
FT                   LS"
FT   CDS_pept        80894..82015
FT                   /codon_start=1
FT                   /gene_family="HOG000177950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081814"
FT                   /locus_tag="AAL150W"
FT                   /orf_name="AGOS_AAL150W"
FT                   /product="AAL150Wp"
FT                   /function="binding"
FT                   /protein_id="AAS50216.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG181600"
FT                   /db_xref="HOGENOM:HBG329863"
FT                   /db_xref="InterPro:IPR007205"
FT                   /db_xref="InterPro:IPR007206"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00002523E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F78"
FT                   /transl_table=1
FT                   /translation="MPSQLEELVSFLHSPQPAVKQIALDNLVGFSTGPHAGIFKNENYR
FT                   PIQDLKELAKNNSKTIVQQSVTILANLCDDPVMRMKIVTDIDFLSYLAWKICDLGNSSA
FT                   DIMCILLSNLAKDEGITNIFGINGVHDSVSLDEKVFMSKNVIDCLMDCFVKGYDRKLNQ
FT                   YANFDYLSFFFADISRFRKGRNYFVEEQQYDGVVPISKLLVFTEKYDNKTRRLGVASTI
FT                   KNSLFDSLHHEKMLKDEKINLLPYILLPIATSRDSELDEEDLFNLPDELQFLPEDKQRD
FT                   PVPEIICVHLESLLLLCTTANGREYLRSKSVYPLIRELHKNVENEEIGELCHRIVNMLM
FT                   RGEPENEKVEEIVSKSAEDESEESDDEAIVEVL"
FT   CDS_pept        complement(82194..84065)
FT                   /codon_start=1
FT                   /gene_family="HOG000246678" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081815"
FT                   /locus_tag="AAL149C"
FT                   /orf_name="AGOS_AAL149C"
FT                   /product="AAL149Cp"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50217.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="HOGENOM:HBG058074"
FT                   /db_xref="HOGENOM:HBG397129"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI00002523E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F77"
FT                   /transl_table=1
FT                   /translation="MSNGRKAAGPQPFIKRDQLRRDFLRTRVKRNGPGKGGVKKEDPDS
FT                   MEEQTRQMLQGGGGGVKREDDDYQEFPLRAANAQDLKNVKVHLLKFQSKKKIEPTKDFH
FT                   LPVRLHRKDTRNVQFQLTRAEIVQRQKEIAEYKRRLEGEQGATPVSASSRESGGAEGTE
FT                   GTPGDSGGALQPLAAEKPGPTTKLPEAGLAEDPTKVGLVKYDGKEQVDFDFQSGTIDPF
FT                   ADVAPDGGGRFKRGNSKRKTRQLKLLDEKARKLRFEEFYPWVMEDFDGLNTWVGSYEAG
FT                   NSDSYVFLSAENDGSFTMIPADKVYRFTARNKYATLTIEEAEKRMEKNGAGAPRWLMKH
FT                   LDNIGTTTTRYDRTRRRLKVVDGNDRQEEDDRVDNSEVELDYDEEFADDEEAPIIDGNE
FT                   EENKESEQRIKKEMLQANAMGLRDDDAVEDEDDLFGEKKIDEEGEKVKKALLKTDLGAL
FT                   YESDDDSNPYLSESDLDDDDDKKIKKEDQDEDSLSRKSSPKKKASRSPHAGHIYVKSIK
FT                   NCIIVISADKSILNNFPKGEWNPSSANHDNGAKDRTDFASRDGAPAPHELLTEQDIIDA
FT                   VQGKEITLKQLIKELRSKFKHPENKDRLKLFVKRLVKLNGTFLELAR"
FT   CDS_pept        84528..85742
FT                   /codon_start=1
FT                   /gene_family="HOG000228237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081816"
FT                   /locus_tag="AAL148W"
FT                   /orf_name="AGOS_AAL148W"
FT                   /product="AAL148Wp"
FT                   /function="ATP binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50218.1"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG035376"
FT                   /db_xref="HOGENOM:HBG330667"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015624"
FT                   /db_xref="UniParc:UPI00002523E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F76"
FT                   /transl_table=1
FT                   /translation="MSETIVDPTEAYELIVKNLQEVLNPQIIKEVLEEQKRPLRLYWGT
FT                   APTGKPHCGYFVPMTKLAHFLRAGCEVTVLLADLHAFLDNMKASLEVVNYRVRYYEFVV
FT                   KAILRSINVPIEKLRFVVGSSYQTSAAYTMDLFRMSNVVSQNDAKRAGADVVKQVSNPL
FT                   LSGLLYPLMQALDEEYLGVDAQFGGVDQRKIFVLAEENMGSLGYKKRAHLMNPMVPGLT
FT                   MGGKMSASDPNSKIDILEEPKVVKKKINTAFCSPGEVEDNGLLSFIQYVLGPIQELKNA
FT                   PGYFEFFIDRPEKFGGPITYHSFEELRQAFKDQKLAPPDLKTGVADAINALLAPIREEF
FT                   ANNPEFQDVAAKAYPVVTEQKTKKVKKPKNKGTRYPGAPKPAADVDAEVDEASVQMKKT
FT                   SLETN"
FT   CDS_pept        complement(85927..91368)
FT                   /codon_start=1
FT                   /gene_family="HOG000141750" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760188"
FT                   /locus_tag="AGOS_AAL147C"
FT                   /product="AAL147Cp"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50219.2"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058076"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="UniParc:UPI0001DB26E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F75"
FT                   /transl_table=1
FT                   /translation="MGTVDYICDIREYLVHLPRLSNYQVNDTVLYQLWKVLFECLNQGR
FT                   SKGIVDWKKLLRVYESPNWQNGVFQSIHLPAEWREKFLEEYTGTGEGVGNDHRGTSCNK
FT                   LCQPTETVYYCFNCTKNPLYEICDECFDPTKHVGHQYTSKVVSRPEGKVCHCGDPSGLS
FT                   NPEEGFECKSALNNLPRRTMSYEHDESLVSILAHVLDYIVDTMMQLKEWTNDDIFLTLP
FT                   MTLEQQSEYYALQLYEKDCKIHIKDLAAKISRVLCKPLEYGIMMVEKLVRGEAFVILLE
FT                   SKDTQKLKTVKEIFTNEHIATHIKNKNEVFRENLVDELIRWIYELCYKRPNVQRKLALR
FT                   VAMMSTWNSKLLGMTLRSQATMVPYWSKIYLLGNFTVQYSQRTSFPWCSPWSFDEAKNE
FT                   QHDPRVLEIMKEYDKRLAEVVPDNSTAKYQPLNGSRFQYLITDGTAVMSKVSRYRMMKV
FT                   ICSMFTIIDDSKKCLAAQYLDVYCAVLYNTVASESTDYKISLMNMLSQYIFQNPQIANM
FT                   IITKAPGFIQRALQFAFALLSFAPATLINCPPIPLSYDFKLPDDSIKSKRSVVCFKDIY
FT                   LIMSTNTVPESVFQNQELTSVIIKCFASFNNILPLRREAKEHVEFENFDFSSYYFLFSS
FT                   ILVMVDGFVRNVCLIKDPRRRREVVYDLLDRSISLEIKMLSCFRNSIPFSDSLWDSSDA
FT                   EPQVKMVRETIYNVTSNIISFQVGIDTQNFFNPMSYFFKFVLQWSQCGRYETLPEELKG
FT                   YINLVSFFKENKKLIFMAESALSTLVLIAQINSGFWVRNGAPIIHQLRMYTKYSMREFT
FT                   YFSDIFNLQLAMSLSPPNDFMVTFISRWHLKNWTEGVPIDDYPDKDVTSSMVDQCLLLL
FT                   IQLLSEVRSLTMSSSVEGFEKTMRSEIIHALCFHNCSHSNLMNVIPEHVTKHPAFDLYL
FT                   EHLANYTPPIGITDHGVYTLKEEYMNEVDPYFVGFSATKRYEAEKLMRSRMESNQLIPY
FT                   MDTFVPAKNVIMELQFTPFSGLYQITSTDIFGIFIKSTLEHIAKFKYEAMLSKVAHIIH
FT                   LCFINNLNGFVNVFWREYSFDETALSFYNSIGSLLFSFLLDEDFCSDHGKIREIFSLLQ
FT                   REAPHVDVDGYLNEQTPNYDPQIWKSRSRELKKGEDEYEKKRLAKRKRDRLLRKLAKQQ
FT                   QQFMENNNVTPEDIDSRETTIDGSFSAIGWEYPDDTCVFCKMPRVENDTFVYFTHFEQN
FT                   TVDKYTDFGKLNLLQSLYTSAKPQPLFPSPGSTSICHVVKACGHGSHFSCMERHMKASR
FT                   NAHNHMTKNVPNGLGFSLLFCPLCNSLVNSFIPRLSDVNTRCDEELFAGTHENKYSMSS
FT                   EELDTLCLKSLIIFCSLTVQSKFSRLPDIYTLFCSVIANTISNIELITRSGDTTIPITK
FT                   RLTNQQLLTLRLLTEMKIYILERKLFSHQTGKITGIPIPAVREYDDWAAFNVEFLHSNL
FT                   LLDACRYLNPITRKGYPLSAFVYASIKRKLHQIFIALSTTLVEDSDCMIDGDQNVMDWD
FT                   VDDIDSGQEGADSVLGVVLTYIVALSTAISIDRSQLNRVAKWKVLLYNVTEKALTVFLR
FT                   RFLMLIFAEYPITKRECNTIELELSSLLSYFGVPQLDSILTDFRVNDLPLTKATIKEAS
FT                   KGPNIQSYAQKVYSLRVESPYGSPLIPLPHRLSDLLSDEEEQLQYRINRHEVAMCLFCG
FT                   TKVFIQNASMLHNFMIGECTNHYSNECTQTAVYGCFLLVRSNTVYLAYGDRGTFFKAPY
FT                   VNKHGEVDEDYKYGTPVFLDEKLYSHLGNDIVLGGKIPHLVHRLTENMSDVGGWESM"
FT   CDS_pept        92509..98211
FT                   /codon_start=1
FT                   /gene_family="HOG000142344" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760189"
FT                   /locus_tag="AAL146W"
FT                   /orf_name="AGOS_AAL146W"
FT                   /product="AAL146Wp"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /protein_id="AAS50220.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG058077"
FT                   /db_xref="HOGENOM:HBG204417"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013993"
FT                   /db_xref="UniParc:UPI00002523E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F74"
FT                   /transl_table=1
FT                   /translation="MIREGAGEVQRHLRHTLESLHDHEYFKSPRGPQERSEMDKVLRSF
FT                   VFRYLYYVLSDNGRLLPHLFAGAPKDKFPTSVEDAMQVDSPSLSKADIFYAIDEITGAK
FT                   SHRHTGRNCGRAFQPGEPLYRCQECAYDDTCVLCISCFNPDDHVNHHVSTHICNELHDG
FT                   ICDCGDAEAWNVPLHCKAEEDDSDGDEEDSVFENDYNMELFEAVLEELFDHFIEVFNQN
FT                   IEPLPTIQKDLTMKLREIIQDGKTQEKFELLSALAYRNQYMEAQKPSSGPASFETEQDL
FT                   DKKLDGYVVLIYNDEYHNFSQATSALRQGGPDNKHTDQLTARIDGEGRAMLKCSRDLSA
FT                   VIGGFFSVQTNGLSATLTPWSEYIHQEACKYMIHWVKNCLSIPNPSFQKVFREAMGKVL
FT                   CSEYIRASETTDMTPVIDKYFIPDRRNTGCHIYADLSVLGKGNVIPLGHHKVLLQESLN
FT                   EIALNLNNYEELKYRRYSNSRLQQILFFDNRYWKKLRKDIRRAVIPTLASSVKYKPTFS
FT                   QQVVEIFNHMTRSVAFMDREPQLSALADCVVQLFTCPTTVRTIFENENFPDIMWSVIDI
FT                   FTEFSKVDDGILLWQRVQKSNPSKSYSYSFKHGLYAVETLLSKVENANLILRPPEFISI
FT                   VTLCKLFNGAWRIKRKEGEHVLREDQHFILYLEYTTSIYNIIRAMNRVLDSSRAALSED
FT                   TLLQAIGLLNTFLGHRTLPYKLVQEAHDVIAFKVSKQKVAFMNPVHTLFSCLIEKVPLA
FT                   KAFEAVSSTKDFLTIADFSLRAAVLCSQIDVGFWVRNGMSVLHQSAYYRTNPEINSYSR
FT                   DIHLNQLAFLKENDDLPRVIYNLLDRWELLGWFTGAEQYETTVYEERITNIIQQFIAFV
FT                   YHILSERHFFRYFGSSAERETHTMKNIIIYSLLMKPLPYSELLKSVPDYLSEKLSVFDE
FT                   CLHEVSEYVEPKGLEDSGVFSLKKEMYKKIDPLRLLNMKNDFEHSATIVKTHLAEGSNA
FT                   VGQVVLQPQLISPKHLDELAAHLGDFTRTQVFAKLIYKLLQACIDREDGTYLYELLHLL
FT                   HGIFKDDELLRGKSSIPEAYISKPICNLLLLIDTKANVFSENAIRKADFLLEHMIRKRH
FT                   NDIFESLAAYFGQDYVEQYKAKKLNQGINFEETEKDRKKRLARLRQQKIMAKFSKQQAK
FT                   FVRSNPNVITDDLFDAEVRTGSDGLVCSLCQDEESLDAFVIPAYHESSPIFFYGDYTPQ
FT                   NFAKPWNGFVNDDDNLTFYDDLKLYSLQEARKGSTTTFVSCNHIIHYECFRRYIQKKRF
FT                   SNNLFICPLCQTFSNCVLPIPHWSLRLPKSPVTVDQLLSQPSEENLINLFIDDQTPNST
FT                   AAMNMLKEVCKKNGNYDKSYGSVSQEFVTSILTCHWANTISMIEIASRIEKNTHQTLLQ
FT                   GKEQKFKTLRGVLSAIGWFYKCMGTPRQKFVPYVFHGEDDGPANQVFQYIVHKSLFSGA
FT                   PVSETISHALAIWIRTLATQFLISSNKTGYEITYHQAVSLGPVYEAPPEFTTACSSLDQ
FT                   IIAIEDTTLKTKMVDLTYTMLMKTLLPTLRRCMIMLYVFSGLLSAESCLRIDGLDLSAD
FT                   LPFEDLPSYFQKLVTLLCKTGFVSIFNRSTIETMDHQYLRNIPMEYAGTVKLVDLAKYL
FT                   NTYVTNTKQLKLRDEATSMQSRNIKNRLDFKICLTCGVRVYSRSDGTEIMKHMAKNCFK
FT                   AYSLFLIPHDSEVRLVLQHPHSHISIPAPYLNSHGESGKNAIQRGDLTTLNIHRYEHLN
FT                   YLWLNNEIPGYISRIMGDEFRVSIISSGVVFNFDRNVLRRQMRANVGNEESSEEEDLMD
FT                   DDEMSPDDDPDFRWEVTPEEFFRDGILRLGGAPGQGGDIRDFFQFITNLRTDDRNDNIP
FT                   TFQFTNGALGRNQNDDDDQDGDEILP"
FT   CDS_pept        join(98539..98541,98786..98983)
FT                   /codon_start=1
FT                   /gene_family="HOG000215187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081817"
FT                   /locus_tag="AAL145W"
FT                   /orf_name="AGOS_AAL145W"
FT                   /product="AAL145Wp"
FT                   /function="ubiquinol-cytochrome-c reductase activity "
FT                   /biological_process="mitochondrial electron transport,
FT                   ubiquinol to cytochrome c"
FT                   /cellular_component="mitochondrial envelope"
FT                   /protein_id="AAS50221.1"
FT                   /db_xref="GO:0005740"
FT                   /db_xref="GO:0006122"
FT                   /db_xref="GO:0008121"
FT                   /db_xref="HOGENOM:HBG142113"
FT                   /db_xref="HOGENOM:HBG318018"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="UniParc:UPI00002523EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F73"
FT                   /transl_table=1
FT                   /translation="MSFSTLYNTLFRRNSVFVGTIFASAFVFQTAFDSGITAWYEKHNK
FT                   GKLWKDVKLQLQNGEDDDDDE"
FT   CDS_pept        complement(99351..99662)
FT                   /codon_start=1
FT                   /gene_family="HOG000115759" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760190"
FT                   /gene_name="TIM13"
FT                   /locus_tag="AAL144C"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM13"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="AAS50222.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00002523EB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F72"
FT                   /transl_table=1
FT                   /translation="MALSSIFGGGSPSQQSNLPTSSASSSVKDQLKGQIAQELAVANAT
FT                   ELVNKVTENCFEKCLMAPYTSKQDTCVDQCLAKYMRSWNAISQAYVARIQQASANGDI"
FT   tRNA            99806..99876
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        join(100017..100038,100100..100635)
FT                   /codon_start=1
FT                   /gene_family="HOG000185228" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930514"
FT                   /gene_name="APS3"
FT                   /locus_tag="AAL143W"
FT                   /product="AP-3 complex subunit sigma "
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="cytoplasmic vesicle membrane "
FT                   /cellular_component="membrane coat"
FT                   /protein_id="AAS50223.1"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030117"
FT                   /db_xref="GO:0030659"
FT                   /db_xref="HOGENOM:HBG333059"
FT                   /db_xref="HOGENOM:HBG353326"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00002523EC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F71"
FT                   /transl_table=1
FT                   /translation="MIHAVLIFNKKCQPRLVKYYTPVDLPKQKLLLEQVYELISQRNSS
FT                   IQSSFLITPPSLLSSGSETINEDIQIIYKNYATLYFTFIVDDQESELAILDLIQTFVEA
FT                   LDRCFAEVNELDLIFNWQTLESVLEEIIQGGMVIETNVKKIVETVDELNRTSNQEARFG
FT                   NGLGNAFQAITMGGFSNWGARQ"
FT   CDS_pept        complement(100759..101190)
FT                   /codon_start=1
FT                   /gene_family="HOG000065984" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760191"
FT                   /gene_name="CBP4"
FT                   /locus_tag="AAL142C"
FT                   /product="Assembly factor CBP4 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50224.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058078"
FT                   /db_xref="HOGENOM:HBG395794"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniParc:UPI0001DB26E1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F70"
FT                   /transl_table=1
FT                   /translation="MERPVWFRWLRVYAIGFGIIGAGVLLFKYTTPTDEELIAALSPEL
FT                   RQQYERERKLRQAEQQELMRIVKQTAASETPVWNTGPIKSPWERKGVSAESREQFQQVK
FT                   AEQVQREELQRIREELETIRQQSANKTQEIASKKSWWPW"
FT   CDS_pept        complement(101503..102996)
FT                   /codon_start=1
FT                   /gene_family="HOG000174713" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777549"
FT                   /gene_name="ERG1"
FT                   /locus_tag="AAL141C"
FT                   /product="Squalene monooxygenase "
FT                   /EC_number="1.14.99.7"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="squalene monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="microsome"
FT                   /protein_id="AAS50225.1"
FT                   /db_xref="GO:0004506"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0005792"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG316608"
FT                   /db_xref="HOGENOM:HBG517657"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR013698"
FT                   /db_xref="UniParc:UPI00002523EE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F69"
FT                   /transl_table=1
FT                   /translation="MSKETSYPKELLCADEKVVYDAIVVGAGVVGPCVATALARKGKKV
FT                   LIVEREWSQPDRIVGELMQPAGVRALRSLGMVQAINNIDACSTSGYTVIYNGEKISFAY
FT                   PYKADLSPPEKIPDLVFDGNDKVVDDGTISAKEFEEDEREHGVGFVHGRFLQNLRAICA
FT                   AEDRVTRLQGNVISILRNDSKEVIGAKVDVPGRGKVDFKAHMTFVCDGIFSRFRKELST
FT                   TNTSKVWSSFVGLSLHHADLPTKHHGHVILGSEHMPVIAYQISSTETRILCAYNYPTLP
FT                   KNVPEWLQKEVQPFIPPSLRKSFDAALESKSYKCMPNSWLPASQNNVTGLCVVGDALNM
FT                   RHPLTGGGMAVGLMDVVLLVKTIGDMDFSDREEVLNELLGFHYERKAHACVINTLSIAL
FT                   YSLFAADSYYLKKLQKGCFEYLGRGEDWVRQPISFLSGVLPSPYLLTKVFFTVALYSVL
FT                   INFRGRTPLGFLLAIYEGFAIIFTAAKVFTPFLYEQLLQ"
FT   CDS_pept        complement(103420..104970)
FT                   /codon_start=1
FT                   /gene_family="HOG000066086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930515"
FT                   /locus_tag="AAL140C"
FT                   /orf_name="AGOS_AAL140C"
FT                   /product="AAL140Cp"
FT                   /protein_id="AAS50226.1"
FT                   /db_xref="HOGENOM:HBG058079"
FT                   /db_xref="HOGENOM:HBG202216"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="UniParc:UPI00002523EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F68"
FT                   /transl_table=1
FT                   /translation="MSTYIRGPVCGTDNCRSRLWRIINGHRTCQYGHVMEGDVEFNDDD
FT                   EEFSAMGVVTRRLNLTTNATGNFQSSQAFSQTQVLAQHEDEKRLLGAPARELFLKCFQY
FT                   ILRKQCSWLIEEQGFPIEFSKTVKIIWMLYLKHMEPETPPAGDDANETVSAPSQTLTER
FT                   YRTANGGRMGLSMLSTLAFHYLACVHLGLPAHTDDFIRWVSSLEMPYFRAVECLPAEWQ
FT                   KKLPNYYTQIMEGSSVPRNAQLHHKISSVALQVKFSAHFQDAIPAGPMILKLVTLTGLP
FT                   PEFYLYTTTLLELIEHHSYVSVLAHDSTHVARPHLYPELRIAALFITSVDWVLQQQDYY
FT                   NIEYLLAWLRRENAVRLTQDTASRNRELAHLAQQPTQLPVAWSQEQASAYLDWLESDFL
FT                   PKYDHFTNSHIPLDHKIARRKLYNILPLAPAAKLEPTHPSSRTFINTLQEFYFTTASSL
FT                   STVSESPAAATRSAAVAKVRHKLVRDLAAEFGVSSQQLTNAVNTIQKQCLVAVRRQAT"
FT   CDS_pept        complement(105162..107222)
FT                   /codon_start=1
FT                   /gene_family="HOG000093792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081818"
FT                   /locus_tag="AAL139C"
FT                   /orf_name="AGOS_AAL139C"
FT                   /product="AAL139Cp"
FT                   /protein_id="AAS50227.1"
FT                   /db_xref="HOGENOM:HBG058080"
FT                   /db_xref="HOGENOM:HBG396596"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniParc:UPI00002523F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F67"
FT                   /transl_table=1
FT                   /translation="MKGSLNSRKEGAFSSVTAGRTGNDVGGSFYENEETKKAFSDRMNY
FT                   VLVNSIGGRAVVTIPSGVKYSGMLLACNATTSNGVDVILKYPRIIDKGIDEEDAAVLSA
FT                   QLKETLLIEGDDVAELELLDVDFSLDDKWEQIKRREEQKARERRDGKLQEFRTDTDIAG
FT                   AGEVKERELQKWTPDDSEAFALEGSLEDHAEEWDQFAVNEQKFGITSTFDEYLYTTKIN
FT                   KGDPNYETRLKEADRIAREIEAQGTAGNVHLAEERGIVVDDSGMDEEDKYSGVDRRGDE
FT                   LLAQLKMNAKPALGRPTKYVPPSLRNEPHNADPAILSSTKKGWSPPAPKSPVDKKIQLD
FT                   ELKKFSEKFKVPYKMPEDVKTIFKKSEELPSKSPSALKVNPSLPPKPTPQPASSTATPS
FT                   ITPSKTSNRNSKPSTPASSKVELKRPQNKFGPQSGHTPSNSPSAGRANTYRRRNNPPFF
FT                   GDDGPKCLKKDFKKNFNVFLKSKEAFESRSRHKQTAEGKAMDAFLIEKPYFTTPTWIST
FT                   MDRSFRTLFPDERTAIQKAQLRLQHRIMNAIGGNMPMGSIPGMMAMPVGPAGSQSTPFM
FT                   ASPGMFMPFQPQPMFYPPVPQMLTMVGGPADDRRNSTHSPSPTTNSPHGAPAFINGAPI
FT                   GPFGYPAAFQPIMAPVGTGNVNGVAGPNGNGSNYKNHYHHHNNGNRYHRHR"
FT   CDS_pept        complement(107399..108322)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760192"
FT                   /locus_tag="AAL138C"
FT                   /orf_name="AGOS_AAL138C"
FT                   /product="AAL138Cp"
FT                   /protein_id="AAS50228.1"
FT                   /db_xref="HOGENOM:HBG058081"
FT                   /db_xref="UniParc:UPI00002523F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F66"
FT                   /transl_table=1
FT                   /translation="MARNILDEIASESDPSQDEEGSLLAVDGDAFRLDQAAPAEPAARE
FT                   LFLRDDSESPLRRPHGGSGSSEGGSSDAEGEAPETQRRPEGRKRVKFSAAERGVADFNP
FT                   WDIRRAVRRAFRDKLPENYSIKTWRRPPRALLRSLADLLSANADNAVEGALSAYHRELT
FT                   RTLGPNELAAFRHDREQLIRSILHKLRTRLKRTHFPARVSEHVLDIEDIYARRTFIQQR
FT                   HIAELNAAEDLERQLLAEQQALAARTAERSDASAKVLLDRLTANLHPALNKAVSNAYGL
FT                   IKDAENTRETYLADCDDLNLHLSDTE"
FT   CDS_pept        108988..109983
FT                   /codon_start=1
FT                   /gene_family="HOG000106048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760193"
FT                   /locus_tag="AAL137W"
FT                   /orf_name="AGOS_AAL137W"
FT                   /product="AAL137Wp"
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="AAS50229.1"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG056531"
FT                   /db_xref="HOGENOM:HBG325902"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="UniParc:UPI00002523F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F65"
FT                   /transl_table=1
FT                   /translation="MQNEHSEFAKMSQTLTNVQELRLRASTTRHALSDIVREKDWSDFQ
FT                   FAPIREATVSRAMTTRYFEDLYRYAVSDVVIVGAGSSGLSAAYVLAKNRPDLRIAIIEA
FT                   NVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEIPYEDEGDYVVVKHAALFTSTVLSKVL
FT                   QFPNVKLFNATAVEDLVTKPSANGGVTIAGVVTNWTLVTMAHDVQSCMDPNVIELEGYK
FT                   DDGTRDPKKKHGVVLSTTGHDGPFGAFCAKRLAALDAQHAIKGMQSLDMNTAEAGVVKE
FT                   SGATAGVEYMYFAGMETATKKGVSRMGPTFGAMAVSGIKAAEEILRHFAE"
FT   CDS_pept        complement(110158..111426)
FT                   /codon_start=1
FT                   /gene_family="HOG000255975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624992"
FT                   /locus_tag="AAL136C"
FT                   /orf_name="AGOS_AAL136C"
FT                   /product="AAL136Cp"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /function="transition metal ion binding"
FT                   /biological_process="deoxyribonucleoside diphosphate
FT                   metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50230.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0009186"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG006380"
FT                   /db_xref="HOGENOM:HBG418082"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniParc:UPI00002523F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F64"
FT                   /transl_table=1
FT                   /translation="MPETSVPKETPSKVTANALSELDLTTSRRSLGPTLAKENQPQLGS
FT                   HEKVHIIDEKHAVADGDVDANQSLSQAAREHQQFLRSHQVHRHHLKEQEKNEPLLMENK
FT                   RRFVLFPIKYHDIWQAYKRAEASFWTAEEIDLSKDIHDWNNRMTENERFFISRVLAFFA
FT                   ASDGIVNENLVENFSAEVQIPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKEADHLF
FT                   NAIETIPEIKEKAEWAIRWIQDKDALFAERLVAFAAVEGIFFSGSFAAIFWLKKKGLMP
FT                   GLTFSNELICRDEGLHTDFACLLFAHLNNKPDTEIVEKIITEAVEIEKRYFQDAIPVAL
FT                   LGMNSSLMNQYVEFVADRLLVALGNKKYYNVSNPFDFMENISLAGKTNFFEKRVSDYQK
FT                   AGVMAKSTKQESESGAFTFDEDF"
FT   CDS_pept        complement(111644..112417)
FT                   /codon_start=1
FT                   /gene_family="HOG000037706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760194"
FT                   /locus_tag="AAL135C"
FT                   /orf_name="AGOS_AAL135C"
FT                   /product="AAL135Cp"
FT                   /protein_id="AAS50231.1"
FT                   /db_xref="HOGENOM:HBG191785"
FT                   /db_xref="HOGENOM:HBG611223"
FT                   /db_xref="UniParc:UPI00002523F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F63"
FT                   /transl_table=1
FT                   /translation="MSYYANHNSQGGFYQPSQQFQFPQGAMSFDPSGSGGLSNSSPANF
FT                   TNEQLPNGIINALSTRGYSFEPPLLEELGINFGHILTKTKFVLTPTTSVNLPLEIFNDT
FT                   DLSGPLLFCLVFGTMLLTAGKVHFGYIYGVALFGSLSLYQLLRLMSQPVSPASQTASPS
FT                   ATPVPHASNAVSFLKTASILGYSFLPLCFLATVGVFCSLNNWFGYILGLISVVWCTWSS
FT                   SGFFIYYLQLHNVRVLIAYPLLIFYSVFALMAIFV"
FT   CDS_pept        112667..113773
FT                   /codon_start=1
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930516"
FT                   /locus_tag="AAL134W"
FT                   /orf_name="AGOS_AAL134W"
FT                   /product="AAL134Wp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50232.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG020894"
FT                   /db_xref="HOGENOM:HBG631304"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniParc:UPI00002523F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F62"
FT                   /transl_table=1
FT                   /translation="MGVIEKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLEES
FT                   TASSGGGGTGFEVAKSGDARVVLIGYPSVGKSSLLGKVTTTKSEVAHYAFTTLTSVPGV
FT                   LKYQGAEIQMVDLPGIIHGASKGKGRGRQVIATARTADLIVMVLDATKSNHQRESLERE
FT                   LETMGIRLNKEKPNIYFKKKETGGLKITFTSPDRSNLTEEAIKLILRDYRIHNADILVR
FT                   DSSCTIDDFIDVLNEQHRNYIKCLYVYNKIDAVSLEEVDRLAREPNTVVMSCEMDLGLE
FT                   DVVDEIWYQLHLNRVFTKKRGVRPDFSDPLVVRNGSTVGDLCHQIHRDFKDKFKYALVW
FT                   GSSAKHSPQKCGLNHKIHDEDVISLFTK"
FT   CDS_pept        113952..115655
FT                   /codon_start=1
FT                   /gene_family="HOG000200401" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777550"
FT                   /locus_tag="AAL133W"
FT                   /orf_name="AGOS_AAL133W"
FT                   /product="AAL133Wp"
FT                   /function="ATP binding"
FT                   /function="methionine-tRNA ligase activity"
FT                   /biological_process="methionyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50233.1"
FT                   /db_xref="GO:0004825"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006431"
FT                   /db_xref="HOGENOM:HBG266382"
FT                   /db_xref="HOGENOM:HBG721667"
FT                   /db_xref="HSSP:1A8H"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniParc:UPI00002523F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F61"
FT                   /transl_table=1
FT                   /translation="MVASTRRALRAIQKFHITTPIFYPNAKPHLGHLYSSLICDVQARW
FT                   QKLRDSEVLFTTGTDEHGLKIQTASEQQGYASPKVFVDKLCTHFISLDEQANIGYTRFI
FT                   RTTDKDHISNVLRLWELCKANGYIYKGEHSGWYSVSDETFYPATKVVQVIDGREFPVMD
FT                   GSTVTEGAEYINTETRNRVIHQTEVNYFFRLSSFRERLISHLKENPGFILPPSRSAQIL
FT                   DLLLKAELPDLSISRPKTRLKWGISVPGDESQKIYVWFDALCNYVTSIGGVDAVLEDRP
FT                   IANLVHSIPQGSVSGSSKEWWNATTHLVGKDIVKFHTIYWPAILLAAGLPLPEKVVVHG
FT                   HWLSDGVKMSKSLGNVVVPEEMIEKYDTDPMRWFILEHDTIEHDASFSEEGLCQTRELL
FT                   CSKWGNLLHRCGGPKFNIHRAVQKFHHKPITDLTKNNPELYGNLLSRLTTLADEIDQLL
FT                   SKYDTANALRLIWSIINDANMVVQHGEPWKKPLEEQDLIIYTAVEAARIVSIAAQPFIP
FT                   VLANRFLDRLDVHFDKRSLEYASVGADSSYGTTANVRGREVPISSLSRQR"
FT   CDS_pept        complement(115713..116960)
FT                   /codon_start=1
FT                   /gene_family="HOG000189057" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760195"
FT                   /locus_tag="AAL132C"
FT                   /orf_name="AGOS_AAL132C"
FT                   /product="AAL132Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /protein_id="AAS50234.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG324241"
FT                   /db_xref="HOGENOM:HBG345712"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI00002523F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F60"
FT                   /transl_table=1
FT                   /translation="MQFYQMYAYRLNESRKRVLANCQRKWDDGFRIQGKPVVQKAKVLD
FT                   IQAGEPCWCVGTIYCEMKYKPNVLEEVVNDTYGTKAPVKSYTDPEGTDEIMLEDESGRV
FT                   LLVGDIITSTPFVTGTVVGVLGMEAEAGTFQVVDICYPQAIPQAPLVRAPGKSVALISG
FT                   ICAASNDPKLSLKLRLLQDLLSGDIGDTGSIASVARLIICGDSVGTCESNSIGGALDEL
FT                   GSFMANTLTSLPITILPGANDPSERSLPQQPLHKALFKQALKPYFAEVNSEVFESVTNP
FT                   YWFDLEGIQVLVSSGQNVDDMCKYVIPYLGTEQLRDTIEHRLDLIEASLKWQNIAPTAP
FT                   DTLWCYPYKDNDPFIMNEWPHVYIIGNQHAYGYRKVLLENEVEVVLITLPKFSSSGQFV
FT                   ILDLDTLNAEVITIDA"
FT   CDS_pept        complement(117330..120374)
FT                   /codon_start=1
FT                   /gene_family="HOG000199289" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760196"
FT                   /locus_tag="AAL131C"
FT                   /orf_name="AGOS_AAL131C"
FT                   /product="AAL131Cp"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="AAS50235.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG104463"
FT                   /db_xref="HOGENOM:HBG192755"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00002523F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F59"
FT                   /transl_table=1
FT                   /translation="MGVGLIRRRRRSRQPRLTLKVEVQQARIVTVEDTRCNPLCLVVTN
FT                   GVFNRTKRFKNTSTPSWRQTLKLALPSKPSSEWLRVLLYDDVLRWQDNGDNSLERGRYL
FT                   YLGEARFSLLDLFRGEKGKYSPERSAEWVPFYSGRTGYKAGEVLLAFSLVSSGNEPSTM
FT                   AVFREWRSYLLDSLAARRIQRKQEIELLGEGQRLADTEDDEGDDDDEDNENMLGYTSLS
FT                   DSSPDDFTNYEDIIEHSMVSCYIEDEEEDEGDTFDNDDWEYMDDIFYADDKSYGTDQQG
FT                   MESKRYNQNNGSVDSFAFVPEVSTTPFTEVSESSNAKEKDSHSSDDTEGTEVMLFGRRK
FT                   RNMRRARPRNNDFEISKKTHAMGVAFVEVKRILDLPPLRNKFSTTFDMDPFVIITFGRR
FT                   VFKTSWKKHSLNPEYNEQAAFEVYPHEMSFKLDFRVLDRDSFSFHDRVADASVDFKDVI
FT                   SRKSTNGICHWDLEVPLNLRYNTLSETHASRMYLKLSFFPYHILKKHFWDQVINAASTL
FT                   QHFDVVQLTLLLDGLGHFTEDEVNEFFYHSGKSPWSKDTLPKEVIIRHLQEWKNSSAFR
FT                   RVQKCPLCCQQVKATKALRHSKLNAENDLITHFAICSSGHKKQLKPSYVSSDFASKRWF
FT                   SRLLIKLTYGKYALGSNNANILVQDRDTGIVIEEKISAYVKLGIRIIYNARGKQSKKFK
FT                   SLLRSVTIKQGKKFDRPASAKDIEPFIKFHSLDMSECLETNFTTFNEFFYRKLKPGSRT
FT                   PESPNPKVLLSPADSRCTVFATVRRSKEIWIKGRTFTLEKLTGGQFPELCNERSCSVGI
FT                   FRLAPQDYHRFHSPCNGVIGKPHYISGEYYTVNPMAVRTELDVFAENVRVVVPIISEEY
FT                   GTLLYIPIGAMMVGSIILTCNPGDKVKRGQELGYFKFGGSTVLLVLQSKNIVLDTDLVK
FT                   NSEENIETLVRVGMSIGHTPDIKEHCRTKVHVNDNEELERIKRTITVTEENAQSTNYTS
FT                   WEYQTLKKLNEKEPEFQGLLDILTE"
FT   CDS_pept        120875..121156
FT                   /codon_start=1
FT                   /gene_family="HOG000000814" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760197"
FT                   /locus_tag="AAL130W"
FT                   /orf_name="AGOS_AAL130W"
FT                   /product="AAL130Wp"
FT                   /protein_id="AAS50236.1"
FT                   /db_xref="HOGENOM:HBG124984"
FT                   /db_xref="UniParc:UPI00002523F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F58"
FT                   /transl_table=1
FT                   /translation="MGKRFSESAAKKIAGQARKREQAATKERAERERLEAEEASKWEEG
FT                   SRQANARKLQEEQKRLEKLKAKQEREALLAAEEEALGKGGKGKKSTRK"
FT   CDS_pept        complement(121231..122103)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760198"
FT                   /locus_tag="AAL129C"
FT                   /orf_name="AGOS_AAL129C"
FT                   /product="AAL129Cp"
FT                   /protein_id="AAS50237.1"
FT                   /db_xref="HOGENOM:HBG058082"
FT                   /db_xref="UniParc:UPI00002523FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F57"
FT                   /transl_table=1
FT                   /translation="MSCKLLLERVARWAGPEAAGPVGQLTPPVTSGGASFLRVGAAATQ
FT                   TDPEPSTTCLKGVLAPVQQYYMTRCRTWAPQVYQCDYFALRFFPAEHFLGMARKSKPGL
FT                   LLTYTGDHLLNANVGDQSAGVQQRVELARSAEMEKRLRQISNLIQARGSLRPRDWSYLR
FT                   VGARKTIRAQFLQAWCKYHGPEAVLARLEGAMDSPFLDKHGRTAHKVAKDGLYHYTIRV
FT                   FPDGTTAADFAAHLERSVLYTANLSWDSYSRHAGRKWISENNAQADIAALNKALHKSDI
FT                   PYRYIKSST"
FT   CDS_pept        complement(122219..122755)
FT                   /codon_start=1
FT                   /gene_family="HOG000112974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777551"
FT                   /locus_tag="AAL128C"
FT                   /orf_name="AGOS_AAL128C"
FT                   /product="AAL128Cp"
FT                   /protein_id="AAS50238.1"
FT                   /db_xref="HOGENOM:HBG128038"
FT                   /db_xref="HOGENOM:HBG204144"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniParc:UPI00002523FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F56"
FT                   /transl_table=1
FT                   /translation="MQSSGRSTAMSSPFFDFVDSINHEVNSINNRLMNAGRSGQRSLRP
FT                   VSRISNWLLPQDEDLMPPVDMLEREREYEVGISVPGVASHDDIQLEYRRNNNEIIVSGE
FT                   IPALEEDAVEDGWRVRERAHGRFKRAIGLPEKPGIDAEHIEAQYKDGVLKLKVPKLEDR
FT                   DQPDEVRRIAIGSKQ"
FT   CDS_pept        join(123217..123395,123786..126399)
FT                   /codon_start=1
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760199"
FT                   /locus_tag="AGOS_AAL127W"
FT                   /product="AAL127Wp"
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50239.2"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG403372"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI0001DB26E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F55"
FT                   /transl_table=1
FT                   /translation="MQKRVYTTERAYSTADLMLAAAIGRRITTAWPGVFRRGPGRCALH
FT                   AASRALWCKPTTHTRDNMCQNSNNGAGKKPREVLPANVKPVHYQLQMEPDFTGFTFQGQ
FT                   VNIELEVNDPAVNSVELNTCDLEIQESRIGETAATFVEHNEDLQRTRFTFPETVFQQDK
FT                   RVTLSLKFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEPNLKA
FT                   TYDITLVSEPNYTHLSNMDVKKEELRDGKKYTEFNTTPPMSTYLVAFVISELRYVENKD
FT                   FRIPIRVYATPGNEHLGQFAADLTAKTLAFFENAFGIQYPLPKIDNVAVHEFSAGAMEN
FT                   WGLVTYRVVDLLLDRENTTLGCLQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFAT
FT                   WMSWYSCNEFEPEWRVWEQYVPDNLQSALSLDSLRSSHPIEVPVKRADEINQIFDAISY
FT                   SKGSSLLRMISKWLGEDVFVKGVSNYLNKFKYGNAKTTDLWDALSETSGKDVRSVMDIW
FT                   TKKVGFPVITVEENDGKLTFTQHRYLSTGDVKPEEDQTIYPVFLSLRTKKGVDNTLVLD
FT                   KRSISVDLEDIDFYKVNADQAGIYITSYPDERWDKFASQASLLSVEDRTGLVGDVRSLA
FT                   SSGYTSTANLLKLVSKWSNEDSFVVWDEMASCLFSLRSNWMFENEEVTKAIDHYLRQLF
FT                   APKAHALGWNFTDEDTFASQRLKIRLFSAACSVGDEKVSNAALEMFDKYIAGDKKAIHP
FT                   LIKPSVFIAAANKGTEFYYEKILEIYKNASSDDEKLAALRTLGKFNDPKLIQRTLGFLF
FT                   DGTVLTQDIYIPMQGLRTHKEGIVALWAWFQENWDEIVKRLPPGLSMLGSVVILATSAF
FT                   SSHQMADEVRAFFATKSTKGFDQSLAQSLDSITAKAQWLDRDREVVAEYLKGNYYKNHK
FT                   "
FT   CDS_pept        complement(126585..128237)
FT                   /codon_start=1
FT                   /gene_family="HOG000141974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930517"
FT                   /locus_tag="AGOS_AAL126C"
FT                   /product="AAL126Cp"
FT                   /protein_id="AAS50240.2"
FT                   /db_xref="HOGENOM:HBG058084"
FT                   /db_xref="UniParc:UPI0001DB26E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F54"
FT                   /transl_table=1
FT                   /translation="MGLWIIFELAVTVVICCWTTNWLIQHVILDAKRDLQKAALAEQAS
FT                   IAPVRKEGETAIYRNMLVPMGFPLTTGLNLSRGYQFRRGNFGDIWSAAVAVGKGENYIC
FT                   FADGMRWTVGTVNHAAKQLRAYFMQEKLAHVGIVPSVSTRGGFICAIAAFMASLDGGVA
FT                   HFLPAVPRKDRALDVLVIDSWEIAARLNGSENWYKRIIVCDHSAKPPGLPANLISLHEL
FT                   IDDKESDDTFKYECTDDTDDNKEFLRISNVSMETTSYLQGSLVSSVANFIKTFPMAQSL
FT                   SERDKLTVVLDQLEESLALQIWSKLFAVLLHGSSISFVKASDLRTISSSTTLLVVSGQA
FT                   QGIKDLVSTQLQKCNRFMFSWAISLLSEGVFSGCARISTNFANLRCVYIMNEVACARHL
FT                   NFFPEEIPQRESTDVRRLTRIQLNQIRALLGARVVMELYAPYTIMGPIAQTNIYDYRIF
FT                   PALVDATFTCYGTLSTSLEGKLVDSAANPDLSSAKRQGLLVVRGFTIGKPLEQERLDRA
FT                   MKLVQNFHGGEGWTPLVGVFGIWGSDGCFYEFK"
FT   CDS_pept        128577..129590
FT                   /codon_start=1
FT                   /gene_family="HOG000001049" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624993"
FT                   /locus_tag="AGOS_AAL125W"
FT                   /product="AAL125Wp"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50241.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058085"
FT                   /db_xref="InterPro:IPR019024"
FT                   /db_xref="UniParc:UPI0001DB26E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F53"
FT                   /transl_table=1
FT                   /translation="MPPILKGDVPETYVVILPKCVENSTLTVFQLPHPSNNRSKSPVRL
FT                   FIHDGLVYQLQTQKFSRGCPYNRADDEVNERYHYTADGQAYKSAIYLNEEDPSQSLVLE
FT                   SGEFDYHTKYDLAFSLCRYYYRNNVVNTEAECLEPSRQAVRPSSNFLAVRDFHDELVSV
FT                   DNPNWSHVPLDVLEAALLRVSDVVEEAGDRYFRISPQRITQWLSTKVERMLPVFPSSLP
FT                   LPSGIPDEYLRDVKTAWSTNLLLSLIPQLAYWELRNYEGENLNIKQAFARQDKYKTDVL
FT                   EKQKENDILIKGAMSVGLQQDVKREGPPRQTTNLKSTVKKKVATGKGAIDSFFKKR"
FT   CDS_pept        129770..130687
FT                   /codon_start=1
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081819"
FT                   /locus_tag="AAL124W"
FT                   /orf_name="AGOS_AAL124W"
FT                   /product="AAL124Wp"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS50242.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00002523FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F52"
FT                   /transl_table=1
FT                   /translation="MAKAIEISTSESAFILEALRQNLRLDGRTFDQFRDVEIELGSEYG
FT                   DVTITMGKTKIHCRISAQIAQPYEDRPFEGLFVISTEMSPMAGAQFENGNNTGEDEVLI
FT                   SRMIEKAVRRSSAMDLEGLCIIAGSKCWAIRADVHFLDCDGGFIDASCIAVMTGLLHFR
FT                   KPDVSVQGEQVIVHPVDEREPVALGILHIPVCVTFSFYNPEDAEVNVKGDSADEIAIID
FT                   ATLKEELLRDGVLTVTLNKNREVVQLSKAGGLPMDALSLMNCCHKAYTITEKITDQILA
FT                   ALKQDALQRDKYAAVLSAENPREA"
FT   CDS_pept        131446..132315
FT                   /codon_start=1
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760200"
FT                   /locus_tag="AAL123W"
FT                   /orf_name="AGOS_AAL123W"
FT                   /product="AAL123Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50243.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG467264"
FT                   /db_xref="HOGENOM:HBG742904"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0000252400"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F51"
FT                   /transl_table=1
FT                   /translation="MCPITVDVCLFDLDGTIVDTTDAVEAAWQKVGRAHQVDAAKIRRN
FT                   SHGRRASETFKQYFPDADNDAAVKEFEHALVSQSHYVGLIPGANDLLLTLDRPSGCNPG
FT                   EVFRDNRWAIVTSATPSLARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQL
FT                   ADILGLNKDKVRAVVFEDSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQ
FT                   VCVMQNGPDGITLEITGSMEKGTSDAVFEEDEEDEAGDETNDDDDDDDDYNEDEYYDNS
FT                   DGDHGKGR"
FT   CDS_pept        complement(132428..133528)
FT                   /codon_start=1
FT                   /gene_family="HOG000197559" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777552"
FT                   /locus_tag="AAL122C"
FT                   /orf_name="AGOS_AAL122C"
FT                   /product="AAL122Cp"
FT                   /protein_id="AAS50244.1"
FT                   /db_xref="HOGENOM:HBG396597"
FT                   /db_xref="HOGENOM:HBG431219"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniParc:UPI0000252401"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F50"
FT                   /transl_table=1
FT                   /translation="MLGRFTRLLVATAQGYRYASNSASAKPIARSLRRSVLPDGPWKIT
FT                   EDKSHPLAHRVSKQMSIKPVTAITTSESYDLNKVIELLFQKGYQPVNLIPNEIVTFKYF
FT                   YEGLQGDVMVIGQNGSVVSWGFDEASHKQHILPLIDGARTNPLPQSLYESEDLDYVEIE
FT                   SKEEWSQISSLVNVSGLEQSFIKEDLIVVDRTSGDKDMLDKAAFSSGISRSTMLAVLER
FT                   NMEAHIESTRSFTELLSKGNRLNITEAEILKSTGRLFLMRGKLNLYSELIETPDLYWSE
FT                   PTLETIYKQVSRNLDVPARISILNKKLDYATDESRALMSVLNEKKSTRLEWIIIYLITV
FT                   EVCFELHHFYERFFGGKPDAHASLQE"
FT   CDS_pept        complement(133709..135775)
FT                   /codon_start=1
FT                   /gene_family="HOG000282027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760201"
FT                   /locus_tag="AAL121C"
FT                   /orf_name="AGOS_AAL121C"
FT                   /product="AAL121Cp"
FT                   /function="FMN binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50245.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269581"
FT                   /db_xref="HOGENOM:HBG736048"
FT                   /db_xref="HSSP:1AMO"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023208"
FT                   /db_xref="UniParc:UPI0000252402"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F49"
FT                   /transl_table=1
FT                   /translation="MALKFDKLDFAVICALALAVVAYLKLDVLKELFAADDSALAVQSS
FT                   SRDIVEVLRENKKDYLVVYASQTGTGEDYAKKFAKELAAKYSLNVMCVDVENYDFDNLN
FT                   SLPKDVIVSFFVSTYGEGDLPDGGLEFEEWLQVLEEGDLGNVRYTMFGLGNSTYEFYNG
FT                   AAEKTQKLLKQAGARMLGTFGKADDGAGTTDEDYMAWKDDILEELKDALALHEKEVSFI
FT                   SSYEYKVLPQDLMGSISLGEPNSQYLPGKTLAKKENMQLGPFDATHPYVAPITSTKELF
FT                   KKKDRNCIHVEFDLSGSNLKYSTGDHLGVWPSNPDEKVEKFLTTFGLDPTTIFDLKPKD
FT                   ITIKPPFPVPTTIGAAVRYYLEISGPVSRQVIGSLLQYVTEEQLKERLQALSKNKEKYA
FT                   KEITSKCMDLADALLYLSSGKKWTQVPWEFLIETVPHMQPRYYSISSSSSSDKQTVHIT
FT                   AVVENYPNPEVSSLGPVTGVTTNLLRHIHLTRTKEDIAASSLPVHYNLAGPRDLYQNYK
FT                   LPVHVRRSTFRLPSNPSTPVIMVGPGTGVAPFRGFIRERISFLKNQENVKLGKHLLFYG
FT                   CRDDADFLYHDEWPVYAKELGSSFELMVAYSRIPNKKKVYVQDHLLERENEVLELINKG
FT                   AFIYVCGDAKGMSQDVHRTLIDILRRGKNISEEESSEILKQFKTTGKYQEDVW"
FT   CDS_pept        complement(136161..137054)
FT                   /codon_start=1
FT                   /gene_family="HOG000113858" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624994"
FT                   /locus_tag="AAL120C"
FT                   /orf_name="AGOS_AAL120C"
FT                   /product="AAL120Cp"
FT                   /protein_id="AAS50246.1"
FT                   /db_xref="HOGENOM:HBG058086"
FT                   /db_xref="HOGENOM:HBG103871"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI0000252403"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F48"
FT                   /transl_table=1
FT                   /translation="MSDEAEAAETRSPLVCNVVRFVLSQCESQVRSTVLTKTRFTNAAR
FT                   DIAAAENITTTKYAKIFDEANAVLEEVYGFRLVGIPNKKSASNKASRTGDAEAADGDPG
FT                   STPITDLGFKGDRFILCSTIKAPPAYMQMVLDQSRQLYVKRLGSGQYEPGTETDHTLTS
FT                   QFDTDQILALQGIMAVVICIILFSKNNALEQELLTHLAKFGIPTDGYAVPIINMRIQDV
FT                   LSYMVRLEYIQRTAPAASETGALDSIFYSVDRRTQVEFPQESLVEMCQRLLGLEQTAVQ
FT                   SLRESIALSIGDAYSI"
FT   tRNA            complement(137152..137223)
FT                   /gene_name="tRNA-Gln"
FT   CDS_pept        137919..139532
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760202"
FT                   /gene_name="ATG18"
FT                   /locus_tag="AAL119W"
FT                   /product="Autophagy-related protein 18 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="pre-autophagosomal structure membrane "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS50247.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0034045"
FT                   /db_xref="HOGENOM:HBG058622"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0000252404"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F47"
FT                   /transl_table=1
FT                   /translation="MSRTGMPVINFINFNQTGTCISMGTSEGLKIFNCDPFGRFYSDED
FT                   GGCGIVEMLFSTSLLAVVGIGDNPSMSPRRLRILNTKRHSVICEVTFPTTILAVKMNRS
FT                   RLVVLLQEQIYIYDINSMRLLYTIETSSNPRGLISMSPSLENNYLAYPSPPKVINSGIK
FT                   SNANTNNIGISARSSIAEGGSEYLDKGTEPLTDSSKAGADLNSVKASTETTISPGKEHS
FT                   AGSGLNATSSSGTVKNGDVIFFNLQTLQPTMVIEAHKGEIAALALSKDGTLLATASEKG
FT                   TIIRVFSVETCTKVYQFRRGTYPTRIYSLNFSDDNEFLAASSSNKTVHIFKLGKPNAEN
FT                   SSAAATNSDDDEGEADSDDGADDDGVGDSDDTRSTVSIESFDNGSHQTREPIVDSSRKT
FT                   VGRMIRKSSQNLSRKAAKALGSYFPKKVTSILEPRRHFASLKIPIESGSNLKTICTIGE
FT                   PLTLDISDYPELFSGSRTMAQSASISANSSDSSLTRNSNFVKMIPIRVVSSEGYMYNYV
FT                   LDPERGGDCLLLSQYPLLMD"
FT   CDS_pept        complement(139712..140035)
FT                   /codon_start=1
FT                   /gene_family="HOG000213817" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930518"
FT                   /locus_tag="AAL118C"
FT                   /orf_name="AGOS_AAL118C"
FT                   /product="AAL118Cp"
FT                   /function="unfolded protein binding"
FT                   /biological_process="tubulin complex assembly"
FT                   /cellular_component="microtubule"
FT                   /protein_id="AAS50248.1"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007021"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG268725"
FT                   /db_xref="HOGENOM:HBG398009"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="UniParc:UPI0000252405"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F46"
FT                   /transl_table=1
FT                   /translation="MAPTQLEIKVRALQRLIKEEKYYQDELREQRERVELLKRDASVDP
FT                   YELKKQIEVMQDTERLLPRFYEKVQQFYNDLKDFVNGYNGDEDTADAHNALKLGNDLLA
FT                   SRK"
FT   CDS_pept        complement(140326..141369)
FT                   /codon_start=1
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624995"
FT                   /locus_tag="AAL117C"
FT                   /orf_name="AGOS_AAL117C"
FT                   /product="AAL117Cp"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50249.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG326130"
FT                   /db_xref="HOGENOM:HBG409872"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI0000252406"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F45"
FT                   /transl_table=1
FT                   /translation="MAYGQIVIGPPGSGKSTYCNGCSQFFNAIGRHARIVNMDPANDSL
FT                   PYQCDVDIRDFITLEEIMNEQHLGPNGGLVYAFESVEHSLSLFALQIKTLVKDENAYLV
FT                   FDCPGQVELFTHHSALSKIFQQLVRDLDLRVCVVNLMDSIYITSPSQYVSVLLLALRSM
FT                   LMMDLPHINVLSKIDMLSSYGDLPFRLDYYTEVQDLEYLQPHIEREHKGAKALRYRRLT
FT                   EAIGEVVSDFNLVAFEVLCVDDKQSMINLQSAIDKANGYIFGASEVGGDTVWAEATRQG
FT                   TAAIEYDIQDRWIDNKDFYDKEEEARRKKLLEEHELLEKEVDVNQDDEWERAVKEWESQ
FT                   HSVNFVK"
FT   CDS_pept        141614..142594
FT                   /codon_start=1
FT                   /gene_family="HOG000209236" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760203"
FT                   /gene_name="RPN8"
FT                   /locus_tag="AAL116W"
FT                   /product="26S proteasome regulatory subunit RPN8 "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="AAS50250.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG474324"
FT                   /db_xref="HOGENOM:HBG524656"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0000252407"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F44"
FT                   /transl_table=1
FT                   /translation="MSVNYEQVNVAPLVLLSVLDHYKRMNTPDNKRCVGVLLGDNSGST
FT                   IKVTNSFALPFEEDEKNPDVWFLDHNYIENMNDMCKKINAKEKMIGWYHSGPKLRSSDL
FT                   KINGLFKKYTQGNSLLLIVDVKQQGVGLPTDAYMAIEEVKDDGSSTERTFVHLPTAIEA
FT                   EEAEEIGVEHLLRDVRDQAAGNLSLRLTNQLKSLQGLQRKLRDIVAYLDKVNSGQLPAN
FT                   HIILGKLQDVFNLLPNLGSPDEEAPATKKDDVLASSNTLQKALTVKTNDELMVIYISNL
FT                   MRAIIAFDNLIENKIKNKKLQEAKRDPEPEEATKEEIQQQESAKA"
FT   CDS_pept        142836..144143
FT                   /codon_start=1
FT                   /gene_family="HOG000189335" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930519"
FT                   /gene_name="COX10"
FT                   /locus_tag="AAL115W"
FT                   /product="Protoheme IX farnesyltransferase, mitochondrial "
FT                   /EC_number="2.5.1.-"
FT                   /function="protoheme IX farnesyltransferase activity "
FT                   /biological_process="heme O biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS50251.1"
FT                   /db_xref="GO:0008495"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0048034"
FT                   /db_xref="HOGENOM:HBG058088"
FT                   /db_xref="HOGENOM:HBG397306"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR016315"
FT                   /db_xref="UniParc:UPI0000252408"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F43"
FT                   /transl_table=1
FT                   /translation="MPALCATYLIHSGNLRACLRIVPLTKPSVVIAYRHLSKSSSKIAP
FT                   AAALNTAPIEFTPNTSAASLHERSTVIKDAARSALRCNDTTPTPALPFDVKRVDKANRA
FT                   AGRKLPAASGVLSAYALMGPYIQLAKPRLTVLVMLSAICSYALSPYPATVLELLSLTVG
FT                   TTLCSAAANGINMGREPDFDRQMMRTQARPVVRGLVTPMQAYKFSAVSGVIGTAILYAG
FT                   VNPTVALLGASNIVLYSWFYTSLKRKHIINTWFGAITGAIPPLMGWAAASPLTHPGCWC
FT                   LAGLLYAWQFPHFNTLSHNIRNEYKNAGHVMTAWKNPKLNARVALRYSLLMFPLCFGLS
FT                   YYGITDWTYQIDSALVNGWMSFWAFKFWWQQRYNYSKKVYNNKAEFNKGMVLANVYARK
FT                   TFWVSVLHLPAVLILAIVHKKGRWDWLFSDEGKLVA"
FT   transit_peptide 142836..142940
FT                   /gene_name="COX10"
FT                   /locus_tag="AAL115W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F43 "
FT   mat_peptide     142941..144140
FT                   /gene_name="COX10"
FT                   /locus_tag="AAL115W"
FT                   /product="Protoheme IX farnesyltransferase, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F43 "
FT   CDS_pept        complement(144347..145843)
FT                   /codon_start=1
FT                   /gene_family="HOG000248845" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624996"
FT                   /locus_tag="AAL114C"
FT                   /orf_name="AGOS_AAL114C"
FT                   /product="AAL114Cp"
FT                   /protein_id="AAS50252.1"
FT                   /db_xref="HOGENOM:HBG146854"
FT                   /db_xref="HOGENOM:HBG397970"
FT                   /db_xref="UniParc:UPI0000252409"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F42"
FT                   /transl_table=1
FT                   /translation="MNFQAFVFCGKGLKLAPFSNTRGDKGMPKPLLPVANRAMLEYVLD
FT                   WCDQAQFKEINIVVDEGDEEVMQEGLAGFMQFREECYDVLSKNVGGFHTHYLRKPAPIQ
FT                   FIGAKSEFTGEILQQELLERITGDFVLLPCDFITNIPPQIFLDQYLNRDHDSLAMAVYY
FT                   QNAFENIDKKQIKKFFTVYTDNEDSMKQPVLLDIYSREDVEKTKYLKMRSQMLWRYPNS
FT                   TVSVKLLNSYIYFCSHELVHLLSTDDSAVAADSDGSDSEDEVGSRNPNQIRPSYFRNKT
FT                   KMVKDPMNGRKSFAKLFRDIARRSWQHSRPRETVSIFIMPDVGIFIRANNLSAYMEANR
FT                   YILKIKSASTSHTVPVTGSSSAIGADSVIGASCTILGKTNVKRSVVGANCKIGNRCRIV
FT                   GSILLDGAEIDDEVTLENVIVGKFGKVGKKTKLTNCYVEGYYSVAPRTVLKGETLANIY
FT                   IEGENEFDDSDMDTSSSEESTDQSEMYNEEEYEGDDLFER"
FT   CDS_pept        146140..147438
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930520"
FT                   /locus_tag="AAL113W"
FT                   /orf_name="AGOS_AAL113W"
FT                   /product="AAL113Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50253.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI000025240A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F41"
FT                   /transl_table=1
FT                   /translation="MSEEQDPLMAAMNGEDGDNKGASDNTGTGAATEAPKAAAPIAPEQ
FT                   EARNKALSQFKKKLLEHRRYDDQLKQRRQDIRELERQYEKTEQDIKALQSIGQLVGEVM
FT                   KELSDEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVY
FT                   NMTTFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTG
FT                   KTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAI
FT                   GGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDR
FT                   KIEISLPNEAGMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIR
FT                   DDRDYIIQEDLMKAVRKVAEVKKLEGKLEYQKL"
FT   CDS_pept        complement(147530..148444)
FT                   /codon_start=1
FT                   /gene_family="HOG000141977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624997"
FT                   /locus_tag="AAL112C"
FT                   /orf_name="AGOS_AAL112C"
FT                   /product="AAL112Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50254.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG103706"
FT                   /db_xref="HOGENOM:HBG252706"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI000025240B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F40"
FT                   /transl_table=1
FT                   /translation="MSEIYYVEEKTTSEPGVDENPILTHWLLKDDIRVCKHCRRTFEAS
FT                   RFSEYAAKQHLARYHTQVDETMSFTQYIQEFSPTYEWGVHKCRLHNERSFSIEFFKYIM
FT                   APSKWENELLYYDEHAVIIKDKFPKAQQHVLVIPRAIKTTLKHPTQLSITDKDKYQKHI
FT                   DWALNYIWHDFTSKYKLKPGSSSPFSSHEEFNSLAHFIANFTQVGVHSVPSMENLHIHV
FT                   MTTDFYSKSMKHKKHFNSFNTEFFVRWDRLPLAEVPNTDAMERRIRESELTCTYCKQGF
FT                   SNRFAALSRHLGEEFHCRFVPVK"
FT   CDS_pept        complement(148662..149543)
FT                   /codon_start=1
FT                   /gene_family="HOG000000986" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760204"
FT                   /locus_tag="AAL111C"
FT                   /orf_name="AGOS_AAL111C"
FT                   /product="AAL111Cp"
FT                   /protein_id="AAS50255.1"
FT                   /db_xref="HOGENOM:HBG058089"
FT                   /db_xref="HOGENOM:HBG203864"
FT                   /db_xref="InterPro:IPR014723"
FT                   /db_xref="UniParc:UPI000025240C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F39"
FT                   /transl_table=1
FT                   /translation="MSYKYISKAGDRFIKQLAGRTHKDRLAINAMQTKMYPEFMKPSLP
FT                   PAAEEEQFSGVRKWKFLPGDRVVVVKEGKFRGNISKVFSHDKKTNGYMLDENGPTRQVP
FT                   VPKEYWTEGQKTHMTLIPQAVRQEDIKLVADIDDPDAPGKVRTVAVHDIVFRGSYYDEN
FT                   YKKMMPYRCVAGQEDLVIPWPVPEQTADGALATDPQTAREQTFFVETAVRTPIPNAALY
FT                   TVRNHKSKYRRGTLTTRDIARLVAPKMPMTESEKAYAKQKEERANIPTHKLTDDDKEAI
FT                   GAKLYEHFTKNL"
FT   CDS_pept        complement(149837..150355)
FT                   /codon_start=1
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777553"
FT                   /locus_tag="AAL110C"
FT                   /orf_name="AGOS_AAL110C"
FT                   /product="AAL110Cp"
FT                   /function="calcium ion binding"
FT                   /protein_id="AAS50256.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="HSSP:1AVS"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000025240D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F38"
FT                   /transl_table=1
FT                   /translation="MSNIHRRANARVGSKNSNVDNGVLQKELLEEQKQEIYEAFSLFDM
FT                   NNDGYLDFHEFKVALRALGFEMDKRDILEIIDKYDTDGRRLISYDDFYLVVGEMILQRD
FT                   PLDEIKRAFKLFDDDHTGKISIKNLKRVVKELGENLTDQELAAMIDEFDLDGDGEINEE
FT                   EFIAICTDN"
FT   CDS_pept        150544..153288
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760205"
FT                   /locus_tag="AAL109W"
FT                   /orf_name="AGOS_AAL109W"
FT                   /product="AAL109Wp"
FT                   /protein_id="AAS50257.1"
FT                   /db_xref="HOGENOM:HBG058090"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniParc:UPI000025240E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F37"
FT                   /transl_table=1
FT                   /translation="MVKVGDRVKVRGLVGVVRYLGETKFAAGQWVGIELDEALGKNDGS
FT                   VQGVNYFRPSKRGGLYGLFARAETVVVVADGLPRSRLPKPLKTPSVDGGSRTASPGPTS
FT                   VASMATGRPRSRTTPSRDSGTSAGSQDNGTPLRMSASPRSSVPPPLLSGSPVLLPPLEE
FT                   TKLQKVVEKLQEKLYRLHLECKELKRRLEEQAQSEKVETLVRDVEVLAIAKVSLEEEKE
FT                   ELTQRLSSLEADYATVVGELGQYREEVELRRKIDLEEASRDDVGADVLWKQNELMKDAL
FT                   LQLEGSLEATNQLVVTLQEEKVQLAEDNNLLLKNIEELKNQLSDAQSTIDDLVAQVDAE
FT                   GNVSHIVESLTTQNLALTEQIDQLNKQLNEVSSKNEVTAELEQVYKEVERELLQQIHSL
FT                   QQKVEDDELVISRLTEKNDELEFLLESNQPTSVDDSIVDDLRNTIVILENDKCRLRLDA
FT                   EFLHEKIRARKPDPLKEYTYQLNYLAMLVGDNPSYEETPTIEIRITLVYLSAVCETIAG
FT                   LYSMKSIEEDSVDYIINAIPLDKWITRYQNGQNLNIDRYQIWLKLLDAHPLLEISANLV
FT                   YGTFLRLCVDVTPALLAILKGSLSTQEIQDIYGCFQTIEKILLAIIKENNLHERLMSFK
FT                   TLEVMPVLSQLFLIVDKLLQNDAAETVVSELQELQKIMAEAELELVEAPADATSEKSLD
FT                   DLPPEEHTPPEVMIRLQKYEEMLQEKETAIEELMLKVRVLDIKNEKTKEHENTIMKLRG
FT                   ELDELKEKNQSLLKKSDELQKTSALLEERIQKERANRYTLISTKGYSELLEEKLKMEKL
FT                   DLISEISDLRKVIRSLEHVETPDSLSWLKESLTMEKMRSPPIRTKVNELLNVLQMSVRN
FT                   CDVLPISGPQHEWQPKHKIVKYHLSTLVEREALIKRMTNNIYT"
FT   CDS_pept        join(complement(154656..154678),complement(153310..154600))
FT                   /codon_start=1
FT                   /gene_family="HOG000203293" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777554"
FT                   /locus_tag="AAL108C"
FT                   /orf_name="AGOS_AAL108C"
FT                   /product="AAL108Cp"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /protein_id="AAS50258.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="HOGENOM:HBG027797"
FT                   /db_xref="HOGENOM:HBG315887"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013234"
FT                   /db_xref="UniParc:UPI000025240F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F36"
FT                   /transl_table=1
FT                   /translation="MMAAMNIAMVCDFFYPQLGGVEFHIYHLSQKLIELGHSVIIITHA
FT                   YGDRTGVRYLTNGLKVYYVPYLVLYRETTLPTVFASFPIIRNILLREKVELVHSHVSVS
FT                   TLAHESILHANTLGIYTVFTDHSLYGFESIGSILVNKLLKFTLTCVDQVICVSHTCKEN
FT                   MVLRAEIDPSTVSVIPNAVVGKDFKPLEADRRVATGRTTIVVISRLFPNKGAGLLTHLI
FT                   PRVCEMHSSVDFIIAGDGPNFVHFQQMIESYRLQDRVQLLGAVQHENVREVMCLGDIYL
FT                   HASLTEAFGTVLVEAASCGLLIVTTKVGGIPEVLPENMTVYASETSVSCLVEATNKAIG
FT                   ILREKKVDRMAFHEQVSQMYDWMDVARRTVQVYAKCQRNPANKDWNVMLKKYYHRDKVW
FT                   ARTLYTLCCITEYILWYVLEWWYPRSEIDIAPKWPKKV"
FT   CDS_pept        154776..157184
FT                   /codon_start=1
FT                   /gene_family="HOG000074725" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624998"
FT                   /locus_tag="AAL107W"
FT                   /orf_name="AGOS_AAL107W"
FT                   /product="AAL107Wp"
FT                   /protein_id="AAS50259.1"
FT                   /db_xref="HOGENOM:HBG058092"
FT                   /db_xref="HOGENOM:HBG203862"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="UniParc:UPI0000252410"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F35"
FT                   /transl_table=1
FT                   /translation="MISDSNRACRPITMQINRGYIAVAGDDESVQEAPGLGRSQEGGGQ
FT                   PHGLLPSEPPSYGEAHSELEGQGSQFEMEFSDLEGDSYQGRFQKLREQFKYKVLDRVRN
FT                   RIIDPLGYLMQFLSEKTDYYLSKVGNPLLLRRFLYILVMSAMMYYVMISGLLPNNHNTG
FT                   MHGMFSDQQQLIEYARRCVNFAKMEEDLEYLSKMPHMAGTKGDMAMLNYVKSSFSNNGL
FT                   KVIQRDYQTYINYPGPVSTEIFKDGKSLFSFSLTEENFCPLSPVGSVEDASIIYAHRGT
FT                   RADLERLRDAHLLDDKTVLLMHYGEVVADQVFLAQEFGAVGILFVSDPYGTDENVIQRM
FT                   PVGLPQYGTGNPLKPSAAEDPSSKLNGKDTAAIPKIPIIPLSYKQGRQIQEVLAHSEQT
FT                   IKFRNGWYTGTLKDIKVNMKSEPKEREDHHSWTVFGKIDGREQNDKAILVMASRDSIGY
FT                   GASYPNYGQMMLLSLVELFQQIKYKFDWKPLRNIYFVSFDASVYNSADATELLWSGVDK
FT                   HKSRIYSVIDISQLGLESDGKKQLDIQAHALVQALFSQEREKFGFDMQVRDVEQYGDWT
FT                   PFMANGIPVAVLSSRNVVERKLPIFTKHDTFEYLSKTVLQNNGWVNTGDLLLVVFQALL
FT                   KLADDPLIPFDILTYADDLSHHLEDLERMAEGQDLVFTQVKEGLSIWRKLGEDWNVWRS
FT                   TWNRIVMIDNNGIEPSILSIERWTQNKKLSNIAARQFHRQGLPGRAFYKNIIFGPSLYL
FT                   SDKFHSWSFPAVRDAIQSGDMTRAHAALKYLATILKISAENYQDETLNL"
FT   CDS_pept        157434..157895
FT                   /codon_start=1
FT                   /gene_family="HOG000187840" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930521"
FT                   /locus_tag="AAL106W"
FT                   /orf_name="AGOS_AAL106W"
FT                   /product="AAL106Wp"
FT                   /function="heme binding"
FT                   /protein_id="AAS50260.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG265461"
FT                   /db_xref="HOGENOM:HBG715794"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="UniParc:UPI0000252411"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F34"
FT                   /transl_table=1
FT                   /translation="MSFVKNMLFGGVATSEDPTGLTQDANGEVSKGQSSVEEPIVEGKF
FT                   FPRTLYKFNGHDDEKIFIAVRGKVYDCTTGRQFYGPSGPYSNFAGHDASRGLATNSFEL
FT                   DAVKHWDQPVDDLSDLSEQQLEALDGWAAHFEKKYPCIGVLVPEPGVNY"
FT   CDS_pept        complement(158057..158698)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760206"
FT                   /locus_tag="AAL105C"
FT                   /orf_name="AGOS_AAL105C"
FT                   /product="AAL105Cp"
FT                   /protein_id="AAS50261.1"
FT                   /db_xref="HOGENOM:HBG058093"
FT                   /db_xref="UniParc:UPI0000252412"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F33"
FT                   /transl_table=1
FT                   /translation="MRAPPQPRKSRHRLMLQVLRKFHDTVGLQKVRSRWHLHKVHKVSR
FT                   ANGRASTCNKKADGNKKKHGDIPLSPIRLEDIANQPSGIETPKKRRMPLLIASFPRGCA
FT                   KSPMFNVLEKNKRSKLLLSRRKYKLKTFNGGNDVGMANGKTPRVHAVKREVIQHAHMKV
FT                   NYHRKGVVNSTCVLVDSQSKRRPEYLTFGQAYSLRLNDYPSLSIRHPVNV"
FT   CDS_pept        complement(159175..160932)
FT                   /codon_start=1
FT                   /gene_family="HOG000248843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760207"
FT                   /locus_tag="AAL104C"
FT                   /orf_name="AGOS_AAL104C"
FT                   /product="AAL104Cp"
FT                   /biological_process="mRNA transport"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50262.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG397973"
FT                   /db_xref="HOGENOM:HBG435159"
FT                   /db_xref="InterPro:IPR005637"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI0000252413"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F32"
FT                   /transl_table=1
FT                   /translation="MNGFGNVNQLSTLAAQHQEQSRSKIAVRGWQNATQQDLLNFVARK
FT                   TRIGIQDSYVQGGQIIGFVNKQDVPALLKFNGIRFAGNALKFEKLDEDGTGATTSNTIT
FT                   LLRNFLMKRYNVQTKMLDLGGLYADPDLTQHGLVSSMSTQSKMFMALMKLAGSEPQLVV
FT                   ESVNLSNNGLKDVNSITSLAQTFPRLRNLCLANNQIARFQSLEVWKNKFRELRELLLMN
FT                   NPVANDPMYRSEMLRIFPKLVILDNNLVRDEQRLNALYSLPMRLQQFFFENDTLGSSAI
FT                   DFVTNFLRLWDTDRKQLMALYTPQSQFSVSVDSSIPAATVPEADQSPSFGHYLPSSRNM
FT                   TKVSSEKSKQERLGMGPDAIGNIFKALPGTKHFLQEQPEKYSLQTWTYSQVGGFVITLH
FT                   GFFEEVSKPEVENTKSYSYNARHRRYNHGQQNSAQNKLSKKSFDRTWTIVPTQGSVIIA
FT                   SDLLTVRPYAAGAWIRVDEPKKTPTADVSQGAQPVAVPAAGPQIPGPPLTNTMVPQPMG
FT                   IPSTLQLPPEVQAKLSPIQLQLLNRLHQDTKLNAEYTYMLAEQSGWDYDVALKSFQSSV
FT                   NNLPRNAFV"
FT   CDS_pept        161381..163390
FT                   /codon_start=1
FT                   /gene_family="HOG000248842" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760208"
FT                   /locus_tag="AAL103W"
FT                   /orf_name="AGOS_AAL103W"
FT                   /product="AAL103Wp"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS50263.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG058094"
FT                   /db_xref="HOGENOM:HBG397975"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0000252414"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F31"
FT                   /transl_table=1
FT                   /translation="MTLNYEYDESDETWPFFLLTVLLMVLVPATVVQLYRAVRRNVGAR
FT                   DITELQRIQQKYSGAAVQDYQRKHRGQGPADVIFSKRSALIIVGWVLVSYLVNRIASNE
FT                   TLHDSYKNVFDPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQY
FT                   VLITKAYKALTDDATRDNFLRYGHPDGPQSTTHGIALPKFLIEGSGSPLVVVTYFLLLA
FT                   LVLPGLVTRWWANTQSYTNKGLNTETASYFVDKLFNNKPSETVDEATIMNWLSHAKEYR
FT                   SKYPGLTAEAIEGIFQDHIHRRHSGPLEGFKFDIIAKSAVLLHGLLDIAASCRNTEICI
FT                   AVIETSKSIVQALPASPNAQILQLPNVEKDRFLANSKGENVHTIGKLFTFDDNKIGKLL
FT                   GIEDPATLKETLYVASQIPHLKVIDAQFKVPGEASVTPSSTPHIVVKVLVRSAKHKMIP
FT                   ATLIPNEKLQESEDFGSLRDPFAVVNEQPLVPATFAPYFPTERHGGWCALVVLQKDGKI
FT                   IQTPLVMTRLSFANLAKDFDKRTVQDLDAEFNPDDWEVGTIKIPLAQPAPPEKGDYFFR
FT                   IIIKSTEYFGGDLDFTMPMQVREPVKEDELDDTASIGDDTAQEDSDSDEENELDNEDSD
FT                   YTDIDTDTEVEDNITTADSVGESPDETEKLTAEE"
FT   CDS_pept        complement(163463..163942)
FT                   /codon_start=1
FT                   /gene_family="HOG000238056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760209"
FT                   /locus_tag="AAL102C"
FT                   /orf_name="AGOS_AAL102C"
FT                   /product="AAL102Cp"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="AAS50264.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG397974"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI0000252415"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F30"
FT                   /transl_table=1
FT                   /translation="MSRELVTVDEVYPTAVGTFDVIVKKSSQKEYSDEFGKELFSSKKD
FT                   DKSTLYSQLAFYGEVAVGAVKARIQDMRGHSAVVIDTLAVLEAYRGKGVGTKLLDYVEK
FT                   ETKPFQPRAIYVTVAASATGELQWYQSHGFELLGDKSGSCENGSQAERNLVKWLV"
FT   CDS_pept        163988..165067
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930522"
FT                   /locus_tag="AAL101W"
FT                   /orf_name="AGOS_AAL101W"
FT                   /product="AAL101Wp"
FT                   /protein_id="AAS50265.1"
FT                   /db_xref="HOGENOM:HBG058095"
FT                   /db_xref="UniParc:UPI0000252416"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F29"
FT                   /transl_table=1
FT                   /translation="MRKTVSSTFTPFIKLRRLANIWEQPSVATEGMLRHARGYSVARRA
FT                   SQGLRAHDVRGMESMQAKIVEFRTNLKRILALNKIPTDGSPEYTVLLTSCREAGVAEEL
FT                   PLLQKMPILRSKLRDDPFSNAAVRRIINTIEHGQKHARMQAPFPESEFKNTHCRDKATD
FT                   GSPGDFDQGTSLSAKREQDLKIIQDLLRPVTSPAAPVRKYDWNIQGKKQRPMVKYGDLL
FT                   PFGNDYRKTQRYRFKYMSLLRDGGENKSSSLETLIYDITRHSAQVTTNETSSLYSIDNK
FT                   DLFTLINGSSFSPEEMLEVIDRHTAQGWKLVGEVRGEPTKVVFQRKQRTEKPEMRLARV
FT                   IYTTGALVAGGLLMSYFYI"
FT   CDS_pept        complement(165123..165695)
FT                   /codon_start=1
FT                   /gene_family="HOG000074723" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760210"
FT                   /locus_tag="AAL100C"
FT                   /orf_name="AGOS_AAL100C"
FT                   /product="AAL100Cp"
FT                   /protein_id="AAS50266.1"
FT                   /db_xref="HOGENOM:HBG058096"
FT                   /db_xref="HOGENOM:HBG395749"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="UniParc:UPI0000252417"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F28"
FT                   /transl_table=1
FT                   /translation="MPVTKSLSKLQKGMKNKQHTIHPKGRKLQQLNKATIRDEKIQTKK
FT                   RAHNEKRSNELARVKFIQDAINVEQLKEQLTFTHEQCLLLIREFIGRDDDELEELKKKR
FT                   RANRPPTSRHQLLEAKKRLELEELRTGFLCPDLTDADNVAFLRRWNGTFGALATLKLVR
FT                   INERAERVVGGTKPVAQPAAAADVHME"
FT   CDS_pept        complement(165813..170207)
FT                   /codon_start=1
FT                   /gene_family="HOG000194392" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777555"
FT                   /locus_tag="AGOS_AAL099C"
FT                   /product="AAL099Cp"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /biological_process="translesion synthesis"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="zeta DNA polymerase complex "
FT                   /protein_id="AAS50267.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0016035"
FT                   /db_xref="GO:0019985"
FT                   /db_xref="HOGENOM:HBG058097"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI0001DB26FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F27"
FT                   /transl_table=1
FT                   /translation="MVKLCSLLHQRKQAFYVMSQTSNHNLNSSEGNEDLIQIQWSDYDC
FT                   YQWPPTSLDPKHSLSWPGKAFSTVPIIRFYGKLTSGHNILSHLHGALPYLFISCDAPPD
FT                   ELRYNSKATCHRLHVLLELALLNTSTKSHGSESAKQSDSTEDNIECLRYVANVSVVKGV
FT                   PFYGFNVGWSVFYKISLLNPRFVTLLANKLRDGSILGRSVSVYEAHIPYLLQTSADFNL
FT                   YGCAYLNLTDCYFRGPVLNNLHNIDEYHQSDAVHTFLKRFLRPDNTLPREFERFGTGLL
FT                   EIDILPQFIANREELEYRYIHHDFIDALRAPANPNKKYLVSTNYVWKDVTWLRESKELG
FT                   PYLPPDELQGVETRPPWDFEELERFHQLAKQQNCDGNPKNLSFATFIDNSWFYENIKTA
FT                   SETISELWPKPLNGKQKIVALPDDEDNEEPLISTIDSVDIERLLYSTPKLKRVKAQHGL
FT                   LMRDDRVMNINPQSNKKHKSYTRESKLPVYRYKSPPISYADMSDALEANGEPAVDYQGP
FT                   YYSNPVDLPKGKDNTTHKYNIESDHISCREWVSFGDEVEFYRRKLTGSPAKVNHWVYIP
FT                   KPPKYYEVLKQPPDSPETSCIDGPTQSQQSAPSQQAPPNMSNEARESGPQLLHLSMEIH
FT                   VDTRRNMLPNPRTDEIKMICWSIDGPQSVGTMELSTDGLLVSLNENDAIYKRIIEEACG
FT                   KTRVAFFTSEYELITEFAKLVLIIDPDILSGYETNKSSWGYILARAELSHNIDFGLLIS
FT                   RLSRDDRSGLASEWNYSHSAGIKIAGRHMLNVWRKMRTEVNLAKYNIENVAYHLLHERL
FT                   PKFTHETLSGFWRTKSDRTSIKIVINYCLERVRCNIRLLNLKQVISRTVEQARLIGIDF
FT                   YSVLSRGSQYRVESVLARLAKAEHLMLISPGKGDLRHQRALECVPLILEPDPTFYTSPV
FT                   LVLDFQSLYPSIIIAYNYCYTTILGRTREMTAGENKIGITTNILKPNILQLLGDNITIA
FT                   PNGVTYVKQNIRKSILAKMLSDILDTRVLLKRTISDMHNGSKRLLSTLDNRQLALKLLA
FT                   NVTYGYASASYSGRMPCSDIADSIVHTGRETLRAAIQMIEKEDKWGARVVYGDTDSLFV
FT                   HLPGKSREQAFKIGAAISDAVTAANPNPIKLKFEKVYHPCILLSKKRYVGHAYEHASQE
FT                   VPRYDAKGIETVRRDGHPAQRKIIQRSLEILFRTKDLSQLKAYIVNQFWKIMTGSVPIG
FT                   DFCFSKEVRLGFYKSEAAAPPAAQVARRMMENDSMAEPQYRERVSYVVAKSRPGTLLAD
FT                   RCIAPQDFLADPRLELDAEYYITKTLIPPLNRLLQTVGLDLFDWYREMPRPSSYKHVGS
FT                   GASDTLHHVLKSNRCLCCKREATTKNGLQLCDSCRTSPSESSVALLLDRRTRESRFNRA
FT                   LRACRVCCFPLTKDLLAAPEIGPNQCQAHDCPVFYTRKKYEGLLSDPSWHSAHRALQLL
FT                   DDW"
FT   CDS_pept        170288..170806
FT                   /codon_start=1
FT                   /gene_family="HOG000034148" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081820"
FT                   /gene_name="ATG29"
FT                   /locus_tag="AAL098W"
FT                   /product="Autophagy-related protein 29 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="pre-autophagosomal structure "
FT                   /protein_id="AAS50268.1"
FT                   /db_xref="GO:0000407"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058098"
FT                   /db_xref="UniParc:UPI0000252419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F26"
FT                   /transl_table=1
FT                   /translation="MNSKNTIVYVKVPGRQREGFVDPPPFEWNQHQDRKLWAHISTIED
FT                   KDDIDWQLLSNQTNAPEFFIRKRVYQLFRVHLKSIEQEIYSHTSADRAPNRSSQAGDEP
FT                   AASVGVLNGYGQNINDIHDLSSLQTPPTCRGKANKDEDGGNSSGISELSSLSVSKSALE
FT                   EALMDRLQL"
FT   CDS_pept        complement(170783..171889)
FT                   /codon_start=1
FT                   /gene_family="HOG000141976" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760211"
FT                   /locus_tag="AAL097C"
FT                   /orf_name="AGOS_AAL097C"
FT                   /product="AAL097Cp"
FT                   /protein_id="AAS50269.1"
FT                   /db_xref="HOGENOM:HBG058099"
FT                   /db_xref="HOGENOM:HBG203868"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000025241A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F25"
FT                   /transl_table=1
FT                   /translation="MEPAHIQIQISELFEVKLTDYGGRACFARQSQQRGDTVLKLTQAL
FT                   GSSIAYEYRKEVCHFCFAYDAGAVMKTKIGHAEARFQPSITGASSFGGGGLRFCSEICK
FT                   NAYMQMESAEELVEAFETLLQAFQRSNKRRNTDLQDDDCGNAVITEAIIEERWRYVENE
FT                   WTPKLSAMKPSKRHLMIPAIDEEVYSCARFVTECLFRLKHLPNESTMYQAFDQLQSNEL
FT                   QKITEFPVLLEFQLKVYKFLKVVLPIGLRDLLSSALFRKILGSEYGNSFGIWEQNEGNY
FT                   SRDYLGYWVLPEASYFNHSCAPNLAKKRVGREMYFVLTSDVAAGEQLCIDYKGILDLPV
FT                   VERRNILHSNWFFDCACERCALELQSIH"
FT   CDS_pept        172280..173191
FT                   /codon_start=1
FT                   /gene_family="HOG000157237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760212"
FT                   /locus_tag="AAL096W"
FT                   /orf_name="AGOS_AAL096W"
FT                   /product="AAL096Wp"
FT                   /function="thiosulfate sulfurtransferase activity "
FT                   /biological_process="sulfate transport"
FT                   /protein_id="AAS50270.1"
FT                   /db_xref="GO:0004792"
FT                   /db_xref="GO:0008272"
FT                   /db_xref="HOGENOM:HBG289502"
FT                   /db_xref="HOGENOM:HBG709927"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000025241B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F24"
FT                   /transl_table=1
FT                   /translation="MSLYSLITPKAFSELLHRNTGKRIVPVDATWYMADKERDLAKKEF
FT                   MELERIHNAIFFDIDVFMDQKSPYPHMLPSLETFNEEMGKLGIREDDILVVYDRCSNFS
FT                   ASRAAWELTTLGHETVFLLTGLNAYKEEGYPLDITQVDSVTPYEPTSYTSCTSHAKEQV
FT                   ITYEELHHLVETGEIKHYNFFDMRTLPRFLGEAPDPRPGVPSGHVPGAQPMPYAEVLEG
FT                   GNYSNTVEGIQSRIAASLSEHGTRLDCSKHSIVMCGSGVTACTVKTAFEACGYVPVRLY
FT                   DGSWSEWGRRAEPRYIAIGRDW"
FT   CDS_pept        173532..174869
FT                   /codon_start=1
FT                   /gene_family="HOG000231935" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760213"
FT                   /gene_name="CLP1"
FT                   /locus_tag="AAL095W"
FT                   /product="Protein CLP1"
FT                   /function="ATP binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50271.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG211231"
FT                   /db_xref="HOGENOM:HBG396677"
FT                   /db_xref="InterPro:IPR010655"
FT                   /db_xref="UniParc:UPI000025241C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F23"
FT                   /transl_table=1
FT                   /translation="MSAIQSTQELLQPIGFDTPVAESKTVLLSPGKEWRARIPAESKLT
FT                   IKIVYGIAELFGTELANGVEYTIQCANIAVYSVDHVKLEWKSLDELETTVSPDTNMPYL
FT                   YNLHFALEKMRLSSFDGPRILVVGKASSGKTSLCKILCSYALKSKAYTPIYVNLNPQEG
FT                   AFSPPGFLTATPISDILDVESTMWGQSMTTGATKLHNKQPMVKNFGLEMIAENRPLYME
FT                   VLGQLAQTVDGRLKNDPLVRRSGVIVDSPPLQHLDESYTELEVAITKFNIKTLVVCAPD
FT                   DSLAVELSDRFQTLVRSIVRIPTSRGICNIDDVARRALQRSQIREYFYGNGSTVLSPYT
FT                   IGVDLLDAVVWRPKSSLTIDMSKTSPNMVELERVEVTAANLQHALVAITYAPRKSTAEE
FT                   VFRSGVLGVALITEVNDAKRKMRILLPVPGRLPDKAMILTAYRYLE"
FT   CDS_pept        175139..177139
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930523"
FT                   /locus_tag="AAL094W"
FT                   /orf_name="AGOS_AAL094W"
FT                   /product="AAL094Wp"
FT                   /protein_id="AAS50272.1"
FT                   /db_xref="HOGENOM:HBG058100"
FT                   /db_xref="UniParc:UPI000025241D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F22"
FT                   /transl_table=1
FT                   /translation="MAPSEHQIYQHIQLTKWYDPHDVSSLLLVLFYALGTIAIKPDILL
FT                   RVLDPTGIRSIYAYEKDLDLNATIKLPNLECLVQFLIDADEEAAALTLIAALEQIPSMH
FT                   GLIQLLTFFKNRVVIDSMCDIPDPYFKRGISKKSVFYMLLSRKFRGFTDIYLSGDMTQK
FT                   WRELHSYRAQFKTTKLWQAVNTKLPQKSAFLGKVFNESDDNTLPLPTIQTGEEEHHVYP
FT                   WILTTRERYEQLVNMELTKLNSCTNPDLSIAEELVRYTSLNQKTTFPSVLMVQYTISLL
FT                   NKNYQESQDLLFRIFDYAGSSFESSQTYDSASGPLFNSFMLSHLFRACGTPQAAVKRIE
FT                   NVVKLVREHGSLTGVQPMLYSLFIFLKDYPHLSDNLQSAVAQLKKYFENTARNSLNSIK
FT                   FLYSIESLLQLTYDAHIPQGLANAYKTRMLCMLDDKSRHIESVDPFIKTTEIWNRIGIE
FT                   EIPPCYATYANTSSDFSNYRGAYSEVVQSLVSGDDAPLYSLDIGAWPYSEQQKVKQLKI
FT                   RYLKKLGELDEAMNLVNVYIEDTRSKIIDKFWEFEFMKEKVYLLFECGMAARSINFITE
FT                   MIGTAEKAKNAYQLTQCFILLSTALVALRKYDMAVQLMRGNMYTVFQFGQRELEKEFMN
FT                   KYIEAMRNATCQTKGVTIDQLQVLQSKYMAA"
FT   CDS_pept        complement(177136..179340)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624999"
FT                   /locus_tag="AAL093C"
FT                   /orf_name="AGOS_AAL093C"
FT                   /product="AAL093Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /biological_process="reciprocal meiotic recombination "
FT                   /cellular_component="MutLbeta complex"
FT                   /cellular_component="chiasma"
FT                   /cellular_component="synaptonemal complex"
FT                   /protein_id="AAS50273.1"
FT                   /db_xref="GO:0000795"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005712"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0007131"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="GO:0032390"
FT                   /db_xref="HOGENOM:HBG124185"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000025241E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F21"
FT                   /transl_table=1
FT                   /translation="MRGMAAPKIHRLEESVFLRLRSQLSIVSVGAAVRELMQNSVDACC
FT                   GRLEVSVDLDRWRVHVRDDGEGLNREELAKVGQWHYTSKLRRLEDLTATDTYGFRGEGL
FT                   YMLSNISRVILLSKRAGMKHAALHRLPATDNALPRDSDDIRLLDGAHGTTVILEDLFYN
FT                   LPIRRRMLARTPPHRLYDEIRADVLQLLLFCQTLQVSVLVIKNNQEKQIVRSGNLTQLT
FT                   FPDTLMAVLMCCLGPVVAAKDLQYVSAKYQDIEVQGVISTVGVPSKDYQFIYINKRRYE
FT                   DKRFIFGFNKLFRSARYKEDNMLAASTRGGQQAYSGYPVYLLVCKGPPSISDLLQNPSK
FT                   VIENLEYGRVLQPLLCQVAKSFLRHYGHATVSFLDRKMTRNRLRAELPLPIQGKTDQDA
FT                   PESSLHSGTDARHLLNGGINPVNQHPKRKKYNPPVASMNSSADATKILEHVAKIRTRNI
FT                   NVGLPVQKPVGSGSISSSLAFSDEHLSVDSIQLKDCIVINQIGNKFILLKLEPSRSRTT
FT                   PLLLILDQHAADERVKLEAYTRDYLFTLLTAQPSFYTTPCSIAMDLTHTEADILLHYKR
FT                   EIEFWGFEICYKDEYTGPLYLKAIPTLFDAKKKNDVHYLKRALLQYAYDLKSLKKTKIT
FT                   SIEADGYVTKHLNEFAWWKYMNAIPTVFLEILNSKACRSAIMFGDKLNHDECLFLVRQL
FT                   STCNMPLRCAHGRPSVIPIADLKGLGSIVFESYIEDYRIT"
FT   CDS_pept        complement(179804..180406)
FT                   /codon_start=1
FT                   /gene_family="HOG000144431" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760214"
FT                   /locus_tag="AAL092C"
FT                   /orf_name="AGOS_AAL092C"
FT                   /product="AAL092Cp"
FT                   /protein_id="AAS50274.1"
FT                   /db_xref="HOGENOM:HBG058101"
FT                   /db_xref="UniParc:UPI000025241F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F20"
FT                   /transl_table=1
FT                   /translation="MKFTSSILLACVSTFGTVHALYSNKTTTLAPMGGNQEYLVPNSVS
FT                   TVVNDDDTTSTITLFRTITLDLPLTSASSSASSSATPYSSYSGSASSSASAPASSPASP
FT                   SASPSSTTANCTSSTEQTFSTSSTQLYTTWTLTGSAGPLVTSSAYDKYVVYASAACTEK
FT                   TVTVTEYAATKYVTVAASAMPSLAPLSGYYSNSTATH"
FT   CDS_pept        complement(181243..182034)
FT                   /codon_start=1
FT                   /gene_family="HOG000093572" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760215"
FT                   /locus_tag="AAL091C"
FT                   /orf_name="AGOS_AAL091C"
FT                   /product="AAL091Cp"
FT                   /protein_id="AAS50275.1"
FT                   /db_xref="HOGENOM:HBG271741"
FT                   /db_xref="HOGENOM:HBG346941"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniParc:UPI0000252420"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F19"
FT                   /transl_table=1
FT                   /translation="MGAENSCRLLGPVALFIQFFMAAVAVGGLLVKRQYEHPKRTWRVW
FT                   SYDVGKQMIGSAGIHLLNVLLSIMKSQGLLGTLKKTDDQCDWFFVNLLMDTTVGIPILW
FT                   CWLVLIHKGLQALGVQNIESGNYYPTLDKPEPGAAVPRTGPMFSAFVKQLLVFVSGLAM
FT                   MKVCIFLLLGCFEQLANLFADLVLGWSDPWPNLQVFLVMFVFPVLLNCFQYFCVDNIIK
FT                   LPSDRLTRQNVDNFDQESIFEQNGVYVPTLLAAAKQTYLAV"
FT   CDS_pept        complement(182217..184064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777556"
FT                   /locus_tag="AGOS_AAL090C"
FT                   /product="AAL090Cp"
FT                   /protein_id="AAS50276.2"
FT                   /db_xref="HOGENOM:HBG124186"
FT                   /db_xref="UniParc:UPI0001DB2717"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F18"
FT                   /transl_table=1
FT                   /translation="MSSEQDSVKNWLSDTPGRRSGQSEMDYEEVLFGLEPLINARSAAE
FT                   LLELELAGLEQCGAVLDQLAVHLRAPANRDLVRESGLLRQLLRAQALVFEAAFQGGGSS
FT                   DALLQVGSELVRCAANAMVDNDDNRREFHSLAGADGHPLLEHYLPKVLQMGEREGPVGA
FT                   LKMRAIAMLQNFCLDSPEYRLQCAQTVPGPLIACLREMGDAYMEEDAALALKLGLELLA
FT                   DLAEDYASKATLDELEFLASLLCRMASACESADPEAAAESEGSEDSGADALQALCGVVE
FT                   AIADKSAALDLSDKERCSALQRALFDSLDALHAKEFPNKLIVVRRITSSIGYISANEKC
FT                   PNRHMRTLCYSVLERSQDGYALCGALFVLANSISGRSDVDEVLAQVPLQRQVRVARGFT
FT                   DPVQFQSFLDLFRKCLNLVTALTFSAEHQDALFSVVRTCHDQARYYAGLAPLVDSFLNK
FT                   LLAIFPGAALAAHGAVLDVAAERGGISACLLLEKVSKVPGVAPETFARLLDAIFKFQES
FT                   ANGGVSLQHLFHVTRALGVYLHDTDARSSQLLLSQYSDKLTLLLSSVLSLRDKDDPAAT
FT                   SVLNNAKFMAGMVWNTSQNTPELQGQDMADLVKAAKALL"
FT   CDS_pept        184563..185549
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760216"
FT                   /locus_tag="AAL089W"
FT                   /orf_name="AGOS_AAL089W"
FT                   /product="AAL089Wp"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50277.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252422"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F17"
FT                   /transl_table=1
FT                   /translation="MMDKLDLDQLPYYDPRVERKVALVTGGNSGIGWYTVLHLYMHGFI
FT                   VYVGGRNSSRVHKAIKEIKQEAENRLETARQDPHDELERCLGELRYLPIDLTDLRSVEK
FT                   AAKKFRAQESTLDVLINNAGVMALPYELTHDGFEVQMQTNYVSHFLLTMRLLPYVKRSG
FT                   GRVVTLSSIGHKIQFTYCPLDCHFDYRPNIFFTWLRYAMAKTAAIQFTKMLAIKHPDVM
FT                   CIAVHPGLVMNTNLFSYWTRLPIVGIIFWIFFQIVGFCFGVSNEEGSIGTLKSALSPAL
FT                   TLERDNGKYFTTGGVESRPSSVANNLDNAASTWIWTVHQLRDRGYEI"
FT   CDS_pept        185827..189141
FT                   /codon_start=1
FT                   /gene_family="HOG000216621" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625000"
FT                   /locus_tag="AGOS_AAL088W"
FT                   /product="AAL088Wp"
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50278.2"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG014191"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001DB2718"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F16"
FT                   /transl_table=1
FT                   /translation="MSTVNSKGSKSSKGSKGLVLENTARRDTLIAIEKKYQQLWQEERL
FT                   FEVDAPTLEDEPATVDSEELQRRHPKFMATMAYPYMNGVLHVGHCFTMSKVEFSVGFER
FT                   MNGKRALFPLGFHCTGMPILACADKLKREAEMFGEDFANAPAAEEEEELEVREDSKPGS
FT                   EDVTKFKAKKSKAVAKQGRSKYQFEIMMQLGIAREDVIKFADAQHWLTYFPPLCEEDCT
FT                   AIGARVDWRRAYITTDMNQYYDAFVRWQMNKLREAGKVKFGERYTIYSERDGQACMDHD
FT                   RQSGEGVTPQEYVGIKIEVLEFAAEAQEIIDNSGLDKSKKIHFIAATLRPETMYGQTCC
FT                   FVSPTLQYGVFDAGDSYYITTERAFKNMSYQKLTPQRGYYKPLFTIEGKKFVGSKVQPP
FT                   LSVYKEVRILPMENVIASKGTAVVTCVPSNSPDDYMTTQELKNKPEYYGIKPEWIDFEI
FT                   LPIISTEKYGDFIAKAICEEMKIRSPRDIIPLAEAKKLAYKEDFYNGVMIYGPLKGTKV
FT                   AQAKNLVRDQLIAEGKAFIYNEPESVVISRSGDECIVSLEDQWYLDYGEPTWKKQAEEC
FT                   LEEMCLFAPEVKNHFEGVLDWLKNWAVSRTYGLGTRLPWDPKYLIESLSDSTIYHAFYT
FT                   FSHLLFKDYYGKEVGPLGIKAEQMTDEVFDYIFQNIDEVKETTIPLESLQKLRREFEYF
FT                   YPLDVSISGKDLIPNHLTFFIYNHVALFPKKFWPRGIRANGHLMLNNAKMSKSTGNFMT
FT                   LKQIVEKFGADASRIALADAGDSMEDANLDEANANAAILRLFNFKEWAQEIVQEVDSLR
FT                   TGELTDFFDLAFENEMNALIEETYKQYELTNYKGALKFGLFDYQASRDYYRESCGVMHR
FT                   DLVLRYIETQILMLAPIAPHFCDYIYREVLGHTESVQVAKFPRASKPVDAGVLSALEYL
FT                   RDLQRSIREAEGQALKKRKGKGSDVDPTKPAKLSMYITESFPSWQTKYIEMVRELFEQQ
FT                   KLDDNQILKSKVEPKDMKRAMPFISMLKQRLASESPSTVFNRELLFDEESIVKSTLDAI
FT                   KRACQAIKVDVYQFIVFPHGSTKGRDILTGEEQEVPVCKATENALPGQPGICINNL"
FT   CDS_pept        189767..189973
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059100"
FT                   /locus_tag="AGOS_AAL088WA"
FT                   /product="AAL088W-Ap"
FT                   /protein_id="ADJ41747.1"
FT                   /db_xref="UniParc:UPI0001DB2719"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGA4"
FT                   /transl_table=1
FT                   /translation="MSDILELDIVRNDIGPVLEEYFTDREQFVLFAQEQDYDIDTCMEL
FT                   CDTVRCLNEAMDETDSSHGGRNP"
FT   CDS_pept        complement(190117..190686)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777557"
FT                   /locus_tag="AAL087C"
FT                   /orf_name="AGOS_AAL087C"
FT                   /product="AAL087Cp"
FT                   /protein_id="AAS50279.1"
FT                   /db_xref="HOGENOM:HBG057931"
FT                   /db_xref="UniParc:UPI0000252424"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F15"
FT                   /transl_table=1
FT                   /translation="MFCACRRNILSISRARVPTFGRIRYQSSFTFNDNASLLAEEQAAE
FT                   VQNGTGKNARSEGASASPAAKVTVEAGRPEESRRARKRDYSWFPVAPSTQHLTNEDIAL
FT                   SNLFSRQRPITPTPREDGVQHLILVLELPDLLPRKSGLAGHTRSSEWNTVPPAMLKAMA
FT                   RFRPPPGTRRGGRRRPVLPPTRKRED"
FT   tRNA            191699..191772
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        191962..192384
FT                   /codon_start=1
FT                   /gene_family="HOG000207094" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625001"
FT                   /locus_tag="AAL086W"
FT                   /orf_name="AGOS_AAL086W"
FT                   /product="AAL086Wp"
FT                   /protein_id="AAS50280.1"
FT                   /db_xref="HOGENOM:HBG057932"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000252425"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F14"
FT                   /transl_table=1
FT                   /translation="MRPFWGHLLYYPSAEAYRNSRNYFSTVSSMLGHLVRRIHIARACN
FT                   TQHNVRLQLFSKEHCGLCDNAKVAVANLLKRPEYQGLEVDTIDITLPENKTWWDKYCLD
FT                   VPVLHVENKKDSGRMKKIFHRVQEEQLIKTIKDIEN"
FT   CDS_pept        join(complement(193820..194931),complement(192431..193757))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760217"
FT                   /locus_tag="AGOS_AAL085C"
FT                   /product="AAL085Cp"
FT                   /protein_id="AAS50281.2"
FT                   /db_xref="HOGENOM:HBG057933"
FT                   /db_xref="UniParc:UPI0001DB271A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F13"
FT                   /transl_table=1
FT                   /translation="MSNFFRDNKIGFKPRSNIFLKMRSKESLKEAEADSSDSSGADSHL
FT                   FLRGDGVSNTSVTTGTSAAENSMGSAVHMQPTAMQMSTPKATKVLLALDGKDEGPNMAP
FT                   LYAPGSEHDSGVHSRRPGDKGSESPSAVAWPRRKRDLAMVSGNDASSNDVLSEAFANTQ
FT                   RIYSNLKQELDRQHAKNEQQQQEIELYRNEIEAIRGKVSNYRNLLTALEDDSKLLLEQK
FT                   NNGEKKLEQLRLAYDSMAAKVGIFQKQSSELKMTLEDLRSLTLARESQLKGKDAEIEHL
FT                   KDELNNYTYQLDQEKVKNSELLHVLGGIKAELKELAVTVVEQCGSDASANMNTILGEVN
FT                   SMKSTFAEELMRRLEPLGSIIGTKSAEQIKIIKEQTELLSSKLQEENEKSTQLLAARLE
FT                   PMLQELLSRWNESGKLQKSTCTSIEEGQTRLIDTLKVSSDLVREQVEAVRLNFMEQLKG
FT                   VEKYLDKFGCQLDKNSQYENQVVDLQKQVHNIALQKSEVVALMKVKDTEVDSLNAQLLQ
FT                   SGESVNSLRESNSALDKQVIQLGLELTRKVEENTRICEELTSEKATFEQKFEAQKEVVK
FT                   LLTHEAESLKSRLEQCEGEATAAKKDKQEALDKFQQLQEHLHKLNVDAVQLKAHELELV
FT                   EENRKLKVTVDGMESANKEDENELFKLKEQVKIMDLEKHNFITERLDYQDKIESLEKQL
FT                   TQLRKQLQKENEISRDVKQAPVKPPHPEPLVYSSAVVPDRNSHNDDEFDLSSSLNDELD
FT                   LTNPSPIQIKTVPAKRKNQSTAKAMPSRKGKASSNINRKKLLSDDDDELACKLKKKKRF
FT                   "
FT   CDS_pept        195420..196436
FT                   /codon_start=1
FT                   /gene_family="HOG000215098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777558"
FT                   /locus_tag="AAL084W"
FT                   /orf_name="AGOS_AAL084W"
FT                   /product="AAL084Wp"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50282.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191419"
FT                   /db_xref="HOGENOM:HBG395619"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0000252427"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F12"
FT                   /transl_table=1
FT                   /translation="MHSEGIYFRLGTKDHDQSLEGYAAPKLPYTLHGESKMAVDRVTLS
FT                   IPKFKKQDLLEKWRFTDVLFCIALVGANVGVYFAKPFERQFTINDITLSHPFAQVQRVN
FT                   DAMLVVYSFVVPLAVIIVVSLLFADPSHRYYLLYISVLGLFLSFLSDMIITNYIKNWIG
FT                   RCRPDFLERCMPREGLEKDVLYGIEVCTTTDTDRLLEGFRTTPSGHSSESFAGLGYLFL
FT                   WLSGQLLTESPAVGAWRKAVAFIPLMAAAVIALSRTQDYRHHFVDVILGSILGMWIAWW
FT                   SYRRNFPAIQSYVPFKPLLDNSDVGLLNAPMLPRSVDEEMAPLNTPSVQSRSGTAQV"
FT   CDS_pept        196773..201869
FT                   /codon_start=1
FT                   /gene_family="HOG000172724" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625002"
FT                   /locus_tag="AAL083W"
FT                   /orf_name="AGOS_AAL083W"
FT                   /product="AAL083Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of translational initiation"
FT                   /protein_id="AAS50283.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006446"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG055343"
FT                   /db_xref="HOGENOM:HBG397659"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR016255"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0000252428"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F11"
FT                   /transl_table=1
FT                   /translation="MSMGNLTLDEYYEIQQNELEAMESIYAGDFVDLTQRKASWDKKPQ
FT                   RVFEISLRSIEKEPAESSLTLHFVLVSTYPHAAPQITFKKVQNVLDSQLALLRDDIRRI
FT                   HKSARGQEILFEITTRVQEVLDESQANANTQSLEAERLQRLEDEKVKLKLAEQENKEKI
FT                   ELERAKEQELIDELVQKELEKRQDDDSLFGMDKAVNLLPPAEWISTGEAYVFPKAIRAK
FT                   LPNNSYYWFRAVVNKEPVKIGNDVLSFGKQYTVKPFIPSDSPLIGILANADFMDNFHYL
FT                   LTEIELQNSYFNTSNGKKEIANLERELDTLLKVNHEHVNKLYSYTVERIGLSSTSFVWK
FT                   IRLLTEYAESTCIGNIIESVGYVNLATSRGWILRLLEALESLHKHGIAHKQIDLHTVHL
FT                   IKDTDFGNTVPKLMHASYGHTISNMLNRYPNTKSGSKMIVNNCPWIPPEMVKFNNSKPQ
FT                   RKSDIWNLAVLFIQMISGVDTPLHYQTPVDFLESVDMDESVVDFLNKMLAPDPRLRLGP
FT                   LELLPMKFLRTNIDAAVGKFYLFPDSVGTGTPTIISTGSNQHLRSRGISRTSDGGHRRS
FT                   FNVGSRFSSVNSTTRSRYATDFEEIAVLGKGAFGQVVKARNSLDSRYYAIKKVRHTEEK
FT                   LSSILSEVMLLASLNHQYVVRYYAAWLEEDMLVEEMAITSSDESDIESDDNTESSIIDS
FT                   FSNANVTTTRTVLNSMNNDWDFISHSFNNSSISNIIFANSTDEEDSANDIPSEGSRSED
FT                   ELTDKHYEDENDTKSIDQGTSPTLTEGRGGKQYKSGINYRRSRRSLRPADLADEKRSLM
FT                   KSSRAKPKSTLFIQMEYCENRTLYDLIHNENLSQQRDEYWRLFRQILEALSYIHSQGII
FT                   HRDLKPMNIFIDESRNIKIGDFGLAKNVHKSADILRIEGAFGSNVSADDLTSAIGTALY
FT                   VASEVLTGNGNYNEKIDMYSLGIIFFEMVYHFDTLMERATDLRKLRSSAVELPANFDSS
FT                   KRNEKKIIRLLLDHDPAKRPTAAKLLASGWLPVKHQDEVTKEALKNLADPSSPWQQQVR
FT                   ESLFSQPYSLSNDILFDNSQNTATPFSQLLRAQMKEEVEKVFRRHGGIENNEPPIIFPK
FT                   APFYSSQNVYEVLDRGGSVLQLQYDLTYPMARYLSKNPHCISKQYRMQSVYRPAEQQHG
FT                   SVEPRRFGEIDFDIISGSSADSALYDAESIKIIDELISVFPVFEKTNTLIIVNHSDIME
FT                   SIFNLCSIDKAQRSLVSQMLSQVGFAKSFKDVKTELKAQLNISSTSLNDLEMFDFKVDF
FT                   DNAKKRLNKLMIDSPHLTKVEESLSYIFKVLNFLKPLGVTRNVVVSPLSNYNSAFYKGG
FT                   IMFQAIYDSGRVKSLLAAGGRYDNLISYIARPSGGKIKHIKRAVGFNLAWDTIYLIVQN
FT                   YFKLASGKQTKNRSRFLRENAIEWKPKRCDILVASFSDAILNSLGVRIVNKLWKLGISV
FT                   DLVRNCYSVEDVISAAQIDGCDWIILIKQQNFSASSHKRKYKPLRIRKLDSEIDVDMDL
FT                   DEFIQLYQQETGIRSTAEILPSSENSQIEEGTSKWEEFSSADGSQDGGSGIAPIGQQKV
FT                   VHIPNNSARAKAKQNKKDKWVFEESARNASKAIVHSLSSAPVFSVDAIRDEVLEIISIT
FT                   SLAQKDEWLRKVFGSGANSAPRSFATSIYNSLSKEAAKGTKWAILHCHKTGSSCVVDLQ
FT                   R"
FT   CDS_pept        join(202079..202092,202145..202760)
FT                   /codon_start=1
FT                   /gene_family="HOG000113535" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930524"
FT                   /gene_name="SRB2"
FT                   /gene_synonym="MED20"
FT                   /locus_tag="AAL082W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 20"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS50284.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG057934"
FT                   /db_xref="HOGENOM:HBG398796"
FT                   /db_xref="InterPro:IPR013921"
FT                   /db_xref="InterPro:IPR016532"
FT                   /db_xref="UniParc:UPI0000252429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F10"
FT                   /transl_table=1
FT                   /translation="MKRTAVIFIEKATPSTITQFHDILSTHVLAIQEKWSFELKTFRSS
FT                   IKNLPPSDTKVLYSLQLTHRDNQTVVIKNQSAIVTGQHSTDALTSNGCSSGFPEPFDNI
FT                   LTSKLSNIWTQRQSTKGNFGTTYKTSELIIRASNVFSSSGFKGLLLEIECTDPVSAEEF
FT                   DRRVANIRAMLSEIDINDYKLNKDEMNEGKPVFLCDLAYQYVKVLD"
FT   CDS_pept        complement(202842..203882)
FT                   /codon_start=1
FT                   /gene_family="HOG000141975" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081821"
FT                   /locus_tag="AAL081C"
FT                   /orf_name="AGOS_AAL081C"
FT                   /product="AAL081Cp"
FT                   /protein_id="AAS50285.1"
FT                   /db_xref="HOGENOM:HBG057935"
FT                   /db_xref="HOGENOM:HBG203240"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR006903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI000025242A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F09"
FT                   /transl_table=1
FT                   /translation="MSFSEEQFIGKLNGLDETQESIVGASKWLLTLYKEAPVVAQSWAK
FT                   YILMTSTNTRRKLLAIYLVNDVIQQAKHKRIFQFGNEFGRVLPNVLKQVFPELPQELQK
FT                   KVQRVVAIWRQRQILSDNVLNNIERYLQGTGAGTTVAVGTINSRIDEACGLYRTLEKYA
FT                   PNVKSTQLKFEKSLEALDPNSMVYVENFKTVTKIATAAKETVHKSVELRQKLIEQLEVL
FT                   VAEQKTLLANELHIVSEVDVQLASKDPSAVQGTSAGDDNVLPTYEQELDSDNSSDDSDD
FT                   ESNLKKRSPHDDSDSQSKRPKLSRDEDMGGGYEPAVVAGTDASRTPEDQNSITSSIQDL
FT                   LSKLAN"
FT   CDS_pept        204016..207198
FT                   /codon_start=1
FT                   /gene_family="HOG000163591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930525"
FT                   /locus_tag="AAL080W"
FT                   /orf_name="AGOS_AAL080W"
FT                   /product="AAL080Wp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS50286.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG053034"
FT                   /db_xref="HOGENOM:HBG330712"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniParc:UPI000025242B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F08"
FT                   /transl_table=1
FT                   /translation="MEGPVKKAKVDGLQEIRRIFTKLNTLYTFLLSRKHVLTTFETLRG
FT                   PLEQAIKRPLEIADLARIAVVMGRSVEFRYVDLNQIHAETKVFDFGRGGYQQKESDIFQ
FT                   LKSGSESMDETQALVFEFVDGNMSRAWSAGGTPEFTMDQMRRMITRRRDVFEERLAAFA
FT                   ASAEERGLDTWEELCRAADLELPRPKQYVDPVQAMIEAQEGRGTAGPDGQKDIDRPPMN
FT                   VLLERLKHTKIYSGQIAALHVQKERTAAYGKLDFDLAPEVVNALDHDQLYIHQAEALNA
FT                   VHAGNNVIITTSTSSGKSLIYQLCAIDALLKDRDSTFMYIFPTKALAQDQKRAFQQLLS
FT                   RIPSLATVVVATYDGDTEQQNRAAIRKHARVIFTNPDMIHSSILPNHPGWRHFLMHLKL
FT                   VVVDELHVYKGLFGSHVALVMRRLLRLVRDFYLNAQLRFISCSATIKRPVEHMTNMFGV
FT                   SDIVHVFKDGSPNGLKYLGVWNPPALPQHMHKRENFIQESAKILVELIVNNTRTIAFCY
FT                   VRRVCELLMKEVRIILQEMGRIDLVNDVMSYRGGYSVDDRRKIEEEMFHGGLRAVISTN
FT                   ALELGIDIGTLDCVLMCGFPLSLANFHQQSGRAGRRNKDSLTLVVAADSPVDQHYVAHS
FT                   EILLEYDNDPDKLQELTLDFDNELILEGHIQCAAFELPIDIKRDQQFFNKKYLQDLCTN
FT                   RLQHDSDGYHANDNYLPWPPKMVSLRGVEEDIYAVVDITNGRNIVIEEIEASRTTFTLY
FT                   DGGIFIHQGYPYLVKEFNADDKYAKVQRVDVDWLTSQRDFTDVDPQEIQLVRSLTDSDV
FT                   PVYFGKIRTTMIVFGFFKVDKHGRILDAVETHNPPVIIDSKGLWIDIPRQALELVKERG
FT                   LNMAGGIHAAEHGIIGLLPRFIVAGVDEINTECKAPEKEFAQRQTSRLRPARLVFYDSK
FT                   GGHHGSGLSSKIFENIESILNGALQRIEECPCEDGCPDCVAASFCKERSLVISKPASLI
FT                   ILHSILGHDPSTYMHKINQGPEPNMAQVKVETIEPVTTPVKFAADVEIIDVRRIRNPKS
FT                   EELEIKEEFTDE"
FT   CDS_pept        complement(207304..209064)
FT                   /codon_start=1
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930526"
FT                   /locus_tag="AAL079C"
FT                   /orf_name="AGOS_AAL079C"
FT                   /product="AAL079Cp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="AAS50287.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR015284"
FT                   /db_xref="UniParc:UPI000042B78E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F07"
FT                   /transl_table=1
FT                   /translation="MIDQFAIFTAQGQLLFQYASLKKRFSEQLCNKFIHELISRPPAIN
FT                   ESKFATVSVDSHTFIFRETKATRLFYVASYASAPSLTLNHEAEQVVDMSLQLWDSLGLD
FT                   SALRAARKEPKGSITLEAVQEELFKFEKYFTVKYESMVEKELSTKSIRDSSPAAQQLKK
FT                   PTNKKATTGGTQKTRRWNSNGMLDDSNVNADQLDFSPIPDDISTAPAEVTNVNQSDFGS
FT                   RTEDGQFLIKEIDNMLSQAKKDSTRQPSSAGAPAGVLGFLRKKWLGNKTIDEGDLHAIL
FT                   EKFKKHLIGKNVAPAAADYLTSRVSEQLVGLKTASWTSVEQTARDALEQALISILTPGV
FT                   SVDLLHEIQKKVGNKVDAKCDPYVFSIVGVNGVGKSTNLSKLAFWLLQNKFKVLIVACD
FT                   TFRSGAVEQLRVHVENLAQLTDDNHVRGSKNKRGKSGNDAVELFEAGYGGSDLVTKIAK
FT                   QAIKYAREQQFDVVLMDTAGRRHNDATLMSPLKSFADQAKPDKIIMVGEALVGTDSVQQ
FT                   AKNFNQAFGKDRNLDFFIISKCDTVGEMLGTMVNMVYATGIPILFIGVGQTYTDLRTLS
FT                   VTWAVNSLLS"
FT   CDS_pept        209599..211377
FT                   /codon_start=1
FT                   /gene_family="HOG000270353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930527"
FT                   /locus_tag="AAL078W"
FT                   /orf_name="AGOS_AAL078W"
FT                   /product="AAL078Wp"
FT                   /function="heme binding"
FT                   /function="stearoyl-CoA 9-desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50288.1"
FT                   /db_xref="GO:0004768"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG057936"
FT                   /db_xref="HOGENOM:HBG103716"
FT                   /db_xref="HSSP:1AWP"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000025242D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F06"
FT                   /transl_table=1
FT                   /translation="MNGEVEDEDQIPEFDFSEFLRANSHRVAPYGSPLGTAPNSTGDEA
FT                   TAGADLSGDSALPVAEAPLLQGISTPEEGVDYDDGLIPELDCEQLLDENPHLVPPSAPW
FT                   MPSPLTVENTVPLLAAKLPKKYEPQVIHLLKKVDLVTMTFSIVLPVFSLLHLVFAAPPL
FT                   NATLVKIWIAYYLLTELSLIAGYHRLFTHQSYHCHIFVQFIMAVIGTSCGLGSILQFSS
FT                   QHLAHHRYSDTERDPQSLSLYGWWFAQWGHKLFKGNKKSAKAVADCRKTLVSSVCAPRN
FT                   KQLRSKQFVVPPSYSLLKWQDENYYMLWIITNLFIPTILAFTVCQLSVFSCVFYLGLVR
FT                   MSLVQQQWLLAGSLGHLKTLPFSSQPFDDSRSAVDLPLSILAQVITFGESNHNFHHEFP
FT                   GDYRNGPAWYAFDPAKWAINLMGHLGLVHHMHSASSDQIDMCRVQQQQKILDGERSKLQ
FT                   WGIPIDRLPMITPEQFATVARKDYEEKEKALVAIEGIIHDVTPFMHDHPGGMALVVASV
FT                   GKDATPAFNGAVYAHSTAARNLLATMRVARLTKGSCVVQTSWEHNLLNDSQGQRIVRNR
FT                   TQATVTRDIYYAASAA"
FT   CDS_pept        complement(211522..212607)
FT                   /codon_start=1
FT                   /gene_family="HOG000000870" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081822"
FT                   /locus_tag="AAL077C"
FT                   /orf_name="AGOS_AAL077C"
FT                   /product="AAL077Cp"
FT                   /protein_id="AAS50289.1"
FT                   /db_xref="HOGENOM:HBG057937"
FT                   /db_xref="HOGENOM:HBG203858"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI000025242E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F05"
FT                   /transl_table=1
FT                   /translation="MTSTTSCEGCEVCKTGEPKYRCPRCSRRTCSLACSRQHKEQENCS
FT                   GTSGQTTEYIPRGVLKGADTKDETNPLVQRDYNFLIGLNRKVQLLKEGSSQKNKNIVHA
FT                   GRGDGGHGRVGKPGSVVRRGVRCMLLPKGMQRSLWNKSKWDKSLDTFVWTIEWAVARPG
FT                   GEQWTHCSHRNQEQSRLLDCIGKAVFDKCAEWLPLAAAGDDGEPLTKASRLQALVGSGL
FT                   RYYTKQFPAETEGVIDTKRVVELDPQKAVGELFRNKTVIEFPTVYIAASAEDMERLGFR
FT                   VASDGTTTSSSDSSDTSSSDSSDSSSGDSSSDSDSSSDGEPEENPARLEPAPPPASPSH
FT                   GGETDSDDGYTPGISLDFLAD"
FT   CDS_pept        join(212993..212995,213046..213387)
FT                   /codon_start=1
FT                   /gene_family="HOG000186416" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760218"
FT                   /locus_tag="AAL076W"
FT                   /orf_name="AGOS_AAL076W"
FT                   /product="AAL076Wp"
FT                   /function="hydrolase activity, acting on acid anhydrides,
FT                   catalyzing transmembrane movement of substances "
FT                   /biological_process="proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase complex"
FT                   /protein_id="AAS50290.1"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016471"
FT                   /db_xref="GO:0016820"
FT                   /db_xref="HOGENOM:HBG351334"
FT                   /db_xref="HOGENOM:HBG621942"
FT                   /db_xref="InterPro:IPR005124"
FT                   /db_xref="UniParc:UPI000025242F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F04"
FT                   /transl_table=1
FT                   /translation="MSQSNGIATLLKAEKEAHEIVASARRYRQERLKQAKLDALQEINE
FT                   YRRRKEQELREYEAANAGGAEELERDAEQRAQKELDEIRRVAGAKRDAVVELLIDAVTK
FT                   PQHELHVNAG"
FT   CDS_pept        213683..215596
FT                   /codon_start=1
FT                   /gene_family="HOG000271512" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760219"
FT                   /locus_tag="AAL075W"
FT                   /orf_name="AGOS_AAL075W"
FT                   /product="AAL075Wp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50291.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000252430"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F03"
FT                   /transl_table=1
FT                   /translation="MSQIYLNSSMLVQLNATVQEFISDWLEHYSIHQQTLNPTQRILQF
FT                   GTTTTVVLLGFLYLMGKWFLGPGNGGKPVPFELAVPEAAQKHWKGKRLFSASVYDPQQP
FT                   GMIQNYCPATGQFLGSFRSMSKEDIDERFAAAAKAQVSWAKTSFAQRRQVLKTMQKFVL
FT                   ENQEMLARVACRDSGKTMLDASLGEIMVTMEKLQWMIKHGERTLRPSKRAGPANFFMKL
FT                   YKGGEVRYEPLGVVGAVVSWNYSFHNTLGPIIASTFAGNGVVIKCSEQVVWSSEFFVKL
FT                   ARESLKVCGHDPELVQLCYCFPPSETDDTANYFTSHPSLRHLTFIGSKPVAHHVLACAA
FT                   KSLTPVVVELGGKDALVVLDSAKDLESLSSIIMRGTFQSAGQNCIGIERVIVCQKNYDA
FT                   LVKILEHRISELRVGADIDNLEDVDVGAMISDNRFDYMEELIQDAVSQGARLLHGGSRY
FT                   THPKYPQGHYFQPTLLVDVTTDMRISQNEVFGPVLTVMKAKDIEDCIRIANDTPFGLGG
FT                   SVFGKNRKDCNYVANHMNVGNVAINDFATYYVCQLPFGGIGSSGYGRFGGEEGLLGLCN
FT                   SKSICYDKVSWISTFIPPPVDYPIKSSAGAWNFARAFITGAYTNSLWQRAKSILELAKG
FT                   GR"
FT   CDS_pept        complement(215636..216316)
FT                   /codon_start=1
FT                   /gene_family="HOG000094410" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081823"
FT                   /gene_name="RRF1"
FT                   /locus_tag="AAL074C"
FT                   /product="Ribosome-recycling factor, mitochondrial "
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50292.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG203857"
FT                   /db_xref="HOGENOM:HBG531104"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR015999"
FT                   /db_xref="UniParc:UPI0000252431"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75F02"
FT                   /transl_table=1
FT                   /translation="MFLLNASRLGAGSRLFSSAGVQFAKKRGQAAKEAVEVDLVDVGDY
FT                   VKKATERFQHTVELHKKRLGQMKAGKPDATMFDGLAVGNEKQKFTELAATSVKGKNMLI
FT                   VTVFDPKDTKRVASAIVGAGLNVTTERVLENQQQLKISLPPVTTETRERLCRDMKKVFE
FT                   EYKNSANRHSLGHVRSEVLKELKKLDKKNDSVRKVIQEIENLHKEYTAMLQEQLKHAEK
FT                   NAMR"
FT   CDS_pept        216808..218499
FT                   /codon_start=1
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760220"
FT                   /locus_tag="AAL073W"
FT                   /orf_name="AGOS_AAL073W"
FT                   /product="AAL073Wp"
FT                   /function="carboxy-lyase activity"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="AAS50293.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0016831"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG055646"
FT                   /db_xref="HOGENOM:HBG479104"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniParc:UPI0000252432"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F01"
FT                   /transl_table=1
FT                   /translation="MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRW
FT                   AGNANELNASYAADGYARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPST
FT                   SAQAKQLLLHHTLGNGDFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPV
FT                   YLGLPANMVDLTVPASLLNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACA
FT                   SRHDVKQETKQLIDVTQFPAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADL
FT                   ILSVGALLSDFNTGSFSYSYKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEA
FT                   AKGYQPSPVPTYAAPNEDADPKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTR
FT                   FPSSTIGISQVLWGSIGFTTGACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMV
FT                   RWGLKPYLFVLNNDGYTIERLIHGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGE
FT                   WRALTEKQEFNKNSSIRMIEIMLDVMDAPSSLIKQAKLTAATNAQP"
FT   CDS_pept        complement(218957..222619)
FT                   /codon_start=1
FT                   /gene_family="HOG000207194" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760221"
FT                   /locus_tag="AAL072C"
FT                   /orf_name="AGOS_AAL072C"
FT                   /product="AAL072Cp"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="AAS50294.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG057938"
FT                   /db_xref="HOGENOM:HBG397445"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniParc:UPI0000252433"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F00"
FT                   /transl_table=1
FT                   /translation="MSGGGQKHEDGGSKYVTTSGGKNNPKQIHIAHRKSPSELTNLMIE
FT                   QFTLQRQLELVQVQQQQLLAQQQQLAQQAGQYLNAGGLGNAGGGATLPFLPQPPQPQYN
FT                   SSPSGGNKSRSHSRNNSGYYNSGDFGGGAHRRTGSQSSVYGHARRHSLGLNEAKKAAAE
FT                   EQAKRAGNGAGNISIKIDVPSEVDPASPGVTESISSFKFPPTPLENTKGHRRVNSNMSP
FT                   NRAFQFPARPSNKENQDDFVQVGNSHRRTNSRGHDLSGINSNWRAQQGQQQQPAPFHKQ
FT                   TFSNQGFGALEPPPVFQPGHRSRGSNASAHSFSSNSGGNNSNGRKSLFAPYLPQANIPQ
FT                   LIEEGRLVAGVLRVNKKNRSDAWVSTDGVLDADIFICGSKDRNRALEGDLVAVELLMVD
FT                   DVWESKKEKEEKKRRKDASTQHDLILESKDDYHNDASSSIVTASASSTASQGTSASSDK
FT                   NEDGSNSGSGSIKRRGSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDEYRPLYAGHVVA
FT                   VLDRIPGQLFSGTLGLLRPSQQANNSDKPQKPKIVWFKPTDKKVPLIAIPIEQAPKDFV
FT                   ENADKYLDKMFVASIKRWPITSLHPFGTLVSQLGEINDPSSEIDAILRDNNFLLDEYLD
FT                   PHDRTRERDTFKPVEVPLSELAQRKFYDGAIAISENGILSDLAIHVSHLPNGSIELGCH
FT                   VVDATAHIEEGSSLDRRARKRSSAVFMPQKTLYLLPEALNKFLTLEPGKRTCTISVVYT
FT                   LAPETLAVTSCWVGETSVSPKAVLTFDEISDVLGKGTGHENTFVETVSAVAASFYRERL
FT                   GMKNSVPNLLKTKLALLDSLDDEKVKVDINILDKSPAAYVIGEIEHKVNSTIAERTYVK
FT                   LGSSAFLRRQPQPISTKLQLFKKKIQKFGFEIDITTPESLLSSILAIEDPTVRLGVELL
FT                   LFKTVNRARYFVAGKVEPDQYGHFSLNLHLYTHFTSPLRRYADHVVHRQLKSILRGTEY
FT                   RQDVDSLKITSEYCNFKKDCASHAQEQAVHLLLCKSINDMGNATGQLLTMATVLQVYES
FT                   SFDVFIPELGIEKRVHGDQLPLIKAEYDSSNRVLDLYWQKGVDSATFVPVDEKNPNSYR
FT                   NSIRNKFSSSSKEIASVQLSARDSHERLIKSDDLATEFDKLHIKPPQLYIPAAEATADP
FT                   LAAYLNDVITRVEGDNYIQEIHELKKVPILLRAEIGMALPCLTVRALNPFTSRD"
FT   CDS_pept        complement(223169..224890)
FT                   /codon_start=1
FT                   /gene_family="HOG000271511" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760222"
FT                   /locus_tag="AAL071C"
FT                   /orf_name="AGOS_AAL071C"
FT                   /product="AAL071Cp"
FT                   /function="1-pyrroline-5-carboxylate dehydrogenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS50295.1"
FT                   /db_xref="GO:0003842"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI0000252434"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EZ9"
FT                   /transl_table=1
FT                   /translation="MLSRSRLLGYSARTIAQLSRPGCPRISNEAVKPFSKRDTLDWDLL
FT                   RASLSKFNNSSLDVPLVINGERIYFNDAGKRELFKQVNPARHTQVLAHVTQASREDVRA
FT                   AVRAAQDAKQKWYETPFYDRAAVFLKAADLVATKYRYDMLAATMLGQGKNVQQAEIDCI
FT                   TELADFFRFNVKYAEELYQQQPAESSPGVWNRSEYRPLEGFVYAVSPFNFTAIAGNLVG
FT                   APALMGNTVVWKPSQNAALSNYLLLTVLEEAGLPRGVINFVPGNPVDVTEEVLADKALG
FT                   GLHFTGSTAVFKQLYGKIQQGVVSGLYRDYPRIVGETGGKNFHLVHPSANLPHAVLSTL
FT                   RGAFEFQGQKCSAASRLYLPQSKADAFLADLAGTLAAIKPANTSASSINGGDLHAFMGP
FT                   VIHEQSFDKLAAAIERARTDPELEILYGGDHSKSQGYFVGPTVVRTSNPRHDFMTAEFF
FT                   GPILTVYEYPDAQFDQVCDLIDSTSAYGLTGAVFARDRDAIAAADRRLKYAAGNFYIND
FT                   KATGAVVAQQWFGGARMSGTNDKAGSPNVLSRFVSVRSVKENFYELTDFKYPSNYE"
FT   CDS_pept        complement(225226..226479)
FT                   /codon_start=1
FT                   /gene_family="HOG000095263" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760223"
FT                   /locus_tag="AGOS_AAL070C"
FT                   /product="AAL070Cp"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50296.2"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG124418"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniParc:UPI0001DB272A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EZ8"
FT                   /transl_table=1
FT                   /translation="MMEEFGQLSLGDGCDTYGHRRDKTLQDVDLSAISRLRISEPGVSQ
FT                   CARERSTISEEYRCKLQPYFSTTPSPLRQTIVAESDDEMDIDPAESVEAERTDAEQLED
FT                   VLQDEEPEEDARASSSGHRGSVIKALLSPTTLGVAAATKELEDLAAPAAPPPVPAAAAA
FT                   APLRSAPALGEQELQELRHNFNTRPLQVQVNHHHYYPGFAPYGAQSAHDPYDLPQPWSE
FT                   RSRPASKHTYAFTSYLQLALNVLTVFAISSLALSFLRALKTDLQSTWRHNKLELDYESQ
FT                   ACRQSYDANLCDPATRVPALYEQCAQWEKCMSRDNNIFFRARSTLSARLVGDVINSFIE
FT                   PLGWKALLSILIGLLIWCFSSNFLLGFARAKSYYGSPLALAAPPAASPRQITASQGSPE
FT                   RDLAISTALASAPRVRER"
FT   CDS_pept        complement(226815..228812)
FT                   /codon_start=1
FT                   /gene_family="HOG000112869" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625003"
FT                   /gene_name="HDA2"
FT                   /locus_tag="AAL069C"
FT                   /product="HDA1 complex subunit 2 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50297.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG057939"
FT                   /db_xref="HOGENOM:HBG203241"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniParc:UPI0000252436"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EZ7"
FT                   /transl_table=1
FT                   /translation="MNFCSKNAQMYYIPVGLTSLQKDLIEILLCMHAESFLEEFGPSEA
FT                   VMQSAAQIKTEKEPEAVEGLGLGPLTPTQMNTMLLRHLRAVANHPCLLVDHYMPRKFLL
FT                   MEPGEELIAMSEKFRVLNQMMEAILSRRRRQRPLQLVLVSHSVKELDLIEGFMLGKMVK
FT                   IKRLSGTSLFDEKHQYTERGTAAAESNSTLTSGSTLKDTSPGSVEGKLSSGEAGAGYTT
FT                   GGIKDDYDYQNSRRHMRAADDGAERQCDHEDWLFLATTTHLTHCTDLFDQYDVDVVLSL
FT                   DPLLDVSLPALRSVRKQSKSVPLVKLFVQDSAEHFMLTRGISAEHEEDHIYDAVGHFIK
FT                   NRGVHRQRLGMSAAALAEVVTALLENCEAATDLKSTKPTDTPSELSIVDALSERIMLLK
FT                   LNHTPYELPLQRGPFSMKSYQLQLKQLIYARLEACQREQECKCAYILDRRMQETANLNR
FT                   LDEVNAEAGRLFQSLKDEEKLVVDSERRLERTRDEHDRLREKSAHLRRRKAELEELLAS
FT                   SDLDSRVSSKRARLAELRQQLMPLEQQNTAMADSNEELRTRYQTRSSHAATLSSALASL
FT                   RERKAALTKESTGPATCWMAASATEEHDRLQTELNDLVQQRHFLQKYIDTMKSQYAITN
FT                   LDELNRTQHNKSGAATSRVRTTRATSPTYI"
FT   CDS_pept        complement(229090..231084)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760224"
FT                   /locus_tag="AGOS_AAL068C"
FT                   /product="AAL068Cp"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /protein_id="AAS50298.2"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG057940"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0001DB272B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EZ6"
FT                   /transl_table=1
FT                   /translation="MLQASYGTAPSTRNEALQQVIDRDENGHFCAVYDFALCATTEVGV
FT                   SPCGKCLAYPNSACRVVRERWLCAFCGSWNAAAGVGARRRGAHYAVGLGTSPAAAQLVF
FT                   VVDLTMEAAELQALKTHVAALVGSVSGRFGLVTLTDGAVTVCGGRGRAAAVPTDEYRKF
FT                   QLERLDPQPLLKRHLGEMSELWLTAEELLVAVGALEAQPCGAAQEERPRRGTGIAFFVA
FT                   ALFNMHRVGFALKVLAFLAGPCTQGPGKVVSKSYRNHMRGHSELQNRKARYSSQAADYY
FT                   RSLREFAPAVSYDVFITSLDQTGVWEMAQCLNHVVQYDTLVEDRFHLDMHAYARRLRNE
FT                   IVPHQVNLITSDTVLVDGCFGPVRKLPPLRNNYSDTERGVGSTTTWAYNGTLLSADELS
FT                   LCFSLCLAPSVRQSSKESAAPNITLQVEFMYEVHGELCVAVTTLVLPTTSDPAALSLPQ
FT                   SFNATICCVSFMKRIAWEILNGHWHSYKLHDWCTALDDLCVRHLDSGSFNASQLVQLSY
FT                   YLQRSALLRLAQTSPDEWAVYLLAILRRDSTQCLHICRPLITMLTPERQQLRLNPDVLR
FT                   DVRPMVVDASNYVIVRYSDPNDSALHAVRAMAQQLQLSRWPVPWYKDTPIGKSQDRYVL
FT                   SRLGVSTASNLPSSEVSLDAYITYIHSKL"
FT   CDS_pept        231315..231956
FT                   /codon_start=1
FT                   /gene_family="HOG000246594" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777559"
FT                   /gene_name="MHR1"
FT                   /locus_tag="AAL067W"
FT                   /product="Mitochondrial homologous recombination protein 1 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50299.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG057941"
FT                   /db_xref="HOGENOM:HBG395969"
FT                   /db_xref="UniParc:UPI00001516C4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EZ5"
FT                   /transl_table=1
FT                   /translation="MSKTVGASRFRPAGWLQRAGYAPQVFVFRNLESGQVIYSQLPTFT
FT                   ERQINKNFYRPNWENRKPSTRPDIWKCMAVVDLASHEESVRLYQNLCRLRYLREVPQRK
FT                   AAEQLRKRNEFGHIWYSAQYRPTYTQEAVADLRECLLRARGGATVHWEDPWRMGDRAKH
FT                   WAALPAVQHQFLPRMANVAREESAILKQLGERAKRAFAAPAPPAPAPQSL"
FT   CDS_pept        232309..233325
FT                   /codon_start=1
FT                   /gene_family="HOG000203350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760225"
FT                   /locus_tag="AAL066W"
FT                   /orf_name="AGOS_AAL066W"
FT                   /product="AAL066Wp"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50300.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG319731"
FT                   /db_xref="HOGENOM:HBG382907"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI0000252438"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EZ4"
FT                   /transl_table=1
FT                   /translation="MLNHTYSDIGVRLAPRFLPDVSFMDDVVAPLTAVKPRPTLVPGIS
FT                   DGHLSLLAPVLAYWVFSGLFHVMDTLRLAEKYRIHPSEEVASRNRAGRLDVLAQVVLQH
FT                   IIQTLTGLVLVYYDGEPQTGMEQLAMWRWRQAAPGWVSNEAIYVAYHYGLSVAKLLVGF
FT                   FLIDTWQFWLHYLMHMNKTLYRKFHAHHHRLYVPYAYGALYNNPVEAFVLDSCGTALAA
FT                   LVTRMTHREEMLLYTFATMKTVDDHCGYALPWDPFQWLFPNNAVYHDIHHQNFGIKSNF
FT                   AQPFFTIWDSFCRTKFPQFEEYEKKQRRVTVDRYKQFLAERQMEREAKLTLLSKKLS"
FT   CDS_pept        complement(233743..234366)
FT                   /codon_start=1
FT                   /gene_family="HOG000075825" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081824"
FT                   /gene_name="ATP5"
FT                   /locus_tag="AAL065C"
FT                   /product="ATP synthase subunit 5, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="plasma membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS50301.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG532379"
FT                   /db_xref="HOGENOM:HBG668108"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniParc:UPI0000252439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EZ3"
FT                   /transl_table=1
FT                   /translation="MSSRVFVRSLAAAAKAGVKPPIQLFGLEGTYASALFTAASKTTSI
FT                   ESAGKALASLSKTIAKDAKLGAILANPALPAGDRTVVVQTLAQKTPGMDAAVQNLMQVL
FT                   AENNRLNLLQGVAGEFTKLTDAHNGLVQATVTTAQPLEGKLFRRVEKALAQSSFIGAGK
FT                   TLKLENVVKPEIQGGLIVEVADRTVDLSIASRISKLNQVLKESI"
FT   CDS_pept        234785..236371
FT                   /codon_start=1
FT                   /gene_family="HOG000065940" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777560"
FT                   /gene_name="BFR2"
FT                   /locus_tag="AAL064W"
FT                   /product="Protein BFR2"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50302.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="HOGENOM:HBG057942"
FT                   /db_xref="HOGENOM:HBG398283"
FT                   /db_xref="InterPro:IPR012617"
FT                   /db_xref="UniParc:UPI000025243A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EZ2"
FT                   /transl_table=1
FT                   /translation="MGKTLADQITELANKSKVPDFDIEDEQVFEHDSNASGSEASDEDE
FT                   ALQAAHYVQVGRSKLRNKHNVLVEDSKYSGSKGSREALFNSSGEEDGSESDRRGSDSDG
FT                   GSDSDSDAPEATLSSEQSADESARSDSDSGDSDSDSGSDAGEENSAVAEDADAKRERLS
FT                   QLVRLETQQAMGKLNAAVQNDALKGYAIMEQSRFFEGAIDVRIKLQKAIAAANQLPLTK
FT                   QSWESRLDAQDAELLESTCKLLHKVAGKCAELRTTFQNKERINQTEIDYQPSKKRSIDA
FT                   LAEQCHDLDSQLRDYRGAVLHMWSSKVAATSGKTALSSSKFKAINQPANVQVDNQLADM
FT                   PRLVKRTQLNRRGVVPLGFEEDYKQKRLPLLDSNSAQDGGQEEDADVPANYDPRKKDNN
FT                   AIDASENPYIFDDEDFYRVLLNDLVDKKILNAQQGSNVQVAIKARSQNKLKKNVDTKAS
FT                   KGRKLNYSVQEPIANYEAPINGGFKWSDEQIDEFFAGLLGQRVNFDERETSEAKDNEEE
FT                   AIEHDDLRIFG"
FT   CDS_pept        complement(236487..238094)
FT                   /codon_start=1
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760226"
FT                   /locus_tag="AAL063C"
FT                   /orf_name="AGOS_AAL063C"
FT                   /product="AAL063Cp"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50303.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG334116"
FT                   /db_xref="HOGENOM:HBG398292"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000025243B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EZ1"
FT                   /transl_table=1
FT                   /translation="MQTEEEALTASLAAFDKKLGTYRSINAGNYADDAVSGSYSVVVNS
FT                   RYAMLCGSDFEEPLDGAQTLRAECISILRSSLPISMAFLMEFSMTICSLFIIGHLCTAM
FT                   ELASASLAVMTYNITGLSLVEGLATALDTVCPQAYGSQRYSKVGLYFLRGSAMIMVGMS
FT                   LTAIIWFFSASWLQLLIPEADLIPKIQLYLRIMILGIPALVLFSTGKRYLQAQAVYEAS
FT                   TYVLAIVFPLTIVFVLGFTRHFGFVGAPIGIVTSQWLMVIILFVFARSIRPDTLRCWYP
FT                   FMQSSHHFKRVFTHWRPLWDLAFPGLVMLEAEFLSIEALTLISTYFGVNAIASQTVIAN
FT                   LSSLIYQIPFAIGCVISNRVAHYVGSGLIKNAQMTIKASYCLASIVGVSMCLFVAFLNK
FT                   PLARLFTNNEEVVELAHSVSYILAVNQIYDAFNTFGAAILRGQGRQRLGGIWNMIAYYI
FT                   VSLPLGWWLAFGPLKLKLAGLWYGCGIGILILALAFSWYIYNSDWQLIIQECNKRENTE
FT                   VENDMLHSDSVDASFSSQ"
FT   CDS_pept        238294..239277
FT                   /codon_start=1
FT                   /gene_family="HOG000094562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930528"
FT                   /locus_tag="AAL062W"
FT                   /orf_name="AGOS_AAL062W"
FT                   /product="AAL062Wp"
FT                   /protein_id="AAS50304.1"
FT                   /db_xref="HOGENOM:HBG057943"
FT                   /db_xref="HOGENOM:HBG398291"
FT                   /db_xref="InterPro:IPR012981"
FT                   /db_xref="UniParc:UPI000025243C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EZ0"
FT                   /transl_table=1
FT                   /translation="MDFLLRPIDSKECSVITFVPTPGFVIKSKLEHGKDATLVVGTKTF
FT                   VNVCHHTQVPLPDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINS
FT                   ECMQWIEKDYQLREILVEWCLESCELRQSVGISREAVVFPRMKSKGALPAVEVLQQDLT
FT                   HDYKHEIAENSSLGMDDPRQILHMRGALDEEASGDDGTLPSLFPERPATRPLIEEVNTG
FT                   RHSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVASALNSGHAYSVHYDGKE
FT                   NSLLVTSTSQAYEPKEICIPLPGVVAGTRSMRALFLKRSNALVVFL"
FT   CDS_pept        complement(239517..240779)
FT                   /codon_start=1
FT                   /gene_family="HOG000246369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930529"
FT                   /locus_tag="AAL061C"
FT                   /orf_name="AGOS_AAL061C"
FT                   /product="AAL061Cp"
FT                   /function="RNA binding"
FT                   /function="glutamate 5-kinase activity"
FT                   /biological_process="proline biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50305.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004349"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="HOGENOM:HBG273629"
FT                   /db_xref="HOGENOM:HBG507643"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="UniParc:UPI000025243D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EY9"
FT                   /transl_table=1
FT                   /translation="MDGTDRKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRM
FT                   GHKVVIVSSGCIAVGLKTVGTDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQ
FT                   ILLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGL
FT                   IGADYLFLMTDVDCLYTDNPRTNPDAKPILVVPDLSQGLPGVNTSSGSGSGVGTGGMAT
FT                   KILAADLATNAGVHTIIMKSERPVDMVRIVEFMEWREQCTAVSADAETLQTDELNLLQE
FT                   HGVPLHTRFIANVWQPSLNKREFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVI
FT                   AVEGSFHELEAVDLKIGVRKADGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIET
FT                   VLGYIDSEYIAHRENLAFPPR"
FT   CDS_pept        241007..244924
FT                   /codon_start=1
FT                   /gene_family="HOG000246682" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081825"
FT                   /gene_name="CFT1"
FT                   /locus_tag="AAL060W"
FT                   /product="Protein CFT1"
FT                   /function="RNA binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50306.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG057944"
FT                   /db_xref="HOGENOM:HBG203242"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="UniParc:UPI000025243E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EY8"
FT                   /transl_table=1
FT                   /translation="MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNE
FT                   GRLVLAYEWKLSGRVHGLSLVPHKSGLGRLAVLTGRGRVSIVRFDAENQTLETESLHYY
FT                   DAKFEELSALTVGAAPRLEQEPAARCLLVHNGDCLAVLPLRGHEEEGEEAEEEEEHPAK
FT                   RARTDADGRLVGASTVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNEKL
FT                   TRQTMKFIILSLDLDDEKSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLYVDNTGAL
FT                   QGAISLNAFSNSGLNTRIQDNSKLQAFFEQPLCYFATQSNGRDILLLMDEKARMYNVII
FT                   EAEGRLLTTFNCVQLPIVNEIFKRNMMPTSICGNMNLETGSLFIGFQSGDAMHVRLNNL
FT                   KSSLEHKGTVSETLETDEDYMELYGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLA
FT                   VGKASSIEHTVAKLANPNKDELSIVATSGNGTGSHLTILENTIVPTVQQALKFISVTQI
FT                   WNLKIKGKDKYLVTTDSSQTRSDIYSIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQ
FT                   VTSKGVHLFDINFKRMMTMNFDFEVVHVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVK
FT                   TVLPDALKEIIITFGVILESNMCNKYINGLEKSEEPQLLFTFVTADNQIVFFTKDHNDR
FT                   IFQLNGIDDFRQKLFISTYQLPEDINPDPSIKQVIISRLGHKHKQEYLTILTFGGEVYL
FT                   YRKCIDNPDRFIKCDHELLITGAPENAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPY
FT                   IIIKEDNSVPRIFPFANITLVSMTRWGENSVMCVDDVKNARIMTLNLDRDRYYGNKMSL
FT                   AKIYLEDPLEDFQTLNNITYHERTQTFIVSYAKSIDYVALSEEDEPLVGYNPDKIHAMG
FT                   FQSGIILLSPKSWEIIDKIEYGKNSLINDMRTMMIQLNSNTKRRREYLVVGNTYVRDED
FT                   IGGTGSFYLYDITEVVPEPGKPDTNYKFKDIFQEDIRGTVSTVCEISGRFMISQSSKAM
FT                   VRDIQEDNSVVPVAFLDMPVFITDAKSFGNLMIIGDSMQGFSFLGFDAEPYRMLTLGKS
FT                   VSKLETMCVEFLVNNGDVYFLVTDRNNLMHVLKYAPDEPNSLSGQRLVHCTSFNLHSTN
FT                   TCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQADGTIFKVVPLSEASYRSLYLIQQQLI
FT                   DKEVQLCGLNPRMERLENPFYQMGHILRPMLDFTVLKRFATLSIPTRMTMASKAGRQAH
FT                   AEIWRDLIDIEYSLTSLNKIT"
FT   CDS_pept        245110..245763
FT                   /codon_start=1
FT                   /gene_family="HOG000001050" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760227"
FT                   /gene_name="GPI11"
FT                   /locus_tag="AAL059W"
FT                   /product="Glycosylphosphatidylinositol anchor biosynthesis
FT                   protein 11"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50307.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057945"
FT                   /db_xref="HOGENOM:HBG203243"
FT                   /db_xref="InterPro:IPR009580"
FT                   /db_xref="UniParc:UPI000025243F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EY7"
FT                   /transl_table=1
FT                   /translation="MTTKKRPVGKKKFVSFSDDDALSRTGRLPKNLPQHGSPPVYVRRT
FT                   WQTIPFHLIVLSYWFIKHSNGYDVRKCTWLLVPCQVLYLALQFNPATVYGNKILKLNYA
FT                   LLAVSGVTCILLTIPCMLLVVLFGAPFLEMLDKTWLLSLHCCVLSYPAVYSVLNSDFKV
FT                   GFFKKYFISIAVGCWISCLAIPLDWDRPWQEWPIPLVVGAQLGAMFGYTFCSQL"
FT   CDS_pept        complement(245830..246612)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760228"
FT                   /locus_tag="AAL058C"
FT                   /orf_name="AGOS_AAL058C"
FT                   /product="AAL058Cp"
FT                   /protein_id="AAS50308.1"
FT                   /db_xref="HOGENOM:HBG057946"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="UniParc:UPI0000252440"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EY6"
FT                   /transl_table=1
FT                   /translation="MQFRRWLTRSRPTFSNLSELVVCKEGTGAGPFIELPEFKILEDAV
FT                   VLKIPAASVVYGRLEQLGMFNVPSGASRPFIKLEHMRNGFTKFCTGVEPVNLVCSSPAP
FT                   TNNLKVLEVNYEDEAWVIKDAGSRILSYSGNISVEEDKLTGRGVVVLNGQGPIYELDLG
FT                   KCDEVLLAPESVCAYTADTSLQLVKLDALLTISKAVKKYGQLLFGKHYEGILTVLTRMA
FT                   NKDKIYYRAKGPGRLLLQTHYLPGSQEYSTAELLQSMK"
FT   CDS_pept        complement(246898..249327)
FT                   /codon_start=1
FT                   /gene_family="HOG000074705" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760229"
FT                   /locus_tag="AAL057C"
FT                   /orf_name="AGOS_AAL057C"
FT                   /product="AAL057Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50309.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057947"
FT                   /db_xref="HOGENOM:HBG203244"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000252441"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EY5"
FT                   /transl_table=1
FT                   /translation="MGVDIRGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCF
FT                   YPDIPGVYAQSGGGGATPPGKSAELASVEQIREYSARLQQLSMPPRPVPASPAPAEPTV
FT                   YVPKVTMLPAVVRRYDYSAAGEEPLTHVVRGPAIFDTAKVPYTQDEIMAKELDFLRGRL
FT                   LDLQKATGKTVPGLGGLRGRPGSGRRARSDTIGAEDDDSLLDGMDGHSLHSSGNGDGPA
FT                   SLKKRKQDQFDEFKSVDPSFLDPKQVLRVLLNKSAFFTPTVPIPGNENRLFHVGHLAMH
FT                   DDYLCFFHNRLYDIMANTLPERLSQQQQTKLKPVAEMEPLRFPPKMLCTHWINYFTTQT
FT                   DVSTLIPFVQSSDIIQSIDQWFPQKDVTFRIESISLDQLATLGLITLFLLFCYNSLSST
FT                   VLVPLKDDEMHRYEQLRSYVPQLHANLKSIMLLVCMGGSTNLSRKWKVRLLPFIAVMKF
FT                   YQTLSGWSPSTSHSTDFDEDLNWSLDLGINHETQDQNAIIIWNFVYKNCCWRKLIHGEL
FT                   PLPLLSKLSGSSKILDSSLLQDYDFLKTIMKLLQYLHSREETQSVAKLQKLKLKCKEAL
FT                   NNASQRCYNAQLMVSHVVDTLVYRNMELFVDVYTLLHYESIGDVEKYNETFKSFIQFLQ
FT                   ESVFYIFSGLANLKFAGYEYIFHLPTFTILKNILLILFSLTERTRLGVGKDTPELAQMN
FT                   DTLITLIRKICMLISDYSKNCKKENPVVTDIKVIVATLLEANSYDHPAVPSSLRNGIKS
FT                   LDILKINKNVAKLRTMSETLIKTDFYEKRGPFVPESLPTFGVTAGNFDSVYQAFFQ"
FT   CDS_pept        complement(249672..250283)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930530"
FT                   /locus_tag="AAL056C"
FT                   /orf_name="AGOS_AAL056C"
FT                   /product="AAL056Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS50310.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI0000252442"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EY4"
FT                   /transl_table=1
FT                   /translation="MQVLFVLAQALLCAFALADPTVTHRVFFDLQHGDEPLGRVVLGLF
FT                   GDVAPRTVANFVTLAKSQDASAGYINSTFHRVIPNFMIQGGDFTHGTGVGGRSIYGATF
FT                   EDESFAVKHDKPGRLSMANRGRDTNGSQFFITTVATPWLDGRHVVFGQVLDGMDVVSAV
FT                   EAVPRNARDVPDISVRIVACGELQDTPADATGATLETDEL"
FT   CDS_pept        complement(250364..251071)
FT                   /codon_start=1
FT                   /gene_family="HOG000093949" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760230"
FT                   /gene_name="MED6"
FT                   /locus_tag="AAL055C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 6"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS50311.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG137407"
FT                   /db_xref="HOGENOM:HBG272267"
FT                   /db_xref="InterPro:IPR007018"
FT                   /db_xref="InterPro:IPR016612"
FT                   /db_xref="UniParc:UPI0000252443"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EY3"
FT                   /transl_table=1
FT                   /translation="MSQPPLDELQWKSPEWIQSFGLRTDNVLDYFSQSPFFDKTSNNHV
FT                   VKMQQQFSQQMPPAPQTARPKAAPSAERQAIWDRYPAYALLEQELAKLKGIEYVLAHVR
FT                   EPDFWVVRKQRRAGDRVTALNDYYIIGANVYQAPTAYSVVQNRLLSTGFHLSAALGAIQ
FT                   RLARFQPGQGAAFVPVEQNSVQPASGTTASSATAPALTAALDGATAGYSDVLTPEMMDR
FT                   LMLQSLKSTPLYL"
FT   CDS_pept        251167..251535
FT                   /codon_start=1
FT                   /gene_family="HOG000000872" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760231"
FT                   /gene_name="FYV4"
FT                   /locus_tag="AAL054W"
FT                   /orf_name="AGOS_AAL054W"
FT                   /product="Protein FYV4, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50312.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG057948"
FT                   /db_xref="HOGENOM:HBG203754"
FT                   /db_xref="InterPro:IPR019083"
FT                   /db_xref="UniParc:UPI0000252444"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EY2"
FT                   /transl_table=1
FT                   /translation="MLQTRLFHACAALARAASRPVPKPTSEIPDVSTFLAKIGRQCSEH
FT                   AELYENKWENLFMWDGPKLKEKGVPVQQRRYILQQVERLRQGGPVREIREGKKSFFGGE
FT                   RKRKEKVAKWRAEQRHAA"
FT   transit_peptide 251167..251196
FT                   /gene_name="FYV4"
FT                   /locus_tag="AAL054W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EY2 "
FT   mat_peptide     251197..251532
FT                   /gene_name="FYV4"
FT                   /locus_tag="AAL054W"
FT                   /product="Protein FYV4, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EY2 "
FT   CDS_pept        join(complement(252120..252173),complement(251562..252068))
FT                   /codon_start=1
FT                   /gene_family="HOG000164170" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760232"
FT                   /locus_tag="AGOS_AAL053C"
FT                   /product="AAL053Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50313.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG123543"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniParc:UPI0001DB272C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EY1"
FT                   /transl_table=1
FT                   /translation="MSQAVYFSHFLVTNQVFYRTRYSYALVNLKPLVPGHVLIAPLRPT
FT                   CVRLRDLTPEEHSDYFQTLQVVHQFIQAEFKAAALNIAIQDGPEAGQTVPHLHTHLIPR
FT                   YADNNIGDAIYDHLDRWSFEDQLADWQRRRAAYCGDEAARRELAKPDDVRKPRTADDMT
FT                   AEARALSAGLQSFLADHPALAPK"
FT   CDS_pept        complement(252226..253518)
FT                   /codon_start=1
FT                   /gene_family="HOG000246591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760233"
FT                   /locus_tag="AAL052C"
FT                   /orf_name="AGOS_AAL052C"
FT                   /product="AAL052Cp"
FT                   /protein_id="AAS50314.1"
FT                   /db_xref="HOGENOM:HBG124691"
FT                   /db_xref="HOGENOM:HBG395966"
FT                   /db_xref="UniParc:UPI0000252446"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EY0"
FT                   /transl_table=1
FT                   /translation="MAGKRRPKKARAPYRKYVAGQGFVHTYGVSSTESSAHDESGLFPA
FT                   DSGVQVSDDDIARRLVDMTLSASAAFAGGAAPIPYPGHSMVLPWELQFLVLSKCKTIET
FT                   HFMQVCRRWYIMCLPLIYRAPRLSSKNFYKFVETLVAARKQNYGQYVVDLDLSMIIQSG
FT                   KNSFVAKVLRRCSQHLEHFTAPQTSFGIAPLISLRSCSNLRYLDLGLLSETVKLKQLFE
FT                   AINGFQHLTHLSFPRSSIACEGFREVAWPQSLVYLKLSGGITNEFIREAALPHTIRTLE
FT                   FSFCPQVDEHSIYMLLSKTGESLEYLRFYYPMPALGDKSLDYVFRYCSNLLGVQLVVDY
FT                   CSKWAFSEHLLSPLAYPRPLRSIVLESSGSLGLSFKIHPDDITIAVAEDRLPCIRDVRI
FT                   SSRLGWDSHSSDVEDLVSVLDDRDANLYVKF"
FT   tRNA            complement(253791..253863)
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        complement(254282..256129)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760234"
FT                   /locus_tag="AAL051C"
FT                   /orf_name="AGOS_AAL051C"
FT                   /product="AAL051Cp"
FT                   /protein_id="AAS50315.1"
FT                   /db_xref="HOGENOM:HBG057949"
FT                   /db_xref="UniParc:UPI0000252447"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX9"
FT                   /transl_table=1
FT                   /translation="MFSVPHFDDMEELYSAYRPITPSLSNSRPSHSEQLKYSTQPTERI
FT                   PLHDFRRDSLELYGLKPKHYSVEDAESEPACEPAPDSSDTGSAPLQPRWKDWILEKRRG
FT                   IEELERQLDNFKLNGTENEIEEGSEDMRAKYKMFNPPAEYKFSPFEDHNEEAAEALSHD
FT                   DILSNMNHNIHRSRWAADKIRSNIDKFFLKNSELLEEPEVIPGAYPRDVVYIPIPVRGE
FT                   GDKERFEGDEYDKHVGPIIYLSYGILIPAAVKLCSFTLYHIVSLSRRDYTFSSICLESE
FT                   PLIIGLDKVITGLLSLFAVQQCLDYVITFPLACHTRYHLLKYGIEIIRDGGSDIIWREY
FT                   SREFLRFHNRALTEFRQKLQKKIWFSALIIAAFGLLSASFVSWIYAVTVTEDSFGTCLN
FT                   TILFGRAQLVAIIICFLGQTCYDLMAYIKHFIGEYAEDTMEMLMKKLDQYKQAQQDRKP
FT                   VETRHVSQGTEEMSGTVKGTTDGIKEQSSLRGSAKKSKHDVLLISTPDNSSSVVYHPQP
FT                   YVSPLKGRSSLNSRSLHLVDPASPPNTRRKKVPDAKSFRKAFAGKAQERIRWRVTKVER
FT                   DLLAISIYMVKLPFRVVFLPARMAMRILPWRLYISFNRG"
FT   CDS_pept        256489..258450
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760235"
FT                   /locus_tag="AGOS_AAL050W"
FT                   /product="AAL050Wp"
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50316.2"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057950"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI0001DB272D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX8"
FT                   /transl_table=1
FT                   /translation="MAESGEAMGAVPEAAESEAQVVSKNGPFRSYLPSTVYQAWRGERM
FT                   EQQGVVVWCGPAAFAALYVLCSGWLAACAGLAASGTETEMLEEIDAVRLGGFHIGVRPP
FT                   LGLHVLARLGLGLIGLRRLALLAACVVLQYLYKSLRCAGIQRLWAGAAVGCIALLEVFR
FT                   DAAVHASLEMYHAMFLAIILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLG
FT                   TWAWVLLLNSAHIFQLIGDLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSY
FT                   SSRDSSYMPTLFKAQLDGYQVVQPASVYYGSGVVIRHSSSIGGYLHSHELTYPGGSEEQ
FT                   QITLYDFEDANNKWTVEPVYNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPP
FT                   VSQRDYDQEVSCTGDSGYSGDSDETWRVDIQDAEYHEDLKPVLHHFSLVNKGQSCTLLS
FT                   HDVKLPEWALYQQEVICLASPVHKYSLFYVDSSEMMHNETMQLPRLSFPAKFWAYIHAQ
FT                   YKYDYFVKNFNATGDVPYLRWLVHISENKLQNCIWVAGLLSVIWWWLLFTYRCFTWNPW
FT                   DPAVAFEPTTLRSALYRDNSFEYVAGWFIHYIVFSRCSHGNLQIVQYLPALLFTTLQIA
FT                   NTFQTFSEWIHRLIVKLF"
FT   CDS_pept        complement(258487..258969)
FT                   /codon_start=1
FT                   /gene_family="HOG000001051" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760236"
FT                   /gene_name="SRB7"
FT                   /gene_synonym="MED21"
FT                   /locus_tag="AAL049C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 21"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50317.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG398241"
FT                   /db_xref="HOGENOM:HBG435513"
FT                   /db_xref="HSSP:1YKE"
FT                   /db_xref="InterPro:IPR021384"
FT                   /db_xref="UniParc:UPI0000252449"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EX7"
FT                   /transl_table=1
FT                   /translation="MLVQIPITTIPTADRRTKMTDRLTQLQQCLDQIVEQFGSAITYVD
FT                   RNHDFEPHNELEDKLSDPQATIAAAEDFDRNIDELTTDMILKTRQIIKLIDSLPGVDVS
FT                   AEEQLSRIDSLQKKLIQVEGEKIEAIKRKESLTKDIEELINEFTEGIANSRRLNKA"
FT   CDS_pept        259049..259588
FT                   /codon_start=1
FT                   /gene_family="HOG000000873" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777561"
FT                   /locus_tag="AAL048W"
FT                   /orf_name="AGOS_AAL048W"
FT                   /product="AAL048Wp"
FT                   /protein_id="AAS50318.1"
FT                   /db_xref="HOGENOM:HBG124413"
FT                   /db_xref="HOGENOM:HBG203755"
FT                   /db_xref="UniParc:UPI000025244A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX6"
FT                   /transl_table=1
FT                   /translation="MGRQVVGNDDLIGLLKKLSEYDVLLDRLQGQMADGFYNLSRANYH
FT                   NKDSLRGSYGRDYWDQTFAGTRFVRIEQDGVIVEDAGAKADKDETQATEGGLHNRRKDV
FT                   SKKEAAQRRQKTPLYMFGGALSVPSSLRMCQEHFQRCLPVVVRLVNCRREIDVLLDELE
FT                   RSAAAGTCADDISQTT"
FT   CDS_pept        complement(259746..260891)
FT                   /codon_start=1
FT                   /gene_family="HOG000000874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760237"
FT                   /locus_tag="AAL047C"
FT                   /orf_name="AGOS_AAL047C"
FT                   /product="AAL047Cp"
FT                   /protein_id="AAS50319.1"
FT                   /db_xref="HOGENOM:HBG057952"
FT                   /db_xref="HOGENOM:HBG203246"
FT                   /db_xref="UniParc:UPI000025244B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX5"
FT                   /transl_table=1
FT                   /translation="MCSRRATGSGCRSKMDAHNNLPQIKSIWIDEDEEAEKLYGLQAQQ
FT                   MMDSDDEELLGVVTLNSEQPVLNNKTRIELPPLPPSAYELKKSQSAMDLLARKKQKWKQ
FT                   FFLGRREARGRMSISVPFAFQHISHADGRLYEEEAAAEAAVPAGGGFSKAFVTDALPPT
FT                   ASPLEDARARRSVSSLSGRSSRRTSRASASLSTARVVSTSTMATSVLELAARPPEKLGQ
FT                   LERAHLEGRIGRLPSESGSMDELQRYHFPTVREEPPAAFETPRVRGEDKFGWDTPDNAR
FT                   TLTEHMLEQLQGSPAVPATVGTPRRKSDSALTPILCMKETFTESQTPNERRSVDDVLLY
FT                   YHQGSETDSTLTGPSNRFSFVGGSPKLPHPPAVHREGDAYM"
FT   CDS_pept        complement(261327..262145)
FT                   /codon_start=1
FT                   /gene_family="HOG000157793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760238"
FT                   /locus_tag="AAL046C"
FT                   /orf_name="AGOS_AAL046C"
FT                   /product="AAL046Cp"
FT                   /function="ribonuclease activity"
FT                   /biological_process="tRNA processing"
FT                   /protein_id="AAS50320.1"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG135833"
FT                   /db_xref="HOGENOM:HBG396045"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniParc:UPI000025244C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX4"
FT                   /transl_table=1
FT                   /translation="MLVDLNVPWPQKSYDAKPSAQDLDQLKRTLTTLHALGYTHVALNF
FT                   TVPHSTSFPKASDQLNPIDLAALADVRAATGLRLYTRLTLVVDDPARGQALARVAAAFD
FT                   IVAALPVSERGLALAAGGLDVDLLTFHYGQRLPALLKHKTVCGCVRAGLKIELVYAHAL
FT                   RDVPARRSFVVNCKTVIRAARARGLVVSSGARSPLECRNILGVAALLRHIGLKDDRCSR
FT                   AMRDLASLALLNGRLRSKSYRHTVRAAPVPKRPRSPDAGAADNHKKPRDA"
FT   CDS_pept        complement(262389..264965)
FT                   /codon_start=1
FT                   /gene_family="HOG000065939" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760239"
FT                   /locus_tag="AAL045C"
FT                   /orf_name="AGOS_AAL045C"
FT                   /product="AAL045Cp"
FT                   /function="DNA binding"
FT                   /protein_id="AAS50321.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG057953"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI000025244D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX3"
FT                   /transl_table=1
FT                   /translation="MERGTTAGTGEAMAAELQAQAAAVARLHERLQTLEGLLPEQDEVV
FT                   TQTLDTLTATAKNLAHNQRALETKLDDLLKNQTNTDMAINELSGRLESLMGLFGNGGLG
FT                   VVVGPPGGAQCGAAPPASRGPGRPKKNQTFVTTNLPNGASYSRIQLPLNNINIPKSRKH
FT                   FTDPNQEPPKKETTGTQPVAPDGTLPPPRRRGRPPKNRKNLATAAVSTGPVAAASGGQV
FT                   SSTSSKRASAEPTGVSAAQQRKANSEEAPVRGRRAAALSGSAVSTRGSRRRSTRARRQK
FT                   NFYDEESDESEELSNSEVSEESDLDKDEDDNGNDASYEESSARKPAQRVPKLKEKEKVK
FT                   HEDEDEDDLSESPNSLSKTRRQLELERRRDPREKMLVSMKYSDRDKAKSFMESNKDLLK
FT                   AMKEEERKKRMTAINYEPIYNNSLQQTIRQVQSNAAGIIPPLSSSTLVPIPQSSDSNRT
FT                   ITADASTLSIPNTEPRRMGILSMLNSHEPSPSQAATGPSLEVAESSTTSVAPQPPIAEI
FT                   TATTTPVRSPSSSSHKRSVNDTDPLEDTPIKRQKNSPNAAATSIIPQSAPTTGYTTGYT
FT                   TMTTTMTPSSELTKNSAQAAARGRPSNASNGSDNSAALLMASPIELVCKDGYFYRRNDL
FT                   TTPITTGNYLGMKFKNKEEELIKMTMHEEDYAELTRQDRINAYFMKPDIDIETEYACQV
FT                   LSNVTLTEKYVNSLEYFLMEFRWENRLVSLGLKLRESKRTWQRRKALFALFEFWRDKSR
FT                   EKRGFRDFTILHAVKEMENYRVFINRSVSWFYNHITLLKMILFDLCDNTDTQWREWMFP
FT                   KGSAVPVETADAGVTKQNINQFIDSMLTLDFLEDGTENLHTKSSAA"
FT   CDS_pept        complement(265544..266593)
FT                   /codon_start=1
FT                   /gene_family="HOG000000875" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760240"
FT                   /locus_tag="AAL044C"
FT                   /orf_name="AGOS_AAL044C"
FT                   /product="AAL044Cp"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50322.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG123980"
FT                   /db_xref="HOGENOM:HBG397471"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000025244E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX2"
FT                   /transl_table=1
FT                   /translation="MATAPTVHIIGFGSIGGLIGVHLQCAGIARVVPVLSSPARAALFH
FT                   ELGSKATLDSVHCPETPPLSAYFPAAVSTSDLQETGSPIDHLVITCKAQHTLAALRPVW
FT                   PLLHNGSTIALLQNGLGVAELLRAEASRRGLSPTLFQGVVTHGAHRDSHWNLHHAGKGQ
FT                   LLLACLPRDPTSIIQAPATVARARASPLAAALLRTPLDAALLPYQQLLPRQLEKLVVNA
FT                   CINPLSALLDCPNGALVPQRELFAAIAAEAAPVLRSAYSALFSSTTGPPPADPDLLAPE
FT                   RLSEKAAAVAVATASNSSSTREDVRAGRTTEIDFINGYIVDLAAAAGLPASAVRLNRAL
FT                   QLLVHALRR"
FT   CDS_pept        complement(266845..268461)
FT                   /codon_start=1
FT                   /gene_family="HOG000184645" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930531"
FT                   /locus_tag="AGOS_AAL043C"
FT                   /product="AAL043Cp"
FT                   /function="ATP binding"
FT                   /protein_id="AAS50323.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniParc:UPI0001DB274A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX1"
FT                   /transl_table=1
FT                   /translation="MSAPIIGIAFGNTSSSIAYVNPKKDVDVIANPDGERAIPSCLSYV
FT                   GDDEYHGGQALQQLVRNASNTIVNFRDFVGLSYAECDGNRCATGAPLVDLDGKPGFLIA
FT                   RAGREERLTVDEVVTRHLRKLREAAEDYIGQSISQAVLTVPTNFAEKQKSALRETASRA
FT                   GLEVVQFVNEPSSALLAHVEQFPFDKDVNVVVADFGGVRSDAAVVAVRNGIFTLLATEH
FT                   DATLGGALLDEELIEFFAKDFEAKNKCNPRKNARSLAKLRASAEITKKTLSNATSATIS
FT                   IDSLADGFDYHNSVNRMRYELVANKVFSKFTQSIQNVITKANLDVLDIDAVLLAGGVSF
FT                   TPKLTTNLEFLFPESVQILGPQHKNATNNPNELLASGAALQAQLVSSYDADELAQALQP
FT                   IVINTQHLSKNIGVLDAAGKFVPILLAESSYPIRKTVRVEDATGDILISVYEGTSIAKE
FT                   TVVEPSAKDEPEDEEESEWSDEDDEPEVIREKDYVIEAKLMDLGIKNVKGLELSFTINK
FT                   DGVLTVAAKDLGSSNAVKGSL"
FT   CDS_pept        268820..270649
FT                   /codon_start=1
FT                   /gene_family="HOG000248691" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760241"
FT                   /locus_tag="AAL042W"
FT                   /orf_name="AGOS_AAL042W"
FT                   /product="AAL042Wp"
FT                   /protein_id="AAS50324.1"
FT                   /db_xref="HOGENOM:HBG271041"
FT                   /db_xref="HOGENOM:HBG434250"
FT                   /db_xref="InterPro:IPR005607"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013876"
FT                   /db_xref="UniParc:UPI0000252450"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EX0"
FT                   /transl_table=1
FT                   /translation="MSHSGAAVFKKVSGMLLIDEESNPAILTWRSTDGDKSHSVMLNTI
FT                   NKLQATPASSDKMMLRLVGKVSTAKRLKDEDGGEAEPKPVVHMFTFNNRIVMDNIKETL
FT                   QHIISRYKDEEVYEEKRRKEGSDAPTPQAEAPLINTTALDDSLSREKLLVNLKLQQSLL
FT                   KENRTLMKTFQEAVIKSGLPPQEFWATRIPLLRAFALATSQKTGPYNVLSTIKPVASSD
FT                   NKVNVSVSREKILTIFQNYPIVKKAYDDNVPKNFKEQEFWARFFSSKLFRKLRGERIMQ
FT                   NDRGDMIIDRYLTLDQEFDRLDDEMLLHPIKKLLDLEGNQNDDPEKRGNRPHFTMLPGT
FT                   DPNGNNDGSVDILKGMNRLSEKMIKSLENEYSRVNLQMQDLDKEEREEILFSDLEEEGK
FT                   TEYEEIYLRQRSPTSETDTNPAMTSTSTAEDIKNEINSITGDLQGTLDLTAVGKINSQT
FT                   AQRINRQVMKAVKVNAKQAKHLRFDSTMGAFLSSQTTDSQEANSNLPPDILESARVLHG
FT                   TCCEFLKHFYNHFQSGEPKSGVIVKKLYGHLKECTHKVENLLTTASQSDSEQDVAALCS
FT                   AYLNPALLSINLAIEKYDAAVEEIESYNKAEDV"
FT   CDS_pept        complement(270726..272186)
FT                   /codon_start=1
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081826"
FT                   /gene_name="RRP3"
FT                   /locus_tag="AAL041C"
FT                   /product="ATP-dependent rRNA helicase RRP3 "
FT                   /EC_number="3.6.4.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50325.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB274B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EW9"
FT                   /transl_table=1
FT                   /translation="MSKVTKQSKSHKSSELVSLAEKIKQKALENRKQSREESQATEEAN
FT                   TASETEAAVIEETAEPEEGFSSFRELDLVPELIEACDNLNFTKPTPIQSKAIPPALQGK
FT                   DIIGLAQTGSGKTAAFAIPILNRLWHDQQPYYACILAPTRELAQQIKETFDSLGSLMGV
FT                   RTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFALRKLQFLVMDEADRLL
FT                   DMEFGPVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTL
FT                   VQTLIVVPGGLKNTFLIYLLNEFIGKTTIVFTRTKANAERISGLCNLLEFSATALHGDL
FT                   NQNQRTGALDLFKAGKKSILVATDVAARGLDIPSVDLVINYDIPVDSKSYIHRVGRTAR
FT                   AGRSGKSVSLVSQYDLELILRIEEVLGKKLPKENVDKSIVLSLRDSVDKANGEVIMELN
FT                   RRNKEKQTRGKGRRSRTATRENMDKEEE"
FT   CDS_pept        272443..273765
FT                   /codon_start=1
FT                   /gene_family="HOG000210038" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081827"
FT                   /locus_tag="AAL040W"
FT                   /orf_name="AGOS_AAL040W"
FT                   /product="AAL040Wp"
FT                   /protein_id="AAS50326.1"
FT                   /db_xref="HOGENOM:HBG025554"
FT                   /db_xref="HOGENOM:HBG749683"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0000252452"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW8"
FT                   /transl_table=1
FT                   /translation="MAKRRHKNRTHVKPSEEELKQIPKSMVIRVGQTSLSNHSLNQLVK
FT                   DFRMIMQPHTAVRLKERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVSLKVARTPQG
FT                   PTVTFQVLDYSLGKDIKRFLKHPKSLGKDDILNPPLLVLNGFDIKNEDEGRANVEKVVV
FT                   SMFQNIFPPLNPARTQLSSIRRVFMINKDQETGELSLRHYAIDIRQVDISRNLKRLYRS
FT                   KNKLNKSVPNLHKKDDIASLILDHDVGAYTSESEVDDDAIVRIIDQRDTRVAAKEPVAA
FT                   NGEEDGDVDMEDAQDDDVEEPALEDDTPQPKKRAIKLTEVGPRLTLKLVKIEEGICSGK
FT                   VLHHEYVQKTDAEIRALEKRHAQKLKLKEQRRKEQEENIARKKAVKDAKKQRKLERRKL
FT                   RETAPEGEKPAESSADDSSSEDDYSDVPEDLDSDLFSEVDN"
FT   CDS_pept        complement(273870..274721)
FT                   /codon_start=1
FT                   /gene_family="HOG000065938" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930532"
FT                   /locus_tag="AAL039C"
FT                   /orf_name="AGOS_AAL039C"
FT                   /product="AAL039Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50327.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057954"
FT                   /db_xref="HOGENOM:HBG398814"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0000252453"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW7"
FT                   /transl_table=1
FT                   /translation="MQQEHNLEAINNFAIWQNDDLVSNCLHCHLKFTFLLRKHHCRCCG
FT                   GIFCASCTQHFEHYDLSKVKVLQRCEGTVETAPYRTCDSCYENLLQRGLLAGAQDGPAG
FT                   QVAGSSLREGVGDVEEPARKLVKDDTVRETVAEHGSEHSSTAVSVRARPEEYDHCPLCN
FT                   ADLSGDPEDTAAEHVQNCIARATSVQQHLVCESPGPMSYQNRILVSIVPGYTEGGGRLP
FT                   ECPICFEDMEPGQKVGRLECLCVFHNECIQMWLERKSRKTRSGGWPARSPKNFCPLHDA
FT                   IV"
FT   CDS_pept        274925..275836
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760242"
FT                   /locus_tag="AAL038W"
FT                   /orf_name="AGOS_AAL038W"
FT                   /product="AAL038Wp"
FT                   /protein_id="AAS50328.1"
FT                   /db_xref="HOGENOM:HBG057955"
FT                   /db_xref="HOGENOM:HBG104135"
FT                   /db_xref="UniParc:UPI0000252454"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW6"
FT                   /transl_table=1
FT                   /translation="MGGKSGHLRLLGRLGGTAAGANVGRGGCGAARERDYTVDLGRRVV
FT                   SRMRETVRRRPTEEFEALIGVHGERRTELGPGEHLLFFNPRDVAASADGYHEYVTPGAI
FT                   TGAVRTFRRRMWAQGTVEWLRPLSHGVEYECTERVRFVREVGGTHYVGLQRDIADGAGT
FT                   ALRELRTLAYATGAPDGPRREAVAVPATCTGCVLEHEVVAAYSRLTLNPHRIHLDRKYC
FT                   ASEGYADLVVQGPLSLQLALKTVEQQGFAGLHGVRYKNTNIMYAGTAIEVCIGVPSGGK
FT                   LALWIRDAVEHDVNYLVAEVAL"
FT   CDS_pept        complement(275833..276669)
FT                   /codon_start=1
FT                   /gene_family="HOG000001053" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777562"
FT                   /gene_name="IPK1"
FT                   /locus_tag="AAL037C"
FT                   /product="Inositol-pentakisphosphate 2-kinase "
FT                   /EC_number="2.7.1.158"
FT                   /function="ATP binding"
FT                   /function="inositol pentakisphosphate 2-kinase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50329.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0035299"
FT                   /db_xref="HOGENOM:HBG057956"
FT                   /db_xref="HOGENOM:HBG203249"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniParc:UPI0000252455"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EW5"
FT                   /transl_table=1
FT                   /translation="MVKIIGKGGANYVLAFGNDNDDLYRICVRGRSLRENNRSTVDNYH
FT                   YALEVVKPQLGEFVCRMELVDLPVCDSLRQVLKSKIEVWDATTVTCLKMPNLVPAGSLS
FT                   HTVDHFTKIHIGERAIVWEFKPKWLSGNDKYCRNCTLNLLRGQTSISYCHAQLLNPGQA
FT                   GPILKSLFAGLNVPPAFIEDMEAYIAQPCSVLQRLRVAQEQVDASLGPLDQPDTAASPE
FT                   RCLSMTLKDVSCFVSWHKDASPVAVVVDLDMKPAAKSAHWTALQEQLDRFQPQVRH"
FT   CDS_pept        276851..277999
FT                   /codon_start=1
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777563"
FT                   /gene_name="DYS1"
FT                   /locus_tag="AAL036W"
FT                   /product="Deoxyhypusine synthase "
FT                   /EC_number="2.5.1.46"
FT                   /function="deoxyhypusine synthase activity"
FT                   /biological_process="peptidyl-lysine modification to
FT                   hypusine"
FT                   /biological_process="spermidine catabolic process to
FT                   deoxyhypusine, using deoxyhypusine synthase"
FT                   /protein_id="AAS50330.1"
FT                   /db_xref="GO:0008612"
FT                   /db_xref="GO:0034038"
FT                   /db_xref="GO:0050983"
FT                   /db_xref="HOGENOM:HBG042306"
FT                   /db_xref="HOGENOM:HBG716221"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="UniParc:UPI0000252456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EW4"
FT                   /transl_table=1
FT                   /translation="MSNNDETVLGHLADHVFKHSGPIPESFVEVKGIDYSKPDAIDMRA
FT                   SDLIKSMKTMGFQASSLGQACDIIDEMRAWRGKHIDELDEYSRKGSFDENGFQKSTIFL
FT                   GYTSNLISSGLRETLRYLVQHNMVSAIVTTAGGVEEDIIKCLAPTYLGEFTLKGAALRD
FT                   KGMNRIGNLLVPNNNYCKFEEWIVPILDAMLAEQEAYVAQQGKDCLGVNTDVDSPIWTP
FT                   SKLCDRLGKEINDESSVLYWAHKNKIPVFCPAITDGSIGDMLFLHTFRASPQQLRLDLV
FT                   ADIRKINSMSMEASQAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFDGSDAGA
FT                   RPDEAVSWGKIKVEAKSVKVYADVTTVFPLIVAATFANGKKN"
FT   CDS_pept        278192..279550
FT                   /codon_start=1
FT                   /gene_family="HOG000248168" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760243"
FT                   /locus_tag="AAL035W"
FT                   /orf_name="AGOS_AAL035W"
FT                   /product="AAL035Wp"
FT                   /protein_id="AAS50331.1"
FT                   /db_xref="HOGENOM:HBG057957"
FT                   /db_xref="HOGENOM:HBG397038"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI0000252457"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW3"
FT                   /transl_table=1
FT                   /translation="MLSAIASARQRIGSLAQGPVFGRSIAAVRHKGHLPPFGAKVSRPK
FT                   TKEELQKERLEAALRSPNKLVRWGAYFQTEEFNKAMTKYLFAVYGLFLIYGIYYMKKLY
FT                   TKEKERDALEEKAADGHINEYESLRLKQLQGKLRTRDERKLELYNALKDKHPDWDSEDY
FT                   DGVEFEVEDLNKINRHILPARDTTEFYDEKAEEYDRSVRMEEMAIRMGKRRKWLMKHCE
FT                   GDVLEVASGTGRNIDYLDLSKIDTITFLDASKNMMKIANKKFREKYPHFKQAAFVVGKA
FT                   EDLVDLATGHSPQQQNLELVNSPEQVIPESKPKVKYDTIIEAFGLCSHHDPVRALKNFA
FT                   KLLKPGGRIVLLEHGRGTYDVVNKILDKRAEHRLETWGCRWNLDIGEILDDSDLEIVTE
FT                   KRTHLGTTWCIVAKRKGDMPKKEEIGFLEKYIRPSLRSSMPPADDKPRESTKN"
FT   CDS_pept        complement(279633..280688)
FT                   /codon_start=1
FT                   /gene_family="HOG000193685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625004"
FT                   /locus_tag="AAL034C"
FT                   /orf_name="AGOS_AAL034C"
FT                   /product="AAL034Cp"
FT                   /protein_id="AAS50332.1"
FT                   /db_xref="HOGENOM:HBG351773"
FT                   /db_xref="HOGENOM:HBG735314"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0000252458"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW2"
FT                   /transl_table=1
FT                   /translation="MSEVITIRKRRGFQFHRSQYLDDEEEEFDLDVEMEGADSSVIMTP
FT                   GELITDDPVWMRGHGTYFLENKTYSSVAGTVSRVNRLLSVIPWRGRYTPETGDHIVGRI
FT                   VEVGNKRWKVDIGGKQHAVLMLGSVNLPGGVLRRKSESDELQMRSFLKEGDLLNAEVQS
FT                   LFQDGSSALHTRSLKYGKLRNGMFVRVPSSLIVRSKNHTHNLPGNVTVILGVNGFVWLR
FT                   KTSDIDLSNNHHGSTVSGKAANTLAGVASGEYKPGANSVSITRLEEESSWEIYSDKNDP
FT                   IPSNIRNTISRYANVIKILAHCEIGITEARIVASYEASMAYGNVGSLIETETMDAIGQD
FT                   VINGEKMRGNA"
FT   CDS_pept        280845..282314
FT                   /codon_start=1
FT                   /gene_family="HOG000195270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760244"
FT                   /locus_tag="AAL033W"
FT                   /orf_name="AGOS_AAL033W"
FT                   /product="AAL033Wp"
FT                   /protein_id="AAS50333.1"
FT                   /db_xref="HOGENOM:HBG026728"
FT                   /db_xref="HOGENOM:HBG592917"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniParc:UPI0000252459"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW1"
FT                   /transl_table=1
FT                   /translation="MQRLVKNFSKMALPARYLPPVHRGITQLDKSVFTRSIPLVVVSFP
FT                   DPRNISVFSKRFKDEILRVPRVPHVVRLVDSPARVDGLPPLKKQMVANDNHVAKGVLLK
FT                   DSVHRVEDVKQQLSADAQAFLDECGAAVRDYNYTLDYEFYHADEILRSVLPEEFLDEVP
FT                   SGFTATGHVAHVNLRTELKPYGSLIGQVILDKNRQIETVVDKVDAIASQFRTFQMNVLA
FT                   GRPDLVVSQRESNCTFTFDFSKVYWNSRLHTEHERLVRLFEPGQLVADVFAGVGPFAIP
FT                   AAKKEVLVLANDLNPESFRYLRDNIAANKVDGFVRPKNLDGREFIRSSPALLRDWTAQT
FT                   GGSVTVAPARRRRGAPPAPPRIVTLPRYFHHYVMNLPDSALSFLNEFAGLYSRHGISED
FT                   AAADPAFVLPYIHCHCFEKYSPDEPEPAPADLHARIHRRVLEIMHTSADILPMTALSFH
FT                   LVRKVAPTKPMFCVTFQLPQSIAFSPLATTT"
FT   CDS_pept        282816..283550
FT                   /codon_start=1
FT                   /gene_family="HOG000141843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760245"
FT                   /locus_tag="AAL032W"
FT                   /orf_name="AGOS_AAL032W"
FT                   /product="AAL032Wp"
FT                   /protein_id="AAS50334.1"
FT                   /db_xref="HOGENOM:HBG057958"
FT                   /db_xref="HOGENOM:HBG104136"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniParc:UPI000025245A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EW0"
FT                   /transl_table=1
FT                   /translation="MQEEGFRELPGLTAAPLPPSPGVGNGGGARGAVDGARKSPTRLMQ
FT                   VIATLLAALTFNYSNQRINNSKHSLLQFLAEIVRRSKSSRGVTVLATYYFHRLYQYRLK
FT                   SLPLAQVPEFARSSKRMFLCSLILAHKFTQDSTFSMKAWSTITGLPPKDISTMERWALN
FT                   QLQYRLYVSAEDLDRWTEDVLFMNCRSEPVHLHSGECCKSARDPGDVHSGECSKRARDS
FT                   DEADPRQDSPWDCVKRLHRCVT"
FT   tRNA            join(complement(283694..283732),complement(283640..283675))
FT                   /gene_name="tRNA-Phe"
FT   CDS_pept        283888..284307
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760246"
FT                   /gene_name="FYV6"
FT                   /locus_tag="AAL031W"
FT                   /product="Protein FYV6"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50335.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG057959"
FT                   /db_xref="UniParc:UPI000025245B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EV9"
FT                   /transl_table=1
FT                   /translation="MDPLDVEDEVDESDTTSLQAQLRQNAIRKQEQFQQEIQERNSMVN
FT                   RMSAEALQYFNQLHKAECSKKEELQTYIDENLKVFEKKQKRAQAPTKNNERSSSTHAAL
FT                   EEHKAASVTKKKLGIVKKGAPRKTKIRLPVRKSPN"
FT   tRNA            join(284532..284569,284600..284643)
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        complement(284742..289361)
FT                   /codon_start=1
FT                   /gene_family="HOG000141764" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625005"
FT                   /locus_tag="AGOS_AAL030C"
FT                   /product="AAL030Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50336.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG057960"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI0001DB274C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EV8"
FT                   /transl_table=1
FT                   /translation="MGNARCEKAFSLKDDGRLRKRMAAADMGKAVADVRQEGATAGAGR
FT                   GQHTGRAAGAAQRAAHFAVAVGRGQVTAQQLPPGPGPAPERGGRRLRREAECEVPLAEF
FT                   RVWCGAERPADAYTAEDVVVDYVRTERRERLLAARQQGLELRCTLAPLAEAQEALLEAI
FT                   SLKCFEYELRREQWAAKAAAARPEKRRRRRGQRAAVRLPAAYQDVEVCVCELQWNKSGD
FT                   WCLVMQVSLWCLRNSVNHFSTDTNELLDMLYGSDQYHSSKLEVPRTYVQHQFLHQVARY
FT                   TRQTLTGSGDLAHVPQLKVELLPFQQESVQWMLEKETVKKTYGRSDEELLSFLNEQISY
FT                   GYHKLSGDWFWNKLSGYVITEADVLLLYQAYLRDEIHAKGMLSEEMGLGKTVEVLALLL
FT                   LRPRAMDPVEEQVYEVVSTGKRMRRVKTNLIVCPQVIVQQWLDEIAKHVDGSLKAYHYR
FT                   GFANIKEEFNTENISELVATLSEYDVIITSYATVSAEVHYAEYSTTMRSRRHKSPKYDY
FT                   SSPLSLMQFFRIILDEVQMLGSESTNAARCTNLLQRIHTWGVSGTPIHSLADFKVVFSY
FT                   LQLHPFQDSPKYIDTVCQNTRKLGNNRMHLDPAQIRKLQRVNGVTFTARELLDIIPRFN
FT                   LCIRHTKNDVEYQIKIPKQHHYLIQLQFSPIERDNYVNLWKSFLEASGYDSDGQGPCYL
FT                   GPAVLNYWLSQLRKTCCHAMMSVLGFSSNEAGNLSALGKGALKSSVNLPNMNDVLKYMI
FT                   DDVQDKIDSLCVENYSLKIQSAQVRMELEELPSEAIRILKDVENQLITDFKTNLGISDP
FT                   YATSVTGQAQRNNKAADEVGSKKKNKIRIYMDFLHQCTFFIATAYYFMGSKKLEKVDED
FT                   NEKLDQLGQAEAKQQYTDIYSAAELHEITEIQELEHSYYDIAEKLRKQILVASAGKVED
FT                   EIQLVRKYLNSKRVADKTQLRHIEFQQEDLSSNMTVASCYKTMADIFQRMNQGIAQFNG
FT                   LLKELEEVCMKPINHEYDDNDAEAKAQDYENSINDQDKIFALLDCLERILSNRDEIITS
FT                   DEEVRIPKVSSLVKDVTSDYHRELLKQVQFVGGTPLKQIFADLKNVSIVMGLTVDGEAK
FT                   TESFESYLLSFQSQPQIIKKENHQMREILKRFNSIYNAKTAYFSNLQKISDSLVSIIQL
FT                   EPSVRATILRNTRGDSMYLKNIQKISTLQSRLKYLQNLTKLEQALKDNKRFNCTICLCD
FT                   ICDGAIIGCGHFFCQECISSWLETKQSCPLCKTQTKSSELYSFKFREEETELKHVLVAD
FT                   ADSRPTPSQEVISQAVQSIENDPIYLNKYEVCPYLDRIRQLETSVNYGSKIDFVIKLLK
FT                   YLRLQHETNPTSPALQIVIYSQYAELLEIVAHVLKQNSIKFLTTTKNVRNFAKVVETFK
FT                   ADPEITCLLLDTKRQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWH
FT                   FMLLNTVEHSILRYKSILEKNKGDSTKGTRQQGGGLRVVSDEDTLSDPESEAENAYNIN
FT                   QAGDEAVSEEHLWHCLFQK"
FT   CDS_pept        289973..291577
FT                   /codon_start=1
FT                   /gene_family="HOG000183591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760247"
FT                   /locus_tag="AAL029W"
FT                   /orf_name="AGOS_AAL029W"
FT                   /product="AAL029Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50337.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG738506"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020650"
FT                   /db_xref="UniParc:UPI000025245D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EV7"
FT                   /transl_table=1
FT                   /translation="MPVDSPHSEDIVLNISLRQAEAEPEGGAAGARRTEERGPAVAEQA
FT                   AGAEPAGARSGGLESEESLSEEEDEEEDEDEEPEGVFPEQSELAGYKLLGKIGEGAFSE
FT                   VYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKREEAGENKATSREQ
FT                   VLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIVRLTYFSEDLSRH
FT                   VIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQSDDPKTKQDEGLFRP
FT                   GIGGGGIGVIKLADFGLSKQIYATNTTTPCGTVGYTAPEVVKDERYSMKVDMWGIGCVL
FT                   YTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAVRRLLEVDPDKRYDI
FT                   DEFLADPWLNSYDCNVLRPLVPLDRRKRHAHNHSHKPYKKDSTLIYSPAAVAMRDALDI
FT                   SNAVQREEEAKHMTPGGHQLGALREDEEESAAAFGDLDHNMFQLRLNSSTILKRRNQKK
FT                   PAQEGIGVNIPMTVEEI"
FT   CDS_pept        291792..294926
FT                   /codon_start=1
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760248"
FT                   /gene_name="TEF3"
FT                   /locus_tag="AAL028W"
FT                   /product="Elongation factor 3 "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="translation elongation factor activity "
FT                   /protein_id="AAS50338.2"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG056255"
FT                   /db_xref="HOGENOM:HBG325362"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI0001DB274D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EV6"
FT                   /transl_table=1
FT                   /translation="MSDSAQSIKVLGELFEKLSVATAENREATATEIASFLNGNIIEHD
FT                   VPEEFFKNLTKAVKDKKTAAAALETIAHIANENNLSPSVEPYIVDLVPEVCVKTGDKDK
FT                   DVQSIASETLLAIVKAIDPVAIKVILPHLTKSLVTTNKWQEKVSVLAAISALVDAAKTQ
FT                   VALRMPELIPVLSEAMWDTKKEVKHAATATMTKATETVDNKDIERFIPELIQCIADPSQ
FT                   VSETVHLLGATTFVAEVTPATLSIMVPLLNRGLAERETSIKRKAAVIIDNMCKLVEDPQ
FT                   VVAPFLEKLLPGLKNNFATIADPEAREVTLRGLKTLRRVGNVSDDDTLPEVSHAGDIVT
FT                   TRGVLDELTKDTPIAPRFAPVVNYIAAIAADLIDERIIDQQAWFTHVTPYMTVFFHEKQ
FT                   SKEIIDDFRKRAVDNIPVGPNFDDEEDEGEDLCNCEFSLAYGAKILLNKTQLRLKRARR
FT                   YGLCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTQADTSVLDFVFQGDV
FT                   GTREVITEKLREFGFSDEMIAMPIMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT
FT                   VNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTA
FT                   KSYYELGASDLEFKFPEPGFLEGVKTKQKAIVKVSNMSFQYPGTSKPQIADINFQCSLS
FT                   SRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENCRIAYIKQHAFAHIENHLDKTPS
FT                   EYIQWRFQTGEDRETMDRANRQINESDAESMNKIFKIDGTPRRIAGIHSRRKFKNTYEY
FT                   ECSFLLGENIGMKSERWVPMMSVDNAWLPRGELIESHSKMVAEVDMKEALASGQFRPLT
FT                   RKEIEEHCAMLGLEAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLDRD
FT                   SLGALSKALKAFEGGVIIITHSAEFTKDLTEEVWAVKDGIMTPSGHNWVSGQGSGPRLE
FT                   KKEDEGDKFDAMGNKIATGNKKKKLSSAELRKKKKERMKKKKELGDAYVSSDDEF"
FT   CDS_pept        join(295234..295347,295418..297379)
FT                   /codon_start=1
FT                   /gene_family="HOG000074554" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625006"
FT                   /locus_tag="AGOS_AAL027W"
FT                   /product="AAL027Wp"
FT                   /function="phospholipase activity"
FT                   /biological_process="phospholipid catabolic process "
FT                   /protein_id="AAS50339.2"
FT                   /db_xref="GO:0004620"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG057962"
FT                   /db_xref="InterPro:IPR002642"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI0001DB274E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F84"
FT                   /transl_table=1
FT                   /translation="MRLTIVITAFALLGNALSNFYTPHGVMCPREDLIRNSNTGLSEQE
FT                   HSYIKNHHYLTQNHLIKFLQNASIPDFDINDFLHKTSQRPINLAIAVSGGGYRSMLTSS
FT                   GFLLGMHSRGLFNCASYIASISGGSWTLMRLLLTNFNIEELKEWNINSSLLEGVPNFEI
FT                   KNRDIIQQFEATANSPESITHTSQEVFMDEDFYSELQDQASIWKRSLALGPAGELPTFS
FT                   EFYDRLERSWAQLDHSPHHKRSIDTLLKLKETFEDVFKADSEDGEVNQIRKLEEMMDSF
FT                   SSFRKVLSFYIDLHSEVRPKKIMGFPVSFTDYWGRALWKKIYVNESMISSMSELFARSE
FT                   ITNNYEAPLPIIIANCKNEDLVNAVFEFTPFEFGSWNRLLGLFVNLKYLGSNFTEGVAQ
FT                   SCVQGFDDIGFITATSSSLFNNVLIYAWKLASESSLKTMKAIRALFSTFGVNLKNKPNS
FT                   FFGTRSDFALFQPNPFYRYPGVDSPLTNSDKLYLVDGGEDGENIPLRPFLQPERQVDLI
FT                   FALDSSSGRINYPTGGILRNLYDNLHATDGAAAVVQTGDVQSVTDLLPYIPSAEEFEAK
FT                   GLLKRPVAFGCYPESYHIRNASATAAPGKLPPIVFYHANRNSTYNSNTSTFKLRYNHSE
FT                   VQGMLENGASLFTHDNNTAYFQCVGCLVVKRAYDNVNASAKLPPTCQQCFRRYCYN"
FT   CDS_pept        297668..298921
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930533"
FT                   /locus_tag="AAL026W"
FT                   /orf_name="AGOS_AAL026W"
FT                   /product="AAL026Wp"
FT                   /protein_id="AAS50340.1"
FT                   /db_xref="HOGENOM:HBG057963"
FT                   /db_xref="UniParc:UPI0000252460"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F82"
FT                   /transl_table=1
FT                   /translation="MVQRGRGGRDAAVGAAHGHGHMRQLYELVYNGGAVGTVTLRPDLP
FT                   RHGTLDPSNVVCTLVELYHSIPGDIPLIKTHSIAGWVFLNEVEPGNLIVWGKSDMRVVV
FT                   DPMEMSAQQEQAALLGGVGYGHWSELEDVAAAAAAAAAAAAGASAHAHAGAGSHVGTAV
FT                   GGPGTGPLAHNAHAHQHTHQHAHHHAHQHRHSGMVNLTRFNSAPPGIMEFQTPEQVKDY
FT                   IQRIYAFQERIGIVCLKTKDYKSKVTRIDFGCEFYGTRAGKTAAPNDISPGGAANGDSD
FT                   EHRTRSTHHLGSGTKRCPFFIRYRYQSAKDNYYLDEACSNLDHDHDRVDVWNYNTNKRL
FT                   LIKEYKRQLIQLMSSSDNVSSGDVIRLLVSEASKDDLYKGYFSNNTRKKDFAKAMRKNC
FT                   EYFRRSYLDKRSFDGQVT"
FT   CDS_pept        299329..300015
FT                   /codon_start=1
FT                   /gene_family="HOG000175945" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930534"
FT                   /locus_tag="AAL025W"
FT                   /orf_name="AGOS_AAL025W"
FT                   /product="AAL025Wp"
FT                   /function="calcium ion binding"
FT                   /protein_id="AAS50341.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG057964"
FT                   /db_xref="HOGENOM:HBG397303"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI0000252461"
FT                   /db_xref="UniProtKB/TrEMBL:Q75F83"
FT                   /transl_table=1
FT                   /translation="MRLLELGLVFGGLLGSVRCMPHGDKIHTEVERPPEGKNWEQWHME
FT                   HEHQMAEYTPEKFFNLHDTNGKGYMDERDILSLYGLSRPEVVGTGDGMGQHDDSERIDE
FT                   ETANRIVKLIGELLDTNDDGKVTKAEYLNFAKRGKSFPDLGVGVGHHLDFEKEFNVHHW
FT                   NTHHQNNEKTTHREDVEHDLLHYYHSLEQDELKRGATRGSYVTDDQLESQIMKQKIPSK
FT                   YLTGRL"
FT   CDS_pept        complement(300125..301459)
FT                   /codon_start=1
FT                   /gene_family="HOG000176669" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760249"
FT                   /locus_tag="AAL024C"
FT                   /orf_name="AGOS_AAL024C"
FT                   /product="AAL024Cp"
FT                   /protein_id="AAS50342.1"
FT                   /db_xref="HOGENOM:HBG253412"
FT                   /db_xref="HOGENOM:HBG327741"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="UniParc:UPI0000252462"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EV4"
FT                   /transl_table=1
FT                   /translation="MAEGTRRRLSVVVLGGGTATNALVPCFEELSSSVAYIMPISDNGG
FT                   STSEILRVIGGPAIGDIRSRLVRVISDAFLIQVLSYRLPQENKRAKEEWNEIVEGSHAI
FT                   WGGVPSPLRECVRPFLAHIQSELLKRGKISKPFQFAKASVGNLFLTGARLFLGSLDAAI
FT                   ELTLRLGRCDASVDVIPCINSNHMYHISALLENETVITGQSQISHPSQPIHDQFAGTMS
FT                   RAGDESSSPSYTSVQGLNTPSQADDDEEEEDAAPFYIHPDLRTSQLYFEKMIDEEPLPA
FT                   PVKRVFYINPYGEEIFPVANSRSIHQLKRCDMLVYSIGSLITSLLPMVILGNVAEVVVE
FT                   GKMKKVLLVNNKYDRETFGLGGLQYVLMIIDAMHMAVTRYKKKRAKLDHMQWPPAAYIT
FT                   DVVYLRDGQINADWKILEQKGIRCHGVDGDVFDDKLLTEVLSNIQ"
FT   CDS_pept        301693..302580
FT                   /codon_start=1
FT                   /gene_family="HOG000178118" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760250"
FT                   /locus_tag="AGOS_AAL023W"
FT                   /product="AAL023Wp"
FT                   /function="phosphatase activity"
FT                   /protein_id="AAS50343.2"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG001206"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR006384"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001DB274F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EV3"
FT                   /transl_table=1
FT                   /translation="MEVAALPTPLYNIISYVIMLVDAKTTAFLRPLALYIRSVCAADFE
FT                   LAPRINSQRIMAKAVIFSDFDGTITWQDSNDFLADQYGLGQAARRRLFEGVIEGTTSFR
FT                   DGFLQMLESIRLPFDQCVSKVREHVQLDPGFKDMYEWTRREGVPLVVISSGMRPLIEAL
FT                   LEQLLGHEALQQIEVIANEVDVRQDGTWCIRYRDESEHGHDKSRSIAACKQRWQHLEPA
FT                   PVYFYCGDGISDLSAAKECDLLFAKSGKDLISFCKKQDVPFREFNTFDDVLSAVKRVVA
FT                   GEASVTELQGGSAA"
FT   CDS_pept        302930..304177
FT                   /codon_start=1
FT                   /gene_family="HOG000019858" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760251"
FT                   /locus_tag="AAL022W"
FT                   /orf_name="AGOS_AAL022W"
FT                   /product="Isocitrate dehydrogenase "
FT                   /EC_number="1.1.1.42"
FT                   /function="NAD+ or NADH binding"
FT                   /function="isocitrate dehydrogenase (NADP+) activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="isocitrate metabolic process "
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAS50344.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004450"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0006102"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG020077"
FT                   /db_xref="HOGENOM:HBG596047"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI0000252464"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET8"
FT                   /transl_table=1
FT                   /translation="MGKVKVQQPIVEMDGDEQTRIIWHLIKDQLIFPYLDVDLKYYDLS
FT                   IENRDATEDRVTVESAEATLKYGVAVKCATITPDEARVEEFGLKEMWKSPNGTIRNILG
FT                   GTVFREPIIIPRIPRLVPGWNEPIIVGRHAFGDQYKATDVVIPGEGTLKLVFESKDGDK
FT                   SKNLDLEVFEYPKDGGVAMTMYNTTDSITGFAKSSFELALQRKMPLYSTTKNTILKKYD
FT                   GKFKDIFEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVQSD
FT                   IVAQGFGSLGLMTSVLVSPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTR
FT                   GIIHRGKVDGTPDVVKFGELLEKSTLDTVQEDNIMTKDLALILGKTDRASYVTTEEFIT
FT                   AVANRLADGYKRLFCE"
FT   tRNA            305373..305443
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        305723..306625
FT                   /codon_start=1
FT                   /gene_family="HOG000046747" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081828"
FT                   /locus_tag="AAL021W"
FT                   /orf_name="AGOS_AAL021W"
FT                   /product="AAL021Wp"
FT                   /function="acetolactate synthase activity"
FT                   /function="amino acid binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="AAS50345.1"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG083524"
FT                   /db_xref="HOGENOM:HBG335310"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniParc:UPI0000252465"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET7"
FT                   /transl_table=1
FT                   /translation="MLRQSIKGIGSGSWIRCNSSSSTAALVYKQLHKHKVKPPVPKFET
FT                   SSWSANSAVASILYETPAPSREPKKQCVLNCLVQNEPGVLSRVSGTLAAKGFNIDSLVV
FT                   CSTEVPDLSRMTIVLQGQDAVVEQARRQIEDLVPVYAVLDYTNTDLIKRELLLTRISLL
FT                   GAEYFEELVARHAGLTEACSDAAENVSADQTFHPSNLPLSELQRMKHEHLNAITNLATN
FT                   FGGRVVDISESNCVVELSAKPSRISAFLKLIKPYGVLEVARTGMMALPRTPVDDETTNQ
FT                   ENMVADASEAVDISQLPPG"
FT   CDS_pept        complement(306691..307770)
FT                   /codon_start=1
FT                   /gene_family="HOG000248704" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930535"
FT                   /gene_name="MRPL2"
FT                   /locus_tag="AAL020C"
FT                   /product="60S ribosomal protein L2, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50346.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG057965"
FT                   /db_xref="HOGENOM:HBG397775"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniParc:UPI0000252466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75ET6"
FT                   /transl_table=1
FT                   /translation="MSFWKVATLWQMPLRPSILVQVRTATKRAAGSRTSMKDSAGRRLG
FT                   PKKTEGQRVEVGQIIMRQRGTRFYPGENVGIGKDHTLFALEPGWVRYYLDPFHTGRKFV
FT                   GVALYQDMRLPIEHFAPRVRRFGRQLLSGKEAETEEQALPRSVFLAKEKILERAQQRAD
FT                   AREQRRAEFGHILREELGLALDQDAEQLATEYLLRVQTNLKSGFNSADARFNAMYHMEV
FT                   RMRNTPEKVGQMDLLKKTVASVDAATSFSNKFELGRHISEGERVAWREALHKDLAGLVI
FT                   RTAEEKQRVVERLKEASKYLSLSEEIHLRRKFLKPVKPETEAVAEAAGKGTVTIKRFNY
FT                   GTGKVDTIIREKKAFLAKL"
FT   mat_peptide     complement(306694..307698)
FT                   /gene_name="MRPL2"
FT                   /locus_tag="AAL020C"
FT                   /product="60S ribosomal protein L2, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75ET6 "
FT   transit_peptide complement(307699..307770)
FT                   /gene_name="MRPL2"
FT                   /locus_tag="AAL020C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75ET6 "
FT   CDS_pept        308131..308841
FT                   /codon_start=1
FT                   /gene_family="HOG000248873" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081829"
FT                   /locus_tag="AAL019W"
FT                   /orf_name="AGOS_AAL019W"
FT                   /product="AAL019Wp"
FT                   /protein_id="AAS50347.1"
FT                   /db_xref="HOGENOM:HBG057966"
FT                   /db_xref="HOGENOM:HBG397808"
FT                   /db_xref="InterPro:IPR010750"
FT                   /db_xref="UniParc:UPI0000252467"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU8"
FT                   /transl_table=1
FT                   /translation="MDGQWDIIVSSLQKLCASHEALPLDGDGGTKRVQLRNMTAEQLQL
FT                   QLLHYQEHRDAVGGARRLVAAMQAAVDALLGDGGPAPPDPGPAGRSYWTSSFNPNDPIY
FT                   VGSEVAYKPRRTGAEGEWFQCQVIKVSADGTRFEVRDPEPDEFGQPGGTFKCNWKELLL
FT                   IPPRTTPRQLTPHYPSGTKVLARYPETTTFYPAMVIGNKRDGTCRLRFDGEEEADKETE
FT                   VDRRYVLPFPARRS"
FT   CDS_pept        309526..310539
FT                   /codon_start=1
FT                   /gene_family="HOG000111155" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15760252"
FT                   /locus_tag="AAL018W"
FT                   /orf_name="AGOS_AAL018W"
FT                   /product="AAL018Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50348.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252468"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU7"
FT                   /transl_table=1
FT                   /translation="MSRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGHH
FT                   RGMGTVEYTNAQDVDEAIRRFNGMDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHP
FT                   GGFEIFVANLPYSISWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAA
FT                   IERWNGYELEGRILEVREGKGTDVGSAGRGDSYVPKQIPSYDYDGEYRGTEVRAELPHS
FT                   ENASVSVSGKASPEYEQYTPSDVEFTSKAAPGGAKNRIIYCENMPLATAESDLYDLFET
FT                   AGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLNNYHYGGCDLKMSYASYA"
FT   CDS_pept        join(310789..310879,311043..311266)
FT                   /codon_start=1
FT                   /gene_family="HOG000200514" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760253"
FT                   /locus_tag="AAL017W"
FT                   /product="UPF0357 protein AAL017W "
FT                   /protein_id="AAS50349.1"
FT                   /db_xref="EMBL:AAO21871.1"
FT                   /db_xref="HOGENOM:HBG057968"
FT                   /db_xref="HOGENOM:HBG398785"
FT                   /db_xref="InterPro:IPR018559"
FT                   /db_xref="UniParc:UPI0000252469"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q876Z1"
FT                   /transl_table=1
FT                   /translation="MFGLISLWHLFWLAVMAGILVVAHRNRETIHGFSSQNFDLTSANS
FT                   NDTRSGLDEASKQEIRRIMEEQGLGFDQARLVYTTRKFGAHGIAPDGMPLDPKVVTFRR
FT                   "
FT   sig_peptide     310789..310857
FT                   /locus_tag="AAL017W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q876Z1 "
FT   CDS_pept        complement(311444..315880)
FT                   /codon_start=1
FT                   /gene_family="HOG000000894" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760254"
FT                   /gene_name="BUD3"
FT                   /locus_tag="AAL016C"
FT                   /product="Bud site selection protein 3 homolog "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="cell septum"
FT                   /cellular_component="cell tip"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50350.1"
FT                   /db_xref="EMBL:AAG41242.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0030428"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="GO:0051286"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG057969"
FT                   /db_xref="HOGENOM:HBG204096"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR021895"
FT                   /db_xref="UniParc:UPI000025246A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF61"
FT                   /transl_table=1
FT                   /translation="MLTAKQDEVGRELRVATGTSLIEYPVKDWLLRRQPTEWEALLGEA
FT                   AIFSGQDELLWGPFVACVYREPRTTRLNCLFMDRIGVMHLHSVDVSDTSRFYPAVENLR
FT                   PEYRTQVVRRCLAVGLLKKYVLLDPSAVRLIRAELPYDYDQTTAGDLANTCELVEGQAA
FT                   RDVGQLLVRLGLVQPRHVRSLMLDVVYENHADVVDANNKLVYYLGEQLEQLFDPLTEYS
FT                   PEPTELSYRVPDQVRTSLSDEMPLMVSICEELLQLQTNFTLSLVGFLQKFLIPLRIKAL
FT                   NEQVPGLSTVKLNNIFPPTIDEVTRINCIFLDALKAALPYGSLEVLKACSITAPYFYKA
FT                   YTRHEAATKFFSRDIKSFLSTFGKSLSDLNFYSEIKLDTLIHGPQEKLTKLKLIIDRLF
FT                   DSKDWETNEEQKEADRCYRSICDVIDSFGKDEPPNTYDTRVFTPSGKILTELAKGWPAE
FT                   LQYKWLKRRVVGVFDVISVTDPESRDIVVIFSDYIVFLHVINGNLYYSGDSKKPLISDV
FT                   LMNSLINEVPLPPKIPKLEVLSHSYIDDVVVSTYGKNSLRFDTLNAERPSSVAYTLASS
FT                   SVEASYVADLCTKARILEKDTAFHLFKTAIDSFHVYSTAHESEAYKTERIKSPFVLFLN
FT                   IPDSIGALQDHNATVGLFASLNKNDKVTLVRLGLDGSREESFASLDNFLSLIIEELLIF
FT                   YPSYLSSATSPLFQQLMQINEQLVQTLLDPKGVHSASKSKCALRTSKKKKMPANLVSTN
FT                   DNSRTLSPGTIISRTPRTISTITPKQEKRKSVGQASNSPARGSISTTPRKHKRESILGK
FT                   ISGLFHKKDKKENKRNSVGSDTRNRHDNGSVHILRNSSSSFRELESPRQMKRFSSVVHT
FT                   AVPSSSKRRTSGISPSKGTVNLRALQDAENDDNADISKIPIPEGESLFDDTIRVDGVDA
FT                   DFYAQKDRLSKIYNHDLYGEVVPSAPGSKNVNVVSGATREQEKQQNTQKAIARELLASV
FT                   DQQKRQPTHSAPAESQIVIPGLPQSNVPQINFGRSPSFIELFGGMRLVLDENDESVNWR
FT                   RLCSERSLNEKYQIRPATYAGCISGELAPPVGIISDQRDSNLSGDNDADTPLPMHSSNK
FT                   SILSDETLEKGEFERDFAISTPKSQTVSDVNARRETWGYSHSHDEEIDSEKRANTKPVS
FT                   APAPNVIPGLIITANSPTKPWHKENTRIKVSDVRSEGTDVSYISSLKKSSNRLVELSVN
FT                   SQEDFEDERHTPVIEPIQNPEAPSLIENTETAPVASNSSNEETLSKLLGSQGVIDLTEE
FT                   TIDYSSINRKHASIQTAYPVLDDVEFSTFHMSFGDMKAEDSHLANQRESYLFSNSTIAG
FT                   KKDESHGPVFYKLPDFVADDSYLGYSAVDQHAKHERNTEIGEEDEAMWVSPSKLDIFDL
FT                   SKQPESVYKRTSIPAKHAELLSKMRKDGSVKFEESMFIRDNSYVYLGQFLSADEVIEQQ
FT                   DKKLAANTDEMDSARRL"
FT   CDS_pept        316203..317294
FT                   /codon_start=1
FT                   /gene_family="HOG000057120" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625007"
FT                   /locus_tag="AAL015W"
FT                   /orf_name="AGOS_AAL015W"
FT                   /product="AAL015Wp"
FT                   /protein_id="AAS50351.1"
FT                   /db_xref="HOGENOM:HBG057970"
FT                   /db_xref="HOGENOM:HBG204095"
FT                   /db_xref="InterPro:IPR019128"
FT                   /db_xref="UniParc:UPI000025246B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EV1"
FT                   /transl_table=1
FT                   /translation="MSVNLYTELENVGTYKVLQLTEELIRAFQSGPVELKAGGDDSEVV
FT                   LCSADKTWAVRQKNHSNTVILMKEFAPVPAAETQVSARGPVQGEWLGYTQQTCELEPRA
FT                   TAGQVDLSALPIYNGQHVGDGPDVETLVENATCSRAEFYAAWRAAGGCSVGGTACVISP
FT                   DLLGRTLHLVLATAVADGFDLACVGPEQMWASIARSMAAGAHGATHPYSREVIETVLHR
FT                   FGRVGSDGVSFELDLSRIARWYGVQALKKFASTEAIMVDEFMIKWRSLFPAYFRCDLDL
FT                   ELLYGEFARPQHERIQYLSRSTLPMDIKDRFQQLFRIQNAWDIREITPFIEELNTRGIG
FT                   MDNFVLKYARRKKTGKTIVVMPR"
FT   CDS_pept        complement(317372..318187)
FT                   /codon_start=1
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777564"
FT                   /gene_name="PET8"
FT                   /locus_tag="AAL014C"
FT                   /product="Putative mitochondrial carrier protein PET8 "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50352.1"
FT                   /db_xref="EMBL:CAA07008.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000006C392"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60029"
FT                   /transl_table=1
FT                   /translation="MDSTFLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNGGY
FT                   RGIYRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGE
FT                   MSACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPF
FT                   TCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHER
FT                   RVPMLHLARTLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF"
FT   CDS_pept        318485..319957
FT                   /codon_start=1
FT                   /gene_family="HOG000017510" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15760255"
FT                   /gene_name="NFS1"
FT                   /gene_synonym="SPL1"
FT                   /locus_tag="AAL013W"
FT                   /product="Cysteine desulfurase, mitochondrial "
FT                   /EC_number="2.8.1.7"
FT                   /function="cysteine desulfurase activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cysteine metabolic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50353.1"
FT                   /db_xref="EMBL:CAA07007.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006534"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="GO:0031071"
FT                   /db_xref="HOGENOM:HBG000049"
FT                   /db_xref="HOGENOM:HBG635316"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniParc:UPI000012FFE1"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60028"
FT                   /transl_table=1
FT                   /translation="MLRQVLRRSLSDSRRPLRSVGSISCSARASGIGMRAYSSQIFKEG
FT                   MQLETHTDIQSAAREQAQERMGSEALASNNSVLKHAYQESVDHGTRPIYLDMQATTPTD
FT                   PRVVDTMLKFYTGLYGNPHSNTHSYGWETSQEVEKARKNVADVIKADPKEIIFTSGATE
FT                   SNNMALKGVARFYKKRKNHIITTRTEHKCVLEAARSMKDEGFDVTFLNVNEDGLVSLEE
FT                   LEQAIRPETSLVSVMSVNNEIGVVQPIKEIGAICRRHKVFFHSDAAQAYGKIPIDVDEM
FT                   NIDLLSISSHKIYGPKGIGALYVRRRPRVRMEPLLSGGGQERGFRSGTLPPPLVVGLGH
FT                   AAKLMVEEYEYDSAHVRRLSDRLLKGLLSIEQTTLNGSADHRYPGCVNVSFAFVEGESL
FT                   LMALRDIALSSGSACTSASLEPSYVLHAIGRDDALAHSSIRFGIGRFTTEAEVDYVIKA
FT                   ITERVEFLRELSPLWEMYKDGIDLNTIEWSGH"
FT   CDS_pept        complement(320132..321250)
FT                   /codon_start=1
FT                   /gene_family="HOG000021112" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930804"
FT                   /gene_name="LEU2"
FT                   /locus_tag="AAL012C"
FT                   /product="3-isopropylmalate dehydrogenase "
FT                   /EC_number="1.1.1.85"
FT                   /function="3-isopropylmalate dehydrogenase activity "
FT                   /function="NAD+ or NADH binding"
FT                   /function="magnesium ion binding"
FT                   /biological_process="leucine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50354.1"
FT                   /db_xref="EMBL:CAA04541.1"
FT                   /db_xref="EMBL:CAA07006.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003862"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009098"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG435977"
FT                   /db_xref="HOGENOM:HBG518924"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="UniParc:UPI00000002F4"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60027"
FT                   /transl_table=1
FT                   /translation="MAAVKRIVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHL
FT                   VGGAAIDATGSALPDEALGAAKEADAVLLGAVGGPKWQGGAVRPEQGLLKLRQELGVYA
FT                   NLRPCNFAADSLLELSPLRPEIARDTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYT
FT                   VKEVQRIARMAGFLALQHDPPLPVWSLDKANVLASSRLWRKTVEETFQSEFPNVQLQHQ
FT                   LIDSAAMILVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAF
FT                   GLYEPCHGSAPDLPAGKANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVLDSGVRTG
FT                   DLLGSSSTSEVGDAIALAVKEALRRQSAAGLS"
FT   CDS_pept        complement(321494..322375)
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930805"
FT                   /gene_name="RLP7"
FT                   /locus_tag="AAL011C"
FT                   /product="Ribosome biogenesis protein RLP7 "
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translation"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50355.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG359947"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI000025246C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75ET5"
FT                   /transl_table=1
FT                   /translation="MATLNSNPEILLRKRRNAERTRVEKQEAARRRAEAEVRQRRARQH
FT                   KFVRAEALVASTLATEREKTRIQRVSKRAAKQRAGHVTGGEWLVRVRAAADGGLEREKT
FT                   AYDGRATLLFVVRVRGPAAAKIPRKAHRVLTLLRLAEVNTGVFVRLTAEVFPLLQVVAP
FT                   YVVVGRPSLASIRALVQKRARVVHQRAGEAAPVEMVLNDNGVVEERLGDEGVICVEDII
FT                   HEIATMGEAFAKCNFFLLPFKLGREVSGFSALSRLQKLKQREEASQTRPVSNAAAAPLV
FT                   EVDVDELIGRLN"
FT   CDS_pept        322942..325446
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082144"
FT                   /locus_tag="AAL010W"
FT                   /orf_name="AGOS_AAL010W"
FT                   /product="AAL010Wp"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS50356.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG057971"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000025246D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET4"
FT                   /transl_table=1
FT                   /translation="MNVDQASQEPWASASLLNRSTPSTSTGTPLNTAQSSLPSAPTTSN
FT                   SHGPGAGSGPGAEGPALHQQLVPQQQPLMAGRGEPPISAGGAGSGQAQGLLAQPLAQQM
FT                   YGAAPHGALMAHPPHLQYATGYGPSHLPPISSKGGAAMKHQAEDFGALHSPPRQYAAQL
FT                   QRPPSTAGQIPLVLAPQQRHGTPPAQVQQLLHQAPSQHPHQHQNQHLHQNQHQNQHLHQ
FT                   SQQNPQHVQVQLKHFQHMQDLHRQQQHHQLLLQEQEQRWKKRKAGEPAPQPVIASELTS
FT                   KRTTQENILKLVALRNKDKPLTEYATTVRAAEIEVLNMDTSTHSKSDIQAAEQHRERER
FT                   QVYALIWLMNNCVPDGDSYVPRGRIFAQYAASCASNNLKPLSQATLGKLIRSLFPHLKT
FT                   RRLGMRGQSKYHYCGLKLISPLLMSDEMPTVAATPVSSCMSTPINMISTNTASINLDNT
FT                   SFSNSTIESAPSSAAGMVNSGVSSVDAVSNISKPALHNNNRRVSMILTGAHENLKFIDN
FT                   FFSRTCEEKVELPLAFPSINPYLPHNVDMDIASSVESLYKVYCNQLFENIRFMKFDDLP
FT                   STLESFSSGSISPQMYNLFISEELYQWVEHSDLITYRALAKMLSSLIVEFDDIPDIVLD
FT                   KLSQFSNTYLAMITKATIDLPVPIVSSKKRIVSQFIQLVKRLIKVIDSGRNASKIVSLE
FT                   QNRNNMFQDWNQFVNLEDVLAIEMSHFSKDYPKMKEQITAFVQKELLGLLSPEYMSFEG
FT                   NNASNGFAKLARFAKKLCELLQSWGHLPGRIVALSFVGLTTTALRELSFHDAESFGAWW
FT                   ILKSFVDEWVYWCGEVGCFLDN"
FT   CDS_pept        complement(325769..326680)
FT                   /codon_start=1
FT                   /gene_family="HOG000208395" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625266"
FT                   /locus_tag="AAL009C"
FT                   /orf_name="AGOS_AAL009C"
FT                   /product="AAL009Cp"
FT                   /protein_id="AAS50357.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG317546"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000025246E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET3"
FT                   /transl_table=1
FT                   /translation="MSVILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKR
FT                   YLAAAGHLHVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDV
FT                   RSPSVQRNYKHDAPVNEVVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQ
FT                   SLSIASDGSMLVAGNNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHL
FT                   ATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLST
FT                   REIVRQYGGHHKGAVCVALNDV"
FT   CDS_pept        327111..328160
FT                   /codon_start=1
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761282"
FT                   /locus_tag="AAL008W"
FT                   /orf_name="AGOS_AAL008W"
FT                   /product="AAL008Wp"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS50358.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000025246F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET2"
FT                   /transl_table=1
FT                   /translation="MVKETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEKF
FT                   KEISEAFEILSDPNKREVYDTYGLEAARGNAPSGFGGAGPGGAGFGGFSTGGGGRHAFS
FT                   QEDAFNIFSQFFGNSAGGASSPFGFSSAGGDEFGFGGFPGGAGLHTSSGGMPGGFGGMP
FT                   GSSGMHSHSQPEEKLVQVNLPVSLEDLFVGKRKSFKITRKGQTGIPEKKQIDIQLRPGW
FT                   KAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPHEFFKRDGNDLIYTLPLTFKESLLGFD
FT                   KTVRTIDGRQISIHKTQPVQPSEEMRYPGQGMPLSKNPSERGDLIVKYKTDYPITLTEK
FT                   QRRAILENF"
FT   CDS_pept        complement(328627..330084)
FT                   /codon_start=1
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761283"
FT                   /locus_tag="AAL007C"
FT                   /orf_name="AGOS_AAL007C"
FT                   /product="AAL007Cp"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="AAS50359.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="HOGENOM:HBG427337"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI0000252470"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU2"
FT                   /transl_table=1
FT                   /translation="MSEEHMIKPENVAPSADTSEWPLLLKNYDKLLVRSGHYTPIPAGA
FT                   SPLKRDLKSYVSSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVC
FT                   IDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRELENLTGALFQRPPLISAVKRQL
FT                   RVRTIYDSKLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGA
FT                   LDENDNMVTLHDVLDAQWVYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNAVCYG
FT                   AKLMIPGLLRYEEGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAKVKRCIM
FT                   ERDLYPRRWGLGPVAQKKKQLKADGKLDKYGRVNENTPEDWKKTYVSHEPSADAAAEVA
FT                   PVKSEPLIEEVSKKDAKTEVEVPAEKKQDDEEKKEKKEKKEKSEKKEKKEKKEKSEKSE
FT                   KKEKKEKKRKADDENASEEKKKKKSKK"
FT   CDS_pept        join(complement(331598..331669),complement(330276..331541))
FT                   /codon_start=1
FT                   /gene_family="HOG000057121" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761284"
FT                   /locus_tag="AAL006C"
FT                   /orf_name="AGOS_AAL006C"
FT                   /product="AAL006Cp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS50360.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG049846"
FT                   /db_xref="HOGENOM:HBG057973"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI0000252471"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU1"
FT                   /transl_table=1
FT                   /translation="MQNSTTAVDVPQPVLDWLFKVLQPEYYDPRTTFHDVVIALRAYKK
FT                   LRPRTRVFTDEAGRSKLLLCLYGKVGNVDVLIWIPFEYPNVAPHAYIDLEANKGRSIIV
FT                   NQRLDGDGLFYLPILGHWHPQNCNVVKLVQDLEQAIMAQEPLRPAAGAVKNTETQNMRA
FT                   DMTVSSLPALPPRPSMENNETQKTDLATTPHGPKKPSLPPKPPKVPSVADAEERRDDSV
FT                   RELDSALSHLRLQNEAPHSNEHAKPHASLPPSNLSAAPVQNQPNWLDSDFTQCDEPTHR
FT                   DSLAVLQDTLNKLAERTNARYHTEWNAKEKSIDEAIESFRHIYSYEADNIRHMEDAIVE
FT                   NSEILQTEIDKLNGELLKAQKFEEKYPDGLPDMNSCVTAESIALNQLYMLVARDYALSD
FT                   TIQILSVMLNQGLISVDPFIKKTRSLAAEQFLTRYHMDKILQLLDN"
FT   CDS_pept        join(331860..331867,331945..332155)
FT                   /codon_start=1
FT                   /gene_family="HOG000000895" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761285"
FT                   /gene_name="VMA9"
FT                   /locus_tag="AAL005W"
FT                   /product="V-type proton ATPase subunit e "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP hydrolysis coupled proton
FT                   transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS50361.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015991"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG057974"
FT                   /db_xref="HOGENOM:HBG398381"
FT                   /db_xref="InterPro:IPR008389"
FT                   /db_xref="UniParc:UPI0000252472"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EU0"
FT                   /transl_table=1
FT                   /translation="MSFYTVVATFLSVVLASAVFWVLAPKENQTVWRSTIILSMSMMFL
FT                   MWAVTYLSQLHPLVVPRRSDLRPEFAE"
FT   tRNA            complement(332325..332396)
FT                   /gene_name="tRNA-Asp"
FT   ncRNA           complement(333431..333451)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR43"
FT                   /product="AgSNR43"
FT   CDS_pept        333713..334648
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761286"
FT                   /locus_tag="AAL004W"
FT                   /orf_name="AGOS_AAL004W"
FT                   /product="AAL004Wp"
FT                   /protein_id="AAS50362.1"
FT                   /db_xref="HOGENOM:HBG057975"
FT                   /db_xref="UniParc:UPI0000252473"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET9"
FT                   /transl_table=1
FT                   /translation="MGKLDCQRNWYQQLIRRAMSNDGTTPLSHVSALTDSVGWAIHERF
FT                   KPVTMVIWLVHSVFFQPIYTTVNLLLWQPMLTLQRAIWKLALLPANLLLKIFLRTSVEE
FT                   LAVGTDFRGALTIAKVCIQYVIATAVVGSFLGITTGVVLGSIHRMVRIPALYVAILPTY
FT                   VDKTTQWVSTVRDFFSNIIDAGLRSIPILSSGVLVDEGGDLFTDLLDTYEHEYVQYSQS
FT                   SSNGLREPVKGDYDDYGNMTPISIQDEEELGTSTLSAISNLWDSVPDSGTVRTDVDELK
FT                   YNLKNSSRQKIAHTTQRYDKFDFSELHHRH"
FT   tRNA            complement(334921..334992)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        335133..336659
FT                   /codon_start=1
FT                   /gene_family="HOG000172574" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761287"
FT                   /locus_tag="AAL003W"
FT                   /orf_name="AGOS_AAL003W"
FT                   /product="AAL003Wp"
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="AAS50363.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG176116"
FT                   /db_xref="HOGENOM:HBG737293"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="UniParc:UPI0000252474"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET1"
FT                   /transl_table=1
FT                   /translation="MRTYIRYSRPLKAVQRTMSTNRTPMNGLEGIFDAVKGSLSSLRTI
FT                   FYFKEGEIDVLQHPVEFYDTLKQKIAAANDRIFLASLYLGRTEHEVIACLDDALKAKPH
FT                   LRISLLVDGLRGTRETPNPCSASLLAKLTKEHGDRVEVRLYMTPEYTGWKRALFPKRFN
FT                   EGIGLQHMKIYGFDDEVILSGANLSNDYFTNRQDRYYLFKSKHFADYYFKMHNLISKMS
FT                   YQAKYSNTKQSYMLYWPKNNATIEPRLDKHKFVTQASELLSKFLTATHENGMEGVQYLD
FT                   DYPTIVYPISQFTPLFKKNNDFSTEKPSILRLLSSIPSSETSWAFTAGYFNILPEIKKR
FT                   LLDSPSCVGKIITAAPTANGFYQSRGISKYLPDAYLYLAQKFLKSVHAEGKSDTISLYE
FT                   WQKGVVNQPGGWSYHAKGIWISDGCDEDSRPVVTVVGSSNYTRRAYSSDLETNAIILTT
FT                   DDRLRAAMGAELQNILRHTKKITLNDFTNDPQRYVKPGVRAATEVLGKKL"
FT   CDS_pept        337035..337586
FT                   /codon_start=1
FT                   /gene_family="HOG000163668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761288"
FT                   /locus_tag="AAL002W"
FT                   /orf_name="AGOS_AAL002W"
FT                   /product="AAL002Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50364.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG027216"
FT                   /db_xref="HOGENOM:HBG315333"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="UniParc:UPI0000252475"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ET0"
FT                   /transl_table=1
FT                   /translation="MNFEEEEVTTSNKATFYFNKYKTLYQYYLDQTTPHVRYRWAGLIV
FT                   LVLLFVLRVVLYEGWYVVCYGLGIYLLNQFLAFLTPKFDMSLQQAEKNNELESGDMADE
FT                   FRPFIRRLPEFKFWHNSIRATLLSHFLATFSVFDIPVYWPILLIYFILLFALTMRRQIN
FT                   HMIKYKYLPLDIGKKKYSHK"
FT   CDS_pept        337894..339051
FT                   /codon_start=1
FT                   /gene_family="HOG000184162" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761289"
FT                   /locus_tag="AAL001W"
FT                   /orf_name="AGOS_AAL001W"
FT                   /product="AAL001Wp"
FT                   /biological_process="translation"
FT                   /protein_id="AAS50365.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG049937"
FT                   /db_xref="HOGENOM:HBG629960"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="UniParc:UPI0000252476"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES9"
FT                   /transl_table=1
FT                   /translation="MKLISQSKGTSSSEVCLVVVAQDKEDLFTLYNIINTDDELIFKKK
FT                   LTLKLDEAGKKKSTELVRLRVKVVSSEFEPQHEFLKYKGITTEDDAGKANVDVALGKFF
FT                   SFTVDYQYPFTIIKKDFNSYCQKLINEACNLESRSDMAAVVLQEGLAHICLLSSFSTIL
FT                   KQKVEYSLPKKKRSVDVLKFDEKTEKFYKAIYNAMLKHFDLSQLKAVILCSPGFYAKTL
FT                   YEKILQYAQTNQEKTVIDNKDKFLVAHCSTGYLQGISEVLRDPAYSQKLQNTKNSGQLQ
FT                   VMDAFLKHLNDDDNKSWYGEAEITKACEFGAIETLLITDDWLRADSVSVRNKSLKLIKD
FT                   VENMGGKVCVFSSMHSSGEELNSLTGLACILKYPIPDLDEHEDED"
FT   CDS_pept        complement(340462..341448)
FT                   /codon_start=1
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761290"
FT                   /locus_tag="AAR001C"
FT                   /orf_name="AGOS_AAR001C"
FT                   /product="AAR001Cp"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="AAS50366.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI0000252477"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES8"
FT                   /transl_table=1
FT                   /translation="MSSVADSSLITPSSYVGFDTITAQIEHRLLKRGFQFNIMVVGHSG
FT                   LGKSTLINSLFASHLIDSSTGKDITKEPITKTTEIKVSYHSLVEDKVRLNVNCIDTPGF
FT                   GDQINNDKVWEPIVKYIKEQHSQYLRKELTAQREKHIVDTRVHAVLYFIQPNGKGLTQL
FT                   DIAALKRLTDITNVIPVIAKADTLTMDERAKFREIIQHEFKKHNFRIYPYDSDDLTPEE
FT                   LELNDSIRSIIPFAVVGSEKEITVNGEVVRGRKTRWGAINLEDINQCEFVYLREFLIRT
FT                   HLQDLIETTALIHYESFRSKQLIALKENASSRATGHGAQSSSTNMLR"
FT   CDS_pept        341774..342310
FT                   /codon_start=1
FT                   /gene_family="HOG000248832" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625267"
FT                   /locus_tag="AGOS_AAR002W"
FT                   /product="AAR002Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS50367.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG057976"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="UniParc:UPI0001DB2774"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES7"
FT                   /transl_table=1
FT                   /translation="MSAQAVWGNVGRALSECTAALFPRLELGSGSVTAPRTLLELLRRA
FT                   GGSQQAGTAAVGADGLVLAVPKKKVSHQKRRQKLYGPGKKQLQMVHHLGKCPSCGHYKR
FT                   LNTLCMYCVGEIRHIWKVYTQTKPAEPPQEQDLSELDKRILYPGREETEYMKKLKKKDY
FT                   LEKRMRTLPVDDKGK"
FT   CDS_pept        342575..344317
FT                   /codon_start=1
FT                   /gene_family="HOG000195370" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761291"
FT                   /locus_tag="AAR003W"
FT                   /orf_name="AGOS_AAR003W"
FT                   /product="AAR003Wp"
FT                   /protein_id="AAS50368.1"
FT                   /db_xref="HOGENOM:HBG057977"
FT                   /db_xref="HOGENOM:HBG623558"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI0000252479"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES6"
FT                   /transl_table=1
FT                   /translation="MNQDAKKQRMLPSYRVSTFTSAPRHPLGVKPSGNAIMEGFGPKER
FT                   AEARGKLLGHLAIFPEELLVEVLTYITTPEDLRNLGHASRMLYAYTYDEELWRKMYTNE
FT                   FIRMEQAARADSKPVVLKPYGCDQWKGSWRKTILKLGDDQEACLQVRDTLYSDLLYRPY
FT                   QCSQVDYKTIFRKVIDFERRSSNLVCNLNPDFGIDRFDESQFDEEKFRKEYIDKPFILR
FT                   AKDNDARWPGWDLAYLVSKYPQVKFRQESVTWPLSHYADYFKKNRDESPLYLFDCASEA
FT                   MEKIKNQYAPPDVFQKDFFTLFQQDGVQCRPDHRWLIAGPARSGSTFHKDPNQTSAWNA
FT                   VLSGMKLWVMLPPDVAPPGVSTDKEEEEVTSPVGITEWVLSGYYNDAVNLAQQGKCRIG
FT                   VQFASECIYVPAGWWHTVINITDSVALTENFVPEPILPRVLNFFKNKTKQISGFHMKDL
FT                   VASIESFLELQRGNIGNKTNLTLLEEFLDQSKTSQLDNEDCGVLNASEIAAPLYEFFCE
FT                   LIQQSDYRGALPAAQQALKDIEIRDAQQQQTSRVNIKDSEKWMELTKMSESPFSFCFDA
FT                   DDDA"
FT   CDS_pept        complement(345018..346451)
FT                   /codon_start=1
FT                   /gene_family="HOG000130831" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761292"
FT                   /locus_tag="AAR004C"
FT                   /orf_name="AGOS_AAR004C"
FT                   /product="AAR004Cp"
FT                   /function="citrate (Si)-synthase activity"
FT                   /biological_process="cellular carbohydrate metabolic
FT                   process"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="AAS50369.1"
FT                   /db_xref="GO:0004108"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0044262"
FT                   /db_xref="HOGENOM:HBG127450"
FT                   /db_xref="HOGENOM:HBG309523"
FT                   /db_xref="HSSP:1AMZ"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="UniParc:UPI000025247A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES5"
FT                   /transl_table=1
FT                   /translation="MSSMMKLGSATRSHLVRSLARNTFARVGGASACRAYSNGEKSLKE
FT                   RFAEIFPAKAEEIKQFKKQHGKVVIGEVLLEQAYGGMRGIPGVVWEGSVLDPHEGIRFR
FT                   GRTIPEVQKELPKAPNGREPLPEALFWLLLTGEVPTETQTKALSADLMSRSELPGHVEQ
FT                   LLDSLPRDLHPMAQFSVAVTALESESKFAKAYAQGVSKKDYWNYTFEDSLDLLGKLPVI
FT                   ASKIYRNVFKDGKMGKIDVDADYGKNLGHLLGFENPEFVELMRLYLTVHSDHEGGNVSA
FT                   HTTHLVGSALSSPYLAFAAGMNGLAGPLHGRANQEVLEWLFKLREEVKGDYSPETIRQY
FT                   LWDTLKGGRVIPGYGHAVLRKTDPRYTAQREFALRHFPDYDLFKLVSTVYEIAPKVLTE
FT                   HGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVSRAFGVLPQLIIDRAVGAPIERP
FT                   KSFSTEKFKELVASKASKA"
FT   tRNA            complement(346915..346986)
FT                   /gene_name="tRNA-Pro"
FT   tRNA            347736..347806
FT                   /gene_name="tRNA-Gly"
FT   tRNA            347919..347989
FT                   /gene_name="tRNA-Gly"
FT   CDS_pept        348342..349493
FT                   /codon_start=1
FT                   /gene_family="HOG000141719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761293"
FT                   /locus_tag="AAR005W"
FT                   /orf_name="AGOS_AAR005W"
FT                   /product="AAR005Wp"
FT                   /function="calcium ion binding"
FT                   /biological_process="homophilic cell adhesion"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50370.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0007156"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG057979"
FT                   /db_xref="HOGENOM:HBG104262"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="UniParc:UPI000025247B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES4"
FT                   /transl_table=1
FT                   /translation="MSARSSLQQRRLSAIQNAADYNIVPSQHEGHTYSVRKRKKSRFRL
FT                   WFKILPLFKKDQQEVVLSVASLETEQHTEQHNESTPNTLLKMARNTGEQTDLKNGLGTS
FT                   APSLVGLSVRDIDDKENPDFVPEKKDVHPELSSQVLEKIHSQSNLSKSLEGNVSVDDLN
FT                   REGALLTDDNDVDLEQLISKKLDGITSLKMQLKNKRKQQAHPQQGSTARSSGSPCSAGH
FT                   HHISPENSNSNHSLVMSTDPIDDFISMGATSNSSLSDKHKEAEQPERIRNSYGEWIPNK
FT                   SHRPHLCRGDSYQKTITDVDERPGRSSQRASGSSAEYLRSLSRSMQRGSSLQRSSGEQL
FT                   DDKNATYTTNNYTIPQRDVEMAPLIIREDEEDQYKGNANARHL"
FT   CDS_pept        349558..352245
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777813"
FT                   /locus_tag="AGOS_AAR006W"
FT                   /product="AAR006Wp"
FT                   /protein_id="AAS50371.2"
FT                   /db_xref="HOGENOM:HBG057980"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001DB2775"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES3"
FT                   /transl_table=1
FT                   /translation="MEEDILLALDFSTGNTEESLEAMLNEVKQATVRTAAGISAAKAAR
FT                   REGREAKRNIKKQPRGNAKTHLASETTSKRDADNLAKKESPKLQDVVVNKGAVVKESLQ
FT                   GAKAPEDDKTAAVSEEHTAETIKAQPEAIDGPIASSTNIVIPHPVDVATDKAESANDNV
FT                   GVPGKSTKGAKPVTVSGGSKDAVTVKGNNPAASKKSLQEANLTETTHLNLSEAAKESDD
FT                   KARAQFGSDETGVLAEANISVSNLSTEGAETHVLEGTPSIHNRDAAPDLPLTESGPKRA
FT                   PALTTDPAVQPLHSKGGSISAREIEGGPITESSGGSTLEISRSTDTAAPAQETPGSPHV
FT                   TIEEAIKDKPLNSHASVDDGVLVGSESCKKTEACSDLEPPSAKADAITGGTDARNITTE
FT                   TATEGSVHSKSPVQGTDASKSVSATNLKQVTGLSDRSVATDSHVSPTIRSEQNTTMEPS
FT                   MKTIEKVPTAESKGSLEKVARNQTAVPKSAPVASSGSGSAEDNTTVASAKPNRESREAD
FT                   PEDKTASSGLGTLPPIEVPGLESGKSNKPNATGTPAAGPVADGATVGKPSTLMPPQALS
FT                   TTLQNASADGSAALGEKTNAVTDVTEDGARDDVFHPKGKKSDDAPKSGFSSNPSAEPNH
FT                   DVLGHKETRNDQGARACSGPTTEELSSCKQTESASAVSDSPKFQQKGTADADETGNLLL
FT                   TEKVPAVKGPDALVGQKSSKNHPAKEPGMSHARTSSPTAGAASKTSPLSPRPNSPKLSA
FT                   AHPNSAEPAAAPAAKHDITKEIDDFMLELGLTDDSATKLLATLDAESSRDLRGKPVYLL
FT                   TSLAGGGFHMPSRTNRLATILTANQIDFQYRDCGSDDAARTHWKRQGRGRSLPAIMVGD
FT                   AVVGNWHEFDEANEEWKVRQLCGL"
FT   CDS_pept        353413..355527
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761294"
FT                   /locus_tag="AAR007W"
FT                   /orf_name="AGOS_AAR007W"
FT                   /product="AAR007Wp"
FT                   /protein_id="AAS50372.1"
FT                   /db_xref="HOGENOM:HBG057981"
FT                   /db_xref="UniParc:UPI000025247D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES2"
FT                   /transl_table=1
FT                   /translation="MAISAIAKDITRFTLQNVNDVISFKPHLCHEVPARHYDMLRQEYI
FT                   SYTGTSIRKNKCKLFYLPTNVSDELHIMKQLSPDIGMGSGHGGAVQEHCGVKMENNGAW
FT                   APEKNGGYGGNSRTVYYKKRLITELDYENVKRVEKACMLIAYAAVNQCLHIETSDGKSS
FT                   GGLPYSRSAGDDDDEERDHGPGSGEEYCEECARKSLERGEMLGFRELGYLINITPWHFH
FT                   RVFKVLAGLTIREYGQLCCDFLKGQEDVLFRVRDRVTLLRECGHSFSCLDDEEFMGEDV
FT                   SAITSLDCGSLEDESEEASVVVLPDYFIDPNKSKELKKKLKEQKSNGTTSDHGNRIELR
FT                   KRRYSLMSHRIMKASASSIKNNPTIMDCLENCTITRDEYERRQSQRYLQRSKLKKRGKK
FT                   PTQLAAVRKPPYHRRTSSESHGILKNAVMDQSTVADMMAAAEQESQDCISHEESLPIFQ
FT                   GPPSGRQLDTSSASSTSASSSALPPSYDYDQDSQSLGHFSSPTQSVLDFKFPPAMATGH
FT                   QTPDLNSVLNSTTPVPPQTVASAGTSVSSGASSALAVGASAPDPFAGDSYKYSLGVGLS
FT                   SMGTSDSAMLPGAGPAAGGMFYDPLVMPTFPAAASDFDAATIAAAPGTPSQGGPANYNI
FT                   SSMVYSGLPLQQQPSQQQQQQLFDFGPLFGAPVASQAAPPYTGNPPALGTMEYLVSSSG
FT                   GIFKDDEDGL"
FT   CDS_pept        356281..358392
FT                   /codon_start=1
FT                   /gene_family="HOG000160890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625268"
FT                   /locus_tag="AGOS_AAR008W"
FT                   /product="AAR008Wp"
FT                   /function="glycogen (starch) synthase activity "
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="AAS50373.2"
FT                   /db_xref="GO:0004373"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="HOGENOM:HBG083100"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="UniParc:UPI0001DB2776"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES1"
FT                   /transl_table=1
FT                   /translation="MTRDIQNHLLFETATEVANKVGGIYSVLKSKAPVTCAQYKDHYHC
FT                   IGPLNPDSVQIEVEALDWEDDSVWSREMLPVKRSLQHMRERGVNFVYGRWLVEGAPRVI
FT                   LFDLVSVTHHLNEWKADLWNSCGIPSPQDDQETNNSILLGYTVAWFLGELTAQDQQHAI
FT                   VAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRHLCAGNADFYNNLDKFDVDAEAG
FT                   KRGIYHCYCIERAAAHTADVFTTVSQITAYESEHLLKRKADGILPNGLNVIKFQTVHEF
FT                   QNLHALKKERIHDFVRGHFHWNYDFDLDKTLYFFIAGRYEYRNKGADMFIEALARLNYR
FT                   LKAAGSKMTVIAFIIMPAKTRSYTVEALKGQAVVKALESTVKDVTTSIGHRLFEHAMRY
FT                   PRSGKSEIPTDLGELLKPSDTVLLKKRVFALRRPESSLPPIVTHNMVDDASDPILNQIR
FT                   RVQLFNNSSDRVKIIFHPEFLNANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECT
FT                   VMGVPSITTNLSGFGAYMEDLIERDQAKDYGIYIVDRRFKNPDESVEQLVDYLDDFCKK
FT                   TRRQRINQRNRTERLSDLLDWRRMGLEYVKARQLALRRAYPEEFRALVGEDLDDHDMDS
FT                   LAGGQKFKVARPLSVPGSPRDRSSSMSAILMTPGDLGTLQDANNANDYFHLSMQTDDDE
FT                   EGEDGREDD"
FT   CDS_pept        358930..360291
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761295"
FT                   /locus_tag="AAR009W"
FT                   /orf_name="AGOS_AAR009W"
FT                   /product="AAR009Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50374.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1A06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020651"
FT                   /db_xref="UniParc:UPI000025247F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ES0"
FT                   /transl_table=1
FT                   /translation="MAVFTSSTGKLGKGVGEHDEDASKPQDRPPSQANMLTKFFHKVTG
FT                   QPASYVNKADYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQMLYDEL
FT                   SILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQML
FT                   TAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGY
FT                   VAPEVLTTSGHGKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY
FT                   WNNISKEAKQFILRALTLTPARRPTAAELLTDRWIVSKQSNTADLLPTIREGFNASKKF
FT                   RDAMQVVILNNRIKKLKQMYGHDESDTDLEENSASTDRRKVGLEVLQNALRSLSLKGSQ
FT                   ESPEQKQLKSQVTQQAFVQLVLAAKENKERIREYQSQQSLDSVAAHQNTTDAPQ"
FT   CDS_pept        360805..361731
FT                   /codon_start=1
FT                   /gene_family="HOG000000974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777814"
FT                   /locus_tag="AAR010W"
FT                   /orf_name="AGOS_AAR010W"
FT                   /product="AAR010Wp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50375.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG057982"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI0000252480"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER9"
FT                   /transl_table=1
FT                   /translation="MSSSVYERPAKQGAEDTEELAPLSPEAYRLKYKGIYSRLISDIWD
FT                   DAPETAESLGMADSSSQPWSAGDVRNTDSPGAKARAATADVTDKAEGQGGGDDSFEKRP
FT                   LSSVTLNLSDERQLSMQLQDLIANNSDLGTRLLSLLLVSSGNAVEIISRINSKDRDLSS
FT                   LDTLRLLKPSSQSPRLSGKEFPSSDADGDRMANRTTCTSIGTNSTTAAKNKDEEELLKL
FT                   QLEKRRRNTEASARFRIRKKLREQEKLGKLKQLNGEISSMYKRIDELMEENRYWKRRLD
FT                   ELNERKSKERLDTIRRRNQAARSDGDR"
FT   CDS_pept        complement(362115..364358)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761296"
FT                   /locus_tag="AAR011C"
FT                   /orf_name="AGOS_AAR011C"
FT                   /product="AAR011Cp"
FT                   /protein_id="AAS50376.1"
FT                   /db_xref="HOGENOM:HBG057983"
FT                   /db_xref="UniParc:UPI0000252481"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER8"
FT                   /transl_table=1
FT                   /translation="MSNTLQDIKEEDGEYGLAAAGQAAAGARGEEALLPPLPDIHGVGQ
FT                   AFAEPGGVAAGEGYAGGSGSLLQLDGGALGEAAPLGTPIPFAGSFTTASSPSVIATESL
FT                   AVYPDSSFDLSKALEIPTHEHGGNGGLLVAELEGGSAPGSTPMSPLVSAPMASLKRKIS
FT                   FTFNPGAALGSDSMQALPASVAAQQPLDSPLQKTNTKSSTSISRSNSVTGGRTSRSSSN
FT                   AAHNMLLPTLNTTIESSEESGHQVILEIKRPARKFSVGSHSSSSVSILNNTSNNSSSSS
FT                   TNVNNHSIGINNSRNSTSTTVEENIYKAHPWIGGRKRSSSNLNTSQRDSSGNLVTSASA
FT                   VTLISKKTPLLRRASSMILRKATSKRDVHQPEAASVPSSPQVGQFIDFASGDSKSPSHG
FT                   RSLKPTRSRMILSLRGALSPTSSEFDTDQSSLAPTMVNATNIMTPMTSPLTSITSPLTS
FT                   SEQPSFGSKVKRGFSRIISGGNTRRHIQPTSVNEATLSPRASFQKSTNIIYRGAQMESL
FT                   QSNCSTDSCPKNSLDGSEYKLPYENGGISQSCVRRSLSAKRALYVGNCRGQSSMIKRQN
FT                   SQVSTIPGGSSEKETSSELLPSSSTIRRQNSLRSTNTQLTETGEVEVTVDVDEIVKSLP
FT                   TITITENFGAKNTTPIQIQSNILLDRAYVLESDRPSGIGKNYKPSRITLKEYIAILMNQ
FT                   QMIEDERFEVLEKTFATSGWCSQKDVLNLRSKRVVINRKWAERISYYQSKLEV"
FT   CDS_pept        join(complement(365676..365710),complement(364888..365608))
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625269"
FT                   /locus_tag="AAR012C"
FT                   /orf_name="AGOS_AAR012C"
FT                   /product="AAR012Cp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="AAS50377.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="HSSP:1G65"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI0000252482"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER7"
FT                   /transl_table=1
FT                   /translation="MSGYDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLG
FT                   CERRSTLKLQDPRITPSKISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPV
FT                   TVEYMTRYIAGVQQRYTQSGGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQA
FT                   IGRNSKTVREFLEKNYSKHTPPASEQDCVKLTVKSLLEVVQTGAKNIEITVVRPDARIV
FT                   TLTTAEISRYVDEIEREKQQELEKKKNGD"
FT   CDS_pept        365968..366435
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930806"
FT                   /locus_tag="AAR013W"
FT                   /product="Mitochondrial import protein 1 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="AAS50378.2"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG057984"
FT                   /db_xref="InterPro:IPR013262"
FT                   /db_xref="UniParc:UPI00003BF810"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62512"
FT                   /transl_table=1
FT                   /translation="MAEEILGNIAEEAHAALLASAGDEATKKSGAIRLPIEDSLDGDFG
FT                   SRGTAYTDLSTTTSAGTSGQLVERTGGISFGRLLSVAGSCSINLLLPFLNGLMLGFGEL
FT                   LAHELSWKFSWFDKERNRGYRIYPEVRKAAELQERERQRALSRAAGPDGFL"
FT   CDS_pept        complement(366511..366981)
FT                   /codon_start=1
FT                   /gene_family="HOG000231207" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930807"
FT                   /locus_tag="AAR014C"
FT                   /orf_name="AGOS_AAR014C"
FT                   /product="AAR014Cp"
FT                   /protein_id="AAS50379.1"
FT                   /db_xref="HOGENOM:HBG203012"
FT                   /db_xref="HOGENOM:HBG370567"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniParc:UPI0000252484"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER5"
FT                   /transl_table=1
FT                   /translation="MAKKDKRQSPQTRVDDDGVLQIAPPRTVGNKEQLQRANYLLQLAA
FT                   LHTMQNKSDQWQALPRAYLGTLDLIQKKTKIALTPALKRTVCKGCRRLLVPYRTVTSRV
FT                   QNESRLGRENPRGDVLVQTCLCGRAKRFPFGKDTSYKTYTERDGTLLDMSGT"
FT   CDS_pept        complement(367092..367778)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777815"
FT                   /locus_tag="AAR015C"
FT                   /orf_name="AGOS_AAR015C"
FT                   /product="AAR015Cp"
FT                   /protein_id="AAS50380.1"
FT                   /db_xref="HOGENOM:HBG057987"
FT                   /db_xref="UniParc:UPI0000252485"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER4"
FT                   /transl_table=1
FT                   /translation="MKEEPLFLRHLLTVTYILVFLRFLRDQSLLNALLAVQVVSLTKFT
FT                   ANILSTYFDADTPPESAPALKKLLAKALYVLQLFFVLQTAHTLAYHAMLDLDADVCRWV
FT                   YGYLFTDLLGEFDCKSRGRSMLFVLDALLLLCQLQLATCRLVLLKDGRRVTIEHFSVEE
FT                   HGILSILMIQAFRLRASDWEIAITTPLRSCGEASGRSAGRSTVSSGEDASDVSQGNSTA
FT                   YYGSTQ"
FT   tRNA            complement(368335..368407)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        368864..370444
FT                   /codon_start=1
FT                   /gene_family="HOG000195427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082145"
FT                   /locus_tag="AAR016W"
FT                   /orf_name="AGOS_AAR016W"
FT                   /product="AAR016Wp"
FT                   /protein_id="AAS50381.1"
FT                   /db_xref="HOGENOM:HBG252587"
FT                   /db_xref="HOGENOM:HBG395478"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI0000252486"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER3"
FT                   /transl_table=1
FT                   /translation="MLVRRVLVPGIGLQGSAARARMGHIAAAGVWRAPQPQSPCELGSM
FT                   SFVRRLHDDRKVSDLPKKQDSEDKPKVPKKSAKDPLWARVKHEVRHYVNGTKLLGYELK
FT                   ISFKLLVKFAKGYELSRRETNQLKRSMGDVFRLVPFSAFLIIPFAELLLPFALKLFPNM
FT                   LPSTYVSGTERQQKRVKLEEVRRKTSNFLQETLEESSLINYNSVEGSEKRKKFLSFFQK
FT                   VNSPKDGKTSVFTHEEILSISKMFKNDTVLDNLSRPQLVAMAKYMSLRPFGTDNMLRYQ
FT                   IRYKLKSIMEDDKKIDYEGVESLSTEELYSAAASRGIKAFGVSREDLVDKMNVWLELRL
FT                   RQRIPSVLLILSSAYTFEGAKNESANQISLETATGLSEKLAKPLDIYYDAILQVLSSIP
FT                   DPVYNVAKLDVSESKEQKVAAPVADESTAKAYEGAKSVEHQDATEGILATQLTAEQPEV
FT                   EEEYIPSTDDNEFKLNVLKEQEEMIKKEEEEAKLRSSSNIVDDITLDEDEDGSKSDKQH
FT                   SPAKPERKS"
FT   tRNA            371215..371286
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        371470..373704
FT                   /codon_start=1
FT                   /gene_family="HOG000195848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761297"
FT                   /locus_tag="AAR017W"
FT                   /orf_name="AGOS_AAR017W"
FT                   /product="AAR017Wp"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50382.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG190912"
FT                   /db_xref="HOGENOM:HBG397484"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI0000252487"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER2"
FT                   /transl_table=1
FT                   /translation="MLGKIYISQQGEFTDYEGNVVQLRGVNLDPSVKFPQQPRIPTNMP
FT                   VDDEFWDGATNVSFVNERLDPKEIEEHMIRLKALGYNCIRYLFTWEALEHGGPGIYDEE
FT                   YMKYTVMVLKKIKEAGGMYVYLDPHQDVWSRFSGGSGAPLWTLHCAGFQPKRFLATEAA
FT                   ILHNYYIDSETQAEKAQYPEMIWSTNYYRLACQTMFTLFFSGKLFAPKCVINGRNIQDY
FT                   LQGHFLKAVMTFYKYIQDNAPELFEENCIIGLETMNEPNCGYLDHPNLRELPRDRQLMK
FT                   GTTPTAYQSFILGEGFACNIDSYDISLIGARKIGKSFVDPKGKSAWLDATERLELDRAY
FT                   GWTRPDDWAPGCIWRLHGVWDIESKSSKPVLLLPGYFSKCPSTGEETSMSYFTNKLFLD
FT                   FYVRYRNQYRELDPDSLLFLEPPVLQEPPYLIGSDIIDKRTVYACHFYDGMSLMFKSWN
FT                   RRYNVDTFGFMRGKYLSPIFGLVFGEANIKRCFRRQLRAMKLEGRRFLGDSVPIFFTEI
FT                   GMPYDMEGKKAYRDHDYSSQIGANDALGFALEGSNMSFSLWCYTYINNTTWGDNWNRED
FT                   FSIWNKEYAMKVPRDVVVKTGDAMPNSSINTIVGAESHLTCESRLSDDALVLDYSGFRA
FT                   LDAILRPYPVKIHGSFSTAEFDLERKRYFLEIIARTETEGTTSIFLPYYHFPPESTVVS
FT                   SSSGYYVREQDNNQLLKWCHGGGRQYISIEVTGMGSSYSVQSADSSCVIM"
FT   CDS_pept        373860..375170
FT                   /codon_start=1
FT                   /gene_family="HOG000196041" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761298"
FT                   /locus_tag="AAR018W"
FT                   /orf_name="AGOS_AAR018W"
FT                   /product="AAR018Wp"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="AAS50383.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG266472"
FT                   /db_xref="HOGENOM:HBG397483"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="UniParc:UPI0000252488"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER1"
FT                   /transl_table=1
FT                   /translation="MSSPEEGSQTSIRTSQADSQSVASTAASSVPASGNGGPSMSDMQY
FT                   YYQYLYPFRPIFHWLNHSPKPQRDMVNRELAMAFRSGAYKRYNSFGSVQEFKQQIQKAN
FT                   PDRFEIGAVYNKPPRDRDSVLKTEMKPLEKELVFDIDMDDYDDFRTCCSGAQVCDKCWK
FT                   FIFLAMKVMNTSLIEDFGLEQFIWVFSGRRGAHCWISDPRARSLSDMQRKSVLDYMNVV
FT                   RDRNLEKRISFTRPYHPHLARSLNILKPYFVDFILREQDPWQDDSAAVRLLLPAIQDAQ
FT                   LADQLKKYWKENPGRSSEEKWKDIDLLASGMTKQAKRPDYVARLREAKEDLILAILYPK
FT                   LDVEVTKQTIHLLKAPFCIHPATGNVCVPITEDFSPTGVPKLIQLQHEMESNGNKVEQT
FT                   SLQPYIDAFSKHVSAIVKAELAFRKRNHPEGEDIPEF"
FT   CDS_pept        375402..375989
FT                   /codon_start=1
FT                   /gene_family="HOG000188743" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777816"
FT                   /locus_tag="AAR019W"
FT                   /orf_name="AGOS_AAR019W"
FT                   /product="AAR019Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS50384.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG020946"
FT                   /db_xref="HOGENOM:HBG317631"
FT                   /db_xref="HSSP:1G0U"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI0000252489"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ER0"
FT                   /transl_table=1
FT                   /translation="MDIILGIRVQDSVILATSKAVTRGISVLKADDDKTRQLSPHSLMS
FT                   FSGEPGDAVQFSEYIQANMQLYMIRENYELSPQAQASYVRSELAKSLRSRKPFQVNVLI
FT                   GGYDTRAEKPELYQIDYLGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTTEEGLKLLKL
FT                   CVEELQRRMPIDFKGVLVKVVDKDGIRDVEDF"
FT   CDS_pept        376231..379566
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761299"
FT                   /locus_tag="AGOS_AAR020W"
FT                   /product="AAR020Wp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /protein_id="AAS50385.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0001DB2794"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ9"
FT                   /transl_table=1
FT                   /translation="MSAVEKEILRILDIDDTVVSEFVLNIYAQSDDIQSFKKQLLDLDV
FT                   GIDEARTDELYCCIEKHKGQIPGDGDASGTTNELQQLLKAELGVDDPVVAEYVADIYSK
FT                   HKSLTKFHEKLSEIDSGLSSASIFKIHKLLRQTCPTGEKTEAPKADVSALCLPNREARW
FT                   DDIRGEGFMEPELDVTPIEGKIYRAVIRNIKPFGCFARVLGTKRSCEGLIHISQLSHSR
FT                   VGSPNDVVSVGDHVYVKITKVQDNGKLSLSMREVDQATGQTATVNRGRSDERTVYRRQL
FT                   SSPERWEIRQMIQSGVSSIDDYPELKEELSHLQQQTQVAGSKHSNESDELIDVELNTEH
FT                   EPKFLSGHTATAKKPELPTIVKLPKGSLNNTAMTGSKLLQEHRQEKLALQKSTDKKERL
FT                   LRELDDSGHKKKAFEDKQRALTAWERKRMAEKVTYGKRTNLSIKQQRESLPVFKMRETL
FT                   VSAIRDNQFLVIVGETGSGKTTQITQYLDEEGFSVGGMIGCTQPRRVAAVSVAKRVSEE
FT                   MGCKLGEDVGYTIRFEDQTSRKTRIKYMTDGMLQVEALLDPTMSRYSVIMLDEAHERTV
FT                   STDVLFSLLKQAALKRPDLRVIVTSATLDSEKFSKYFLDCPVIKISGKTFPVDVIYSET
FT                   PQLDYIEAALDTVMEIHINESPGDILVFLTGQEEIDACCEILYERVQALKETIQELLIL
FT                   PVYSALPSEVQSKIFEPTPKGSRKVIFATNIAETSITIDGIYYVVDPGYAKLNIYNPKI
FT                   GIEQLVVSPISQSQADQRKGRAGRTGPGKCYRLFTEAAFHREMVPNSVPEIQRQNLEHT
FT                   ILMLKAMGINDLLNFDFMDPPPRSSMVHALEALYNLQALDEDGYLTQLGKRMSQFPMEP
FT                   ALSKSLIASVEQGCSDEILTIIAMLSVQNVFYRPKDKIQEADNRKARFHHPFGDHLTLL
FT                   NIYNRWQENNFSKSFCAENFLHERHLRRAKDVKEQLKRIFKNLDLPIRSCHGNVDLIRK
FT                   TLVSGFFRNAAKRDPQVGYKTIVDETAVSIHPSSCLFGKECDYVIYHSLVLTSKEYMSQ
FT                   VTLIDPKWLMENAPHFYKLSDPSGEKQKRLKIVPLHNRFSKDQDSWRLSSIRQSKERAL
FT                   GIKR"
FT   CDS_pept        379870..381441
FT                   /codon_start=1
FT                   /gene_family="HOG000093387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761300"
FT                   /locus_tag="AGOS_AAR021W"
FT                   /product="AAR021Wp"
FT                   /function="oxygen-dependent protoporphyrinogen oxidase
FT                   activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="AAS50386.2"
FT                   /db_xref="GO:0004729"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG193530"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="UniParc:UPI0001DB2795"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ8"
FT                   /transl_table=1
FT                   /translation="MPVPASVLQAGSKVLVVGGGIGGLSYAYFLSRLRPDIKVKLLETR
FT                   QNCRGSIVSKPTSLPDGSVVNLEKGPRTLRGVSDSAVIIMDLVRQLGESQSIYGIAKDS
FT                   PANRKFLLDHKGELLQLPNSWKTFRKFMQNPLSDGLVRGILGEPFRRTRPESSADESAF
FT                   DLFVRRFGNAQVPNNLLSSLFHGIYGDDIQLLSAQRIARRFYEMEQEHSSFIRAGISGI
FT                   FKKPALSLSLDKYQETFGRDKEELLQLKKTLSQFPILGFKGGMEFLPRLILKELSGMPN
FT                   VEICTGKLVSAVSPAKDGKIEVVAKDGTRYTGIDHVRLAVSPMSIKRMLSEQSISSHLE
FT                   RASANTIAVVNFYLPKKDVIADYHSFGYLAPISIPNPHKLLGVIFDSVVERSYTPLFAP
FT                   STDRFAQGQYTKMTAMMGGHYFSQQDLQNPPSEDGIIQNIKNVFKRHLHISEADLAAAH
FT                   WSVTLAKNCIPHFHVGYNQWETVLRGKIQSEYGHRISLGGMAFSSGPGVPDVFMNGFLD
FT                   AVSMAK"
FT   CDS_pept        381732..382076
FT                   /codon_start=1
FT                   /gene_family="HOG000000973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082146"
FT                   /locus_tag="AAR022W"
FT                   /orf_name="AGOS_AAR022W"
FT                   /product="AAR022Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50387.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG123965"
FT                   /db_xref="HOGENOM:HBG203006"
FT                   /db_xref="HSSP:1A9N"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000025248C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ7"
FT                   /transl_table=1
FT                   /translation="MTEEPVTKKKRVEGRDGVRPSPTADEPGMPRSTLYISNLNDQVKI
FT                   STLRTNLYLLFSTFGEVLRIAMSPKLRGQAFVVLSTVDEANLAMISLKDESFFGKPLRI
FT                   QFSKSDMKEV"
FT   CDS_pept        complement(383019..383981)
FT                   /codon_start=1
FT                   /gene_family="HOG000144430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761301"
FT                   /locus_tag="AAR023C"
FT                   /orf_name="AGOS_AAR023C"
FT                   /product="AAR023Cp"
FT                   /protein_id="AAS50388.1"
FT                   /db_xref="HOGENOM:HBG057988"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniParc:UPI000025248D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ6"
FT                   /transl_table=1
FT                   /translation="MALSNEVSPLDITSTNIKHVNRMFQEMEVRMAHLQRQVDSLRVRV
FT                   RREHTKRKRLELRLVSRFGELARRVAESGSSAEEEDEGVGPLGRPLDMFEDMLRERDAG
FT                   GSEREGERLPRRRGGMLDGLMGAQEELAGEAPGQVLVDTQHPHEDLAALINDALNGCNG
FT                   SKRRSLSNEFAARRRQPSVGSQTRLPIFPIKPAAPSAALETSRRYDEEDIKLKYGVSFS
FT                   EKYSKVSEIWNDYVKASDKGISIRSLEASFSNKWRANMKKSVKKKYNRRLIVVRAIETG
FT                   IKRGRTQEECIEILDAFLRQNNKTVSHFYKKSNLPKELV"
FT   CDS_pept        384192..385160
FT                   /codon_start=1
FT                   /gene_family="HOG000198048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082147"
FT                   /locus_tag="AAR024W"
FT                   /orf_name="AGOS_AAR024W"
FT                   /product="AAR024Wp"
FT                   /function="microtubule binding"
FT                   /protein_id="AAS50389.1"
FT                   /db_xref="GO:0008017"
FT                   /db_xref="HOGENOM:HBG023549"
FT                   /db_xref="HOGENOM:HBG622485"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR004953"
FT                   /db_xref="UniParc:UPI000025248E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ5"
FT                   /transl_table=1
FT                   /translation="MSGMGESRTELLGWLNDLLRLDYTKVEQCGTGAAYCQIMDSIYGD
FT                   LPMHRVKFDARAEYESLTNFKILQSCFTKHKIEKTVFVDRLIKCRFQDNLEFLQWMRRF
FT                   WIQNKDESPYDPESRRKSVRPVSMRAPAQAPPSHAPKRRSLATFAATGTAAAPRPLQKA
FT                   RAAAGGAGGAVATRVPSGGAPARGTATAGAGEQVAALQGELSAAEHKINKLTQEMVQYQ
FT                   DAMSLMERERDFYFGKLRDIEILVQSTQDLFKEGVYNDDPQELNRLLGKVSQILYSTEE
FT                   GFEVANGADGNEEYDVEAGTRMENCVEGQVLHNLITDDETF"
FT   CDS_pept        complement(385305..387485)
FT                   /codon_start=1
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082148"
FT                   /locus_tag="AGOS_AAR025C"
FT                   /product="AAR025Cp"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50390.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI0001DB2796"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ4"
FT                   /transl_table=1
FT                   /translation="MRAMWSQGRWAGALRPALRRGLHGGPRAQFQRTALARAPAGGRGD
FT                   DGRNDKDDKNKKDEEPGSVGEYLRSKSFARTVCWTVGLSLAFELLSRSGEQPEEALTMQ
FT                   DFKTRYLEKGLVKKLYVVNRQVVEAELLPQAGDGRGEAFGLGMRGPVVGFTIGSVDIFE
FT                   EQLDQAQDKLGIPQNERIPVTYVERTSVLQGVMPFLPTLLLLGLVYSMTRPRAGGGPGG
FT                   MGGQGGIFGVGKSRAKLFNQETGVKIKFKDVAGCDEAKMEIMEFVDFLKTPEKYRALGA
FT                   QIPRGAILSGPPGTGKTLLAKATAGEAGVPFLSVSGSEFVEMFVGVGASRVRDLFENAR
FT                   KMAPAIIFVDEIDAIGKARGKGGEMGGSNDEREATLNQLLVEMDGFTSRDQIVVIAGTN
FT                   RPDVLDPALLRPGRFDRHIQVDAPDVEGRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGK
FT                   LAALTPGFAGADISNACNEAALIAARHNDAFVEFRHFDQAIERVIAGLEKKSRVLNPEE
FT                   KKTVAYHEAGHAICGWFLEHADPLLKVTIIPRGQGALGYAQYLPDEQYLTSEERFRHRM
FT                   IMALGGRVSEELHFRYVTSGAHDDFKKVTGMARSMVKSLGMSRKVGYVAYEQDDNGGLV
FT                   VRKPFSEKTARLIDLEVKRLVDEAHASCKQLLTEHLAEVDKVAKLLLDKEVLTREDMIH
FT                   LLGPRPFPEKHESFEKYLDPKKPASGESQPAT"
FT   CDS_pept        388801..389811
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082149"
FT                   /locus_tag="AGOS_AAR026W"
FT                   /product="AAR026Wp"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50391.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG057989"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI0001DB2797"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ3"
FT                   /transl_table=1
FT                   /translation="MDSNLRLPSISHILTQIPSEQAAGDGDGCAPAPRRRSGEEQRRPL
FT                   PPPGLQRAPEERAPKVLPAGPQSFSQCGAYRSAQVFPMVARSSGFAAPSVAYTAAEPLR
FT                   TGEYCAGTYAVHGEYTVPVSPLTPPSTASSSAALPPLAVLPQPASLHSAVLPPHTPLPH
FT                   APRALPPAAAHARAPPPGLPPPLAAAQAAGTGSDREPDDDAELRCTCGQKYKHRKSQRQ
FT                   CHIPRPRNAFILFRQHWHQQLFPQERIKQSERGNGSFKTNSQVSVDIGQRWRSLSPEER
FT                   QKWLDFAKREKEEHMRKYPNYKYVPTRKDKKVLIQGEGRNLASDPKSICRACARK"
FT   CDS_pept        390019..390969
FT                   /codon_start=1
FT                   /gene_family="HOG000247984" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625270"
FT                   /locus_tag="AGOS_AAR027W"
FT                   /product="AAR027Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50392.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG057990"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB2798"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ2"
FT                   /transl_table=1
FT                   /translation="MLFLRRALSCAVPRRMAQDAMRPSTGTKDAYKSMLAQYYPQELLK
FT                   SIELGEQAIPDDAEYRLSSNVEFAPPYLDDFSKLDPFWDYKPGLPHQHADGPLTAFRPD
FT                   QQHQPLPERLEVPRGAALLTTGGSNMAAIARGIARQTGLDAEYITRKLVMRPLVVKRVS
FT                   NQTAKGKIASFYSLVVVGDRNGMVGLGEGKSREDVSESIKKAHWNAIKNLKHIPRYENR
FT                   TIFGDIDFRFHGVKLHLRSAKPGFGLRVNHVIYEICECAGIKDLSGKVYKSRNEMNIAK
FT                   GTLEALTKSQKTLEEIAYSRGKKLVDVRKVYYSSD"
FT   CDS_pept        391164..392294
FT                   /codon_start=1
FT                   /gene_family="HOG000000931" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625271"
FT                   /locus_tag="AAR028W"
FT                   /orf_name="AGOS_AAR028W"
FT                   /product="AAR028Wp"
FT                   /protein_id="AAS50393.1"
FT                   /db_xref="HOGENOM:HBG057991"
FT                   /db_xref="HOGENOM:HBG395729"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniParc:UPI0000252492"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EQ1"
FT                   /transl_table=1
FT                   /translation="MLKFAGITPSLRRCAFQRHQLSLARYQVRGVKTSTVDWKPIHTSK
FT                   TPEDHERGDHPWARRFFLTLMCAIPVVSFYLGMWQLRRLKWKTELIAKCEDQLTYRPVP
FT                   LPQKFTPEMCEQWEYRRVVVKGAFRHEEEIFVGPRVRNGVKGYLLFTPFIRKDTGERLL
FT                   IERGWVSEDRVLPTQRGLQHLSVPRGDNVEVVCLVRKALPKGRFQWDKTDEESRVWQVA
FT                   DIPAMAAATGTLPVHLQAIEDFHNHHWPVADSDAAAAQSNGVRGTSWWKFWNTNSGSTV
FT                   SEKEGNAIPASTPVQSRQSDAIEYSEFQFMREGVPVGKVPAVELRNTHTQYMLTWFGLS
FT                   FFSTLLLCFAIRGSRGSAVSQSQLKRSKLKHARKNT"
FT   CDS_pept        392457..393476
FT                   /codon_start=1
FT                   /gene_family="HOG000000932" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761302"
FT                   /gene_name="DAM1"
FT                   /locus_tag="AAR029W"
FT                   /product="DASH complex subunit DAM1 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS50394.2"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG057992"
FT                   /db_xref="InterPro:IPR013962"
FT                   /db_xref="UniParc:UPI0001DB2799"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EQ0"
FT                   /transl_table=1
FT                   /translation="MSKESVRESKAATEYRLSISSNPGSRRSSFGGSSEHPAGSGIGNN
FT                   KASNGELREATLVDTLLLPQVQELKDSMITLDANLTHMNFIHESLVDLNESVSALLYGL
FT                   MCNSWCVDFPNMPHHTARELGISKELARLKEEKQQLLADLQGTAQAPSLVLKEKEPNTS
FT                   KQKFQLPKPPMVSTRSVVAPVRTISEEEEDDNTAASFVSNPTVMGQPPHAPPPVARSNN
FT                   AKGRRRYSILQQIRNHDLTGQKHMVANLGGTVKARAATHPIPESAGEKRKSLAVSAVRI
FT                   GNNKRLQTSRPPSGGRDVTMARKRSGTQPAILNTNSITHSSTGAVPASSAQGRRPPFR"
FT   CDS_pept        393761..394720
FT                   /codon_start=1
FT                   /gene_family="HOG000142009" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082150"
FT                   /locus_tag="AAR030W"
FT                   /orf_name="AGOS_AAR030W"
FT                   /product="AAR030Wp"
FT                   /function="copper ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50395.1"
FT                   /db_xref="GO:0005375"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG057993"
FT                   /db_xref="HOGENOM:HBG203994"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniParc:UPI0000252494"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP9"
FT                   /transl_table=1
FT                   /translation="MGLESYLGHAMLKHHDADSMPTMTAADATSATEHAGHGSGSSGSG
FT                   GHGGSGSVHMMNMYLGNNYKGYPVLFKNLKADNGAEAFGIFVLIVVACFAYKSLLFISW
FT                   CLEVKWFKNVGKSQPSADGSVGQGKESASAPADIYARDIEHQNPLFPTMPHFLFDIFAP
FT                   TWKELLQDLVRLVITFLSTLIVYLLMLVAMSYVLTFIFAIAFGLATAEVFYNRCKLVLV
FT                   RRWDLKRELEKRKGCPGSGNCSCGYHRPEENAVLDDTVSCSTMKDRSVSQADADCCCAP
FT                   VAAMEKQQRQQREVSQIARQREENGDMNVDLMPAEKFK"
FT   CDS_pept        395062..399360
FT                   /codon_start=1
FT                   /gene_family="HOG000193710" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761303"
FT                   /gene_name="SPT6"
FT                   /locus_tag="AAR031W"
FT                   /product="Transcription elongation factor SPT6 "
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /function="transcription elongation regulator activity "
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50396.2"
FT                   /db_xref="GO:0003711"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG112190"
FT                   /db_xref="HOGENOM:HBG397800"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR017072"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="UniParc:UPI0001DB279A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EP8"
FT                   /transl_table=1
FT                   /translation="MSSEGLASARELEERDLGATRDTEEIPSDEEEGEDVFDSSEEDED
FT                   LDEDEEEARKVKEGFIVSDDEEDDSSVKQRRRRKHKRRPRHEEDDGKLSEDDLDLLMEN
FT                   AGVKRTTRPETDATKGRFKRLKRAGSPDESEGQQDTDGRHENRLEDFFSEEEDEEHLGG
FT                   TENRRLRTGGKDVLDELDDFIEEDEFSDEDEATRQQRRKLKEQRSKQSVQITGLSSDKI
FT                   DEMYDIFGDGHDYDWALAVENEDDLENLDEYQQEEDDDETSDQKAKKKKITLQDIYDMQ
FT                   DLKKNLMTEEDMVIRRSDIPERYQELRAGLKNYGQLTPEDQLLEQNWISDKIAVDKNFD
FT                   ATYDISEFREAVGDAVRFISKENLEVSFIYAYRRNYISSRDKNGFILSEDDLWDIVFYD
FT                   IEFHSIIYKRDYVKKFYEQLGIRDSLVDDYFNDESMTELNSLQDIYNYLEFRYAHEIND
FT                   ALLADSSSKTKKHLKNSSYEKFKSSSLYQAVKDVGITAEQIGENIGAETQIHPVVDHPN
FT                   LKPSESISQILDAASADLQVFAKNHKLAWDTVQKYFAAEIGNNPKVRQKIRNDFYKYYI
FT                   VDVVLTTKGRKEIQRSSPYEDIKYAINRTPGHFRSAPDVFLRMLEAESLHLMNIKIHMS
FT                   SQEQYCEHLFQIALETTNTSEIAIEWNNFRRNAFYQALEKIFEDIAQEIKDELKKTSQK
FT                   LVANSVRHRFMSKLDQAPFIPNPREPKIPRVLTITCGQGRFGLDAIIAVLLNRKGDFVK
FT                   DFKIVQNPFDRDQPQAFEAVLDNIIQEAQPNVIGINGPNPKTQKLFKKIQEVIQKKQIV
FT                   DNRGHNIPVIFVEDEIAIRYQSSERGAQEFPNKPTLVKYCIALARYIHSPLLEYTNLSE
FT                   EELQSLLIHPHQSLLPRHIFKRALETSFVDIVNLVGVEVNKANDNPYYAKALQYIAGLG
FT                   KRKAIDFLESLQRLNEPLLARQQLITHDILHKTIFMNSAGFLYISWNEKNQRYEDLEHD
FT                   HLDSTRIHPEDYHLATKVAADALEYDPDAIREKEEQGAMSEFIELLRDDPDRRMKLESL
FT                   NLEEYADELERSTGQRKLNNLNTIVLELLEGFEELRNDFHPLQGDEIFTSLTGETDKTF
FT                   FKGSIIPVRVERFKHNDIICISNSQVECIVNAQRHLGVQLKRPASDIYEVGKTYPAKII
FT                   FIDYENISAEVSLLDHDVKHQYIPVDYSKDPTIWNLKQELEDVEEEKKISMAEARAKRT
FT                   HRVINHPYYFPFNGKQAEDYLRSKERGEFIIRQSSRGDDHLAITWKLDKDLFQHVDILE
FT                   LDKENPLALGKTLIVDNNKYNDLDHVIVEYLQNKIKLLNEITSNEKFKKGTKKEVVKFI
FT                   EDYSNVNPNRSVYYLSFNYEHPGWFYLMFKINAQSKLCTWNVKLTHNGFSLADYNYPTV
FT                   IQLCNGFKTLLKSSSRARTQEASGSGYYGY"
FT   CDS_pept        399751..401079
FT                   /codon_start=1
FT                   /gene_family="HOG000195427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082151"
FT                   /locus_tag="AGOS_AAR032W"
FT                   /product="AAR032Wp"
FT                   /protein_id="AAS50397.2"
FT                   /db_xref="HOGENOM:HBG252587"
FT                   /db_xref="InterPro:IPR011685"
FT                   /db_xref="UniParc:UPI0001DB279B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP7"
FT                   /transl_table=1
FT                   /translation="MSRILLATRPCKGVTPYALRPVLASRYNLISGRRLMATGPAPKSD
FT                   SKLPAKPASPAEAAPKPSLWSRVKHEAQHYWDGTKLLGLEVKISFKLVMKMSAGYELSR
FT                   REMLQLKRTTTDVVRLVPFSAFVIIPFAELLLPIALKLFPNMLPSTYESKTDKQKKLEN
FT                   LRKTRAVMSEIIKEKKSHFKPSDITESQKMIFNSFYKHVRETGEPESREQLIQVARLFS
FT                   DDTVLDNLTRPHLVAIAKYINLQPFGTDVMLRYRIRYKMLQLKKDDFALFYEGVDLLNS
FT                   AELRTACASRGIRNLNVEDAVLRDNLNIWLNMRLKEKIPSTLLIMATAYTYGDISSQKT
FT                   LYDALCDVLSGIPDELYHEVKVNVVEEDDATNKSKMAQLREQEEIMREEEQQEKDAVVK
FT                   VRDQLRLDDLDEPAAAIPEPVADKEPTTGDATKDGKPPQHTAK"
FT   CDS_pept        401399..402424
FT                   /codon_start=1
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625272"
FT                   /locus_tag="AAR033W"
FT                   /orf_name="AGOS_AAR033W"
FT                   /product="AAR033Wp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50398.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000252497"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP6"
FT                   /transl_table=1
FT                   /translation="MTTTAAQLRKELCRSQTGYGLMGLTWRDVPSEPETAFECMRKAIS
FT                   CCKQGKILFNCGEFYGGDFLNLHYVRDFFRLHPARERVILCVKGAVDNATLQPVGDPVS
FT                   VRKSMDNCLREIGGYIDIFECARFDPKAVAPGELYPRASIEAVVEYVKAGKIGAIGLSE
FT                   VTAEQVRAISRDYGEYLACVEVEFSMLSRDILHNGLAQTCAELGIPILCYSPLARGLLT
FT                   NAISTPDDVPAGDLRRLLARFGHDALANNLQAATFLQEHIIKPRAPPPPLPAVALAWIR
FT                   SWSGTHKGTHFLPIPGATTPQRVEESLSICELTPEELDSINAFLEQFTAAGRRDEFLAR
FT                   N"
FT   CDS_pept        402682..405978
FT                   /codon_start=1
FT                   /gene_family="HOG000020094" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930808"
FT                   /locus_tag="AAR034W"
FT                   /orf_name="AGOS_AAR034W"
FT                   /product="AAR034Wp"
FT                   /function="ATP binding"
FT                   /function="valine-tRNA ligase activity"
FT                   /biological_process="valyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50399.1"
FT                   /db_xref="GO:0004832"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006438"
FT                   /db_xref="HOGENOM:HBG379584"
FT                   /db_xref="HOGENOM:HBG577712"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000252498"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP5"
FT                   /transl_table=1
FT                   /translation="MLRSCLLSDSFHLLKQQLFRSTAPRSIFERIRPQSVAMSTEQQLP
FT                   EVDANGEIIINPLKEDGSPKTAKEVEKERKKAEKLLKFAAKQAKKAENKANQQKNQTKK
FT                   EKKKKETEAVVEFVDETVPGEKKILKSLDDPALKAYNPANVESSWYDWWVKSGFFEPEL
FT                   TKDGKIKPEGIFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHA
FT                   GIATQSVVEKQIWANEKKTRHDYGREEFVKKVWDWKEVYHAKIKSQVQRLGASYDWSRE
FT                   AFTLDPELSRSVTEAFVRLHEEGVIYRASRLVNWSVKLNTAISNLEVENKEIAGKTLLS
FT                   VPGYDEKVEFGVLTSFAYPVVDSDEKLIIATTRPETMFGDTAIAIHPDDPRYKHLHGKF
FT                   VQHPFLPRKMPIVCDAEAVDMEFGTGAVKITPGHDQNDYNTGKRHDLEIINILTDDGLL
FT                   NENCGPEWQGMKRFDARKRVIEKLQELGLFVSQQDNEMVIPTCSRSGDVIEPILKPQWW
FT                   VSQGEMAKEAINAVKDGRITITPKSSASEYFHWLENIQDWCISRQLWWGHRCPVYFVNI
FT                   EGKEQSRNEGTYWVSGRNLEEAQKKAAEKFPNEVYTLEQDEDVLDTWFSSGLWPFSTLG
FT                   WPDKTPDMSTFYPFSMLETGWDILYFWVARMILLGIKLTGNVPFNEVFCHSLVRDAQGR
FT                   KMSKSLGNVVDPLYVITGSSLEELHATLSKGNLDPREVEKAKAGQKESYPNGIPQCGTD
FT                   ALRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQATKFALMRLGDDYVPPAEEQLSGN
FT                   ESLVEKWILHELSSTAKTVNEAFDKRDFLTSTSAIYDFWYLICDVYIENSKYLIQEGTD
FT                   LEKKSARDTLYTLVDNALRLIHPFMPFISEEMWQHLPKRASETSESIVKAKYPVFRQDF
FT                   FDEESAADYNLVLSATKEARSLLAEYNIVKNGKVFIEVQGNNDKVFTCLNSQSASIVSL
FT                   IKAIDQVTVVRSATEIPEGCVLSSVTPDVNVHALVKGQVDIDTEIQKFNKKLDKAQKSK
FT                   EAIEKVVGSSDYETKANEQAKKANKDRLDSIAAEIESLEATIANLEKLKL"
FT   CDS_pept        complement(406067..406711)
FT                   /codon_start=1
FT                   /gene_family="HOG000248419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930809"
FT                   /locus_tag="AGOS_AAR035C"
FT                   /product="AAR035Cp"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="AAS50400.2"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB27AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP4"
FT                   /transl_table=1
FT                   /translation="MSLGILSHVDGSSKFSTAAASAICGVSGPIEPKARQEIPQHLALD
FT                   VIVRPAAGPPTTREKLLEDKVRATITPVVETFLHPRQLCQITLQVLKSVGQHEHMELAV
FT                   ALNAAYLALLDAGVPLRAVLSAVSIAVSTEGELTQNPSPAELQDARSVFTAAFSVADGV
FT                   NTLLLLDGNGTFEESTVSKVLELAEKECVRLAGELRHAVKEKLEKDFIWKK"
FT   CDS_pept        406863..407816
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761304"
FT                   /gene_name="TPC1"
FT                   /locus_tag="AAR036W"
FT                   /product="Mitochondrial thiamine pyrophosphate carrier 1 "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50401.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000025249A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EP3"
FT                   /transl_table=1
FT                   /translation="MAASSGSPQLATEDHLRKGEAVSGLHAVVAGSVSGLVARSVTAPM
FT                   DTVKIRRQLQLASEHKYHGILHTFRTVAREEGVRALWKGNVPASAMYVLYGSLQFGTYA
FT                   WLNTAAASAGLPPQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARV
FT                   IWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYETCTIAADTYGLPWLAAAASPTAGLVS
FT                   KAAVFPLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKG
FT                   LTMALCKSTPTTVITLWVYQRCLRLLEPTRAPQLPA"
FT   CDS_pept        407860..408648
FT                   /codon_start=1
FT                   /gene_family="HOG000204051" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625273"
FT                   /locus_tag="AAR037W"
FT                   /orf_name="AGOS_AAR037W"
FT                   /product="AAR037Wp"
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50402.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG210908"
FT                   /db_xref="HOGENOM:HBG523037"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniParc:UPI000025249B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP2"
FT                   /transl_table=1
FT                   /translation="MTFLEPRGDEKGFNASFCANFIAVHLTDVIMRIAQAQQETTVTAK
FT                   QVLRYIPNCIGYMRVATMVVACFLMKNHPAWTTVVYGVSCLLDALDGTMARRYGQTSRF
FT                   GAVLDMVTDRSTTNALICFLCLLYPRWTPVFQLLIALDLSSHYMHMYGSLSCGDSHKKI
FT                   EKDQWLLHMYYSRRDVLFAVCFLNELFYFGIYLAGFPQLWHLWLPGLGRLHFGTLVALL
FT                   CLPGYVFKQITNVVQLNRAALLLAHMDARDATRRLRAKHE"
FT   tRNA            408798..408871
FT                   /gene_name="tRNA-Ile"
FT   CDS_pept        409047..410747
FT                   /codon_start=1
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777817"
FT                   /locus_tag="AGOS_AAR038W"
FT                   /product="AAR038Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50403.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB27AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP1"
FT                   /transl_table=1
FT                   /translation="MQECRPLLMKSTLPNDDRGVAIRRKDSWVPSEHSSEVGDEASSAG
FT                   FAGKYHSTYRKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILC
FT                   ITVSTAEMVCYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHY
FT                   WRDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGN
FT                   PKRDRYGFRYIGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGE
FT                   TKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVI
FT                   AMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVP
FT                   IYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQ
FT                   DNLPELPFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAI
FT                   YLGYRYIWRRGKDAVIPPTEVDLTTGLLEIELHERHHGFERYSFFHVDD"
FT   CDS_pept        411513..412088
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082152"
FT                   /locus_tag="AAR039W"
FT                   /orf_name="AGOS_AAR039W"
FT                   /product="AAR039Wp"
FT                   /protein_id="AAS50404.1"
FT                   /db_xref="HOGENOM:HBG057995"
FT                   /db_xref="UniParc:UPI000025249D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EP0"
FT                   /transl_table=1
FT                   /translation="MSSVKTATRCREEDCPQGREQGTAGRMKGAGRRPFHLKGKINKTH
FT                   FKAKEKVPDVRRGDADMLLIELHDLFDFRHCMQSGNTGEMKVDLDEVASIEYIHDPACV
FT                   YKKKGPVPLQPDDDEDVGSETSAEPLDPLTDVEQSGVGFLASGVYSAIPERCSGGMFLE
FT                   SSCHRDVPNKQTLFLLLHDLIQGDAYDE"
FT   CDS_pept        complement(412119..414110)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777818"
FT                   /gene_name="CCZ1"
FT                   /locus_tag="AAR040C"
FT                   /product="Vacuolar fusion protein CCZ1 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="multivesicular body membrane "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS50405.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0032585"
FT                   /db_xref="HOGENOM:HBG057996"
FT                   /db_xref="InterPro:IPR013176"
FT                   /db_xref="UniParc:UPI000025249E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EN9"
FT                   /transl_table=1
FT                   /translation="MDFIAVYNPAVYAKEADSEAWRQLLLYHSFKEDAEEPTPQNEKLS
FT                   LIGMIQGIWQFAHNFSEPETRGSVRYVDTQLERRRVIAVEVEDGHFMAFGVEDGKRYGC
FT                   EYYVRELLQSYHVFRLHCGSMSEFADRGELTDRLNEHVVGYWQALKLVPEAIYASTLAS
FT                   VCWHDGYKVSELELRDRAWESYIKNEILLDSESFLGLKDMCIYKLPRDGRRSAAEYGLL
FT                   RSFAPEFLSLPELSNWVYHLDRLFETALSSHVLAGHVRLSIGGDEQEEEGELRHDSQPA
FT                   SDVGARMWRNVTMPISMTYDTMSEVGNLTGINTLMSGLNSLTSGFSSMTSRLVRRADRQ
FT                   NSDTASLSLHVDHGFLISPLALEALPESYRYRRFQLRFSTDEPQWYRLLFWYYKDYLCI
FT                   FIFHENFDKIWDPDYLQAIDAKLYDAMLQLEGSVVTEDNKPGRFAYGVFNKTTKRIECS
FT                   LPLLRFSDKRSDEKSRQPLKMVVAGIDETLQFLTAGTFATNMATSRTNDEHMGPSATNT
FT                   LRMPEPTDAPSSSWTLDITKLNLFQGLNENLRLEKMADTDSGTFLDSLSSEKLLQLNVE
FT                   LCRLYTGIRRSEYNKAGIQEEQLLRLNNGILFYISTSPTEDVLILKNWFMDDKYTKAEN
FT                   KRSTSASLLHSLGGDVRRWWNARTNREQ"
FT   CDS_pept        414286..415830
FT                   /codon_start=1
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761305"
FT                   /locus_tag="AGOS_AAR041W"
FT                   /product="AAR041Wp"
FT                   /function="7S RNA binding"
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="AAS50406.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR006325"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI0001DB27AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN8"
FT                   /transl_table=1
FT                   /translation="MVLADLGKRINAAVAQALNNDTDDYVAGVETMLKAIVTALLENDV
FT                   NIKLVSSVRSNIKARLLADKSGRRMGQAQTKQLVQKTVFEELCALVDCQTAAYQPKKKK
FT                   SNVVMFVGLQGAGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIKAKIPF
FT                   YGSYTETNPVRVAADGVAKFKKERFEIIIVDTSGRHHQEDALFQEMVEIAQEVKPNQTI
FT                   MVLDASIGQAAEQQSRAFKEAADFGAIILTKMDGHAKGGGAISAVAATKTPVIFIGTGE
FT                   HVHDFEKFSPKSFVSKLLGIGDIESLLEQFQTVSNKEDTKATMENIQQGRFTLLDFQKQ
FT                   MQTIMKMGPLSNLASMIPGMSGMMSGISEDETSRKMKKMVYVLDSMSREELESDGRVFI
FT                   DEPARMLRVARGSGTSVFEVEMILMQQQMMARMAQGAKNMGGLPGMPAGPGMPRLSPQM
FT                   MQHAQQQLRQNPSMMRNMMGMLGGGSGAAMPDMADMMRMMQDPQMQQMASQFGMGL"
FT   CDS_pept        416501..417913
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761306"
FT                   /locus_tag="AAR042W"
FT                   /orf_name="AGOS_AAR042W"
FT                   /product="AAR042Wp"
FT                   /protein_id="AAS50407.1"
FT                   /db_xref="HOGENOM:HBG057997"
FT                   /db_xref="UniParc:UPI00002524A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN7"
FT                   /transl_table=1
FT                   /translation="MAATNAVEAGYGGAAENGGCAEGLLGSPMRFSPSSKLKVNHGHFM
FT                   ANINNNAGPGKGGTAAGGTSPTREASYANVSGSGKVIENLHQQVDALTSTNLQLTKQSN
FT                   QLLEKLEGCNAREAKYLETISSLKHENENLNSMLNRKTRRVKDLDMELVQLRTSHEEAT
FT                   ASHNQLKYQLENKFAHETELEQQCQLLQAQYDAVVDAQRRYREHYQKEIEELREALEAL
FT                   KKDNDKFLGEHMARLTRSQLDIDKSMSDYNGKFHRMELSQKEAVIELNEKYDRMRADLD
FT                   VDGWIVLYKQMRDIAFDYAKQLDLSLPKEFAELHGEDGYYAKMLDEDRQSSPVSTSSTA
FT                   VEPMSQPSPSMSAQTLSPPPLRVPKNRTPITKRSSFYGNTMPGANISLTSATGLLPGVK
FT                   RTGSIRSFHGRAPSEGLSDTPTIFTASRNASPMEFPQRSALTSAASANATVRHSSVPRH
FT                   RRNQSSQVGNNK"
FT   CDS_pept        complement(418277..419890)
FT                   /codon_start=1
FT                   /gene_family="HOG000248044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761307"
FT                   /locus_tag="AAR043C"
FT                   /orf_name="AGOS_AAR043C"
FT                   /product="AAR043Cp"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="AAS50408.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG057998"
FT                   /db_xref="HOGENOM:HBG397739"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI00002524A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN6"
FT                   /transl_table=1
FT                   /translation="MILLLDGAELILLAVLTHLAYSPYTKVEESFTIQAVHDILKYGIS
FT                   GISEYDHQAFPGAVPRTFVGALIIAGILKPLSWLFGLQGGNEVSSITGIAMQKWARAIV
FT                   GCLNVLALFRMKRVVERKLTANDEPKKRNPLRHTGYWFVVFLSAQFHLMFYASRPLPNF
FT                   VVCLPLAVTALSLAIEERYCFSIGLLSFTAVVFRLELGAMCIGLALAALVARKVSVMEI
FT                   IRFGIIGSGVGLGLSATIDSYFWGRSCVPEMDAFVFNVIGGQSAKWGTEPLLAYFTRYL
FT                   PRLFFPPMVTVFCIAGVRIASTPFRIVFAASLIHIMLLSLQPHKEWRFIIYSVPAITLL
FT                   GSMGAAYLFSLANWRQANGFSMRILILISPLLMLMHSVLMSYISSMNYPGGYALSAFNK
FT                   YVLDNNISNATVHLDVFTCMTGATLFGQLPDSYGIIYDKTEGDELLDAWSSFDYVITTD
FT                   PNSSLPPVTGYKWERIQTTEAFDRFDLKTIPEIINSEVAKGFPILKDAILSADLQPVKA
FT                   AFTDVIRCRDSVYTYKRVEN"
FT   CDS_pept        420064..421296
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082153"
FT                   /locus_tag="AAR044W"
FT                   /orf_name="AGOS_AAR044W"
FT                   /product="AAR044Wp"
FT                   /protein_id="AAS50409.1"
FT                   /db_xref="HOGENOM:HBG402319"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI00002524A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN5"
FT                   /transl_table=1
FT                   /translation="MPLKNFQYREDEDGELPPLVTGLEENIQELLSELKPDGGLNIVNE
FT                   RKIEQANKQHQGAGSQKKIPVTVITGYLGSGKSTLLEEITKRGSDMRIAVILNEFGDSS
FT                   EIEKSLTIKNNGKAYEEWLDLGNGCLCCSLKDVGVKAIEAMVSRSPGKIDYIILETSGI
FT                   ADPVPIVKMFWQDEGLNSCIYIDGIVTVLDAEHVMTWLDEVAPPRQWRGDQVLMENQMT
FT                   VAHLQLAMADAVVLNKIDRLEGLDDEIAVVEEKVRSINAVAPIYRTKFGDLEINKVLNL
FT                   HAFGASDIPDAHVAYHDPRLSTVTLTCRPLRDKAELEWFEEHFLQALLWKDFGRGELTQ
FT                   GQEFEIHRTKALLLVGSEFKIVQGVRDTYEVLRGEPVPGVKQCKLVFIGVHLDKQYIQG
FT                   IMESALNARIE"
FT   CDS_pept        complement(421382..422311)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761308"
FT                   /locus_tag="AAR045C"
FT                   /orf_name="AGOS_AAR045C"
FT                   /product="AAR045Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS50410.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG057999"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI00002524A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN4"
FT                   /transl_table=1
FT                   /translation="MTVGNGKRLVALSWVVLFGVMSYFGVISAAQAKSVKMYPPNPPIS
FT                   QRVQMLLRYDGGEKQEELEIGIELYGSVVPDTVKNFREIAKGVKAKIKGTDQVLDITYK
FT                   NTVFHRVVPEKYICGGKVLDYRFSIHGQTFKDENFDIKHDRPGRLAMVNDGPDSNHSQF
FT                   YIVTSLEPLEENDGKNVVFGQVYDGLEELLEKVRHLPLDEQGKPTSNLKIVGIHVDDLS
FT                   IQNMDELVALYKQSLVKYHAGDTSVGVPETAFLRKGAGENGAVISSFEYSKQRVVVFGL
FT                   VFALLYIAAKRGRSYLASKANVVSVRNG"
FT   CDS_pept        complement(422643..424277)
FT                   /codon_start=1
FT                   /gene_family="HOG000034133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930810"
FT                   /gene_name="ATG15"
FT                   /locus_tag="AAR046C"
FT                   /product="Putative lipase ATG15 "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="autophagy"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="multivesicular body membrane "
FT                   /protein_id="AAS50411.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="GO:0032585"
FT                   /db_xref="HOGENOM:HBG192013"
FT                   /db_xref="HOGENOM:HBG398588"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI00002524A4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EN3"
FT                   /transl_table=1
FT                   /translation="MVADFDSGWYEGAGDELGQGARNGVLRERLGGNEKAQVVRSRRKA
FT                   VAWNVLMVLGLILYVLYSACFAQARQWWRTNGMARGSQAGRFQLVQVHHHGVGAEHATH
FT                   LVLDVDAEFRKEAAAEYSVFALHGEGQELWPEAGRRRAANPFEYAYALREERATVVRAQ
FT                   QQVPEFMEPYLDFALERPDLAEQIKMDWGYENMFVPNITDKETVISLALMSSNAYVRLP
FT                   NTGNWRNVTSWNSSVEGDQIHLGWDENGLRAHVFANEDRSVVVLALKGTSSQVLPGSGD
FT                   DDETSANDKLNDNLLFSCCCARVSYLWTTVCDCYIKSYTCEESCLESELRRKDRYYQAG
FT                   LDMYKQVLAEFPDASIWLTGHSLGGALASLVARTYGVPAVTFEAPGELLATQRLHLPQP
FT                   PGLPNQLDTVWHFGHTADPIFMGTCNGASSACSIAGYAMETSCHSGKSCVYDVVNDRGW
FT                   RVNLLHHRIHTVIDKILDDYDAVAACVPPDICHDCYNWNYVRWRDGTTSPMPSSVASKP
FT                   TPTPTSPGSPSSTCKGRNWFGYCTEYA"
FT   CDS_pept        complement(424520..425497)
FT                   /codon_start=1
FT                   /gene_family="HOG000258174" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930811"
FT                   /locus_tag="AAR047C"
FT                   /orf_name="AGOS_AAR047C"
FT                   /product="AAR047Cp"
FT                   /function="pyridoxal kinase activity"
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="AAS50412.1"
FT                   /db_xref="GO:0008478"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="HOGENOM:HBG096859"
FT                   /db_xref="HOGENOM:HBG661459"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI00002524A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN2"
FT                   /transl_table=1
FT                   /translation="MPKIVHQPHSTIAHGHRASLPGAGMTKKLLSVQSHVVQGYVGNKA
FT                   AVFPLQCRGWDVDVVNTVQFSNHPGYGTHTGFRTQPEVLGRLVEHSLDGPLGLEHAAVI
FT                   LGYLPDAEGLRRAAAAIARACCARPALAWVVDPVLGDAGRLYVPPEVLPQYRALLRGGG
FT                   VLAVTPNQFELELLVGAAAGSRAALRHALDAFHEQFPRVPYVVVTDVRLAGDDALCYTA
FT                   CSDGRAARLFATPRLPAAFAGSGDLFCALLVDALCSGSSPALADAVACALARLGGVLQR
FT                   TYELACAKNCDEPPPQVVRDLRLVECRDLLVADVAPQLKGEDLP"
FT   CDS_pept        425637..428672
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777819"
FT                   /locus_tag="AAR048W"
FT                   /orf_name="AGOS_AAR048W"
FT                   /product="AAR048Wp"
FT                   /protein_id="AAS50413.1"
FT                   /db_xref="HOGENOM:HBG058000"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00002524A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EN1"
FT                   /transl_table=1
FT                   /translation="MKLQSTLYNVGYPVYGARFLNANTLLVTGGGGEGNHGIPNKLTAL
FT                   QINFSKKKIVKRFRELTLDENDDSPTTLDVAQDVILMGCNENSEKIRQGAPNHHLRKFV
FT                   YENEHLKFVGAIDLNRSDNPEDYTKLLYMSQDGWVAAVASSAVPTVIRIVNPGNLRETY
FT                   EVETGNDVKDLHFSSDGKVLAYITASTLEVISIVTGNFIVRKTDFDKNLSLSKIRFIGE
FT                   DTLLIAAALKKGTGIVLTKLSLKKGNTQILRTCVITKKFKSVTSMDVDPKGQLAVLAGS
FT                   DNSLALVKLRNFSVAKFFKQVHTFAVTRVVFSPDSRLLVSVSAANTVHVVQLPEDFATR
FT                   TTLTENLIKFFTNFVLVVLVALFARFAHQHGLHTKAYNIVSNTLRKPENRRTSFFSDIL
FT                   NQQITLSGDVVSSSTTAVDTVHSSVDTSGWYLDSTRSGTDAVASGDRLDGGAATIESLA
FT                   KSAGVDSPVEVETLPHANSTTFSEVTAYTGEYPEVVSSATSEVAMESSVDSKFMAIEAS
FT                   TTPAITISTSLQSMSVSDVYTGTSAAEDASSTGSDASVVLEKTAILNPSSTNIAEDEFV
FT                   DAIAEPPSASVDSTPYVTAARDYSSEDTGERSEPTITEYKTAIESPSTFGDDNESVFLV
FT                   TSADLHPSVSSASQTLTTEELQAVANSHQYKTEVQIVKQDEDEVEDVLELDSPPASLYD
FT                   GDVLKEAEKNDSSNVIPDDSIDIDEYLDENLVKNFTLENALSLDEIFDDDNVVFGEEKL
FT                   LVDPDLEFPELTGMEQDMESDYLPLIENGTEAVLQLDPNIDDIDLDNNMVYADDAQPVS
FT                   DGLQNIAIMPDVIDNLEIQTFSEQEKQQLEPSSIESVATSLEVPNEATTYEVEAADLTS
FT                   SVDPIEIVIETAETAYNDASPDIVNLENTLTSTEQQDSAPDINEVDDLETEVEVKTEFL
FT                   EDIVDFQHPVETSAQFNVPKTPALEVIDQPQPVTQVQTVIETVVDGTTRPANALLMNST
FT                   VEVITVKEIVKETVFVTEKVTN"
FT   CDS_pept        complement(428880..430211)
FT                   /codon_start=1
FT                   /gene_family="HOG000248313" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930812"
FT                   /gene_name="RAD18"
FT                   /locus_tag="AAR049C"
FT                   /product="Postreplication repair E3 ubiquitin-protein
FT                   ligase RAD18"
FT                   /EC_number="6.3.2.-"
FT                   /function="damaged DNA binding"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50414.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG058001"
FT                   /db_xref="HOGENOM:HBG204057"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00002524A7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EN0"
FT                   /transl_table=1
FT                   /translation="MSIQPGQVVTDPSDFAGTTIPELADLDSLLRCHICKDMLQTPVLT
FT                   QCGHTFCSLCIREYLNKESRCPLCLAELRQNMLQKEFLVGELAACYMELRARLLETVRI
FT                   PPKKVAEVVQNNSPIELDSDGEVEIIESCTGAVPGSKRGSPQVEEVEAAAKRQRTKQNG
FT                   IQYMLQKKPKAVGEKVPCPICNRLYNKEFLERVHLDECLMMGTLRESGESDITVIEQQS
FT                   YTAEPDSKNSHVAERRGESPVDEVVTHKESYLGSGLRVTKSRLPKLHFTSLSTSQLKQK
FT                   LSELGLPTAGSRQQMINRYNHYELLWNSNFLDSIQPVGEGELRRSLLSWEATRNTDTPI
FT                   SSGVSSSITNMLKTNNSASTLLKSFKTDKFDKSAWSRLHGKEFRRLIRAAKKSMLEQDR
FT                   GEAITAQNNELSTKASVDMESTSFRNDTNDTIDTVTDEVHEDLK"
FT   CDS_pept        complement(430603..431964)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761309"
FT                   /locus_tag="AAR050C"
FT                   /orf_name="AGOS_AAR050C"
FT                   /product="AAR050Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50415.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058002"
FT                   /db_xref="HSSP:1JXS"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI00002524A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM9"
FT                   /transl_table=1
FT                   /translation="MHVNVAVTRDADATAATPIARERKRRQPLSPEMSSPLRGSKLQRR
FT                   KQTLEAGPGRASGTHTVDELAAQLERGCEQASERKPPYSYAVLIGVAILQSQEGKLTLS
FT                   QIYRWISSFFPYYRLCDAGWQNSIRHNLSLNEAFVKGGKSLDGKGHFWEIKGNCEGRFF
FT                   RDGAEYTGAAIRQRLQRAGATRERVEPENEPVLLPSLAPAPAVAVRSYDVFKRRYRNPD
FT                   TFDEAGYATDPEARNHEEVATPEHPSVASDVSSEEGPERQRTPDSLDHEGSWNCMGSTS
FT                   NETLSSSPLMRRYTCSFNTCFDPASPDEGVLLQPQLLETPQSHSPLQTPREQPASAGKL
FT                   HTPFFDDFFGSPIILMPAGTPNGYVDESALDNERRIVPRSPRRPLNSSASSSFGLHRPQ
FT                   SILEAPHISTSALFGVDLCSVWRRALGGSEDRNDYASQQRLDILFKPAPDADRK"
FT   CDS_pept        complement(432400..432846)
FT                   /codon_start=1
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761310"
FT                   /locus_tag="AGOS_AAR051C"
FT                   /product="AAR051Cp"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50416.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG020790"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="UniParc:UPI0001DB27B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM8"
FT                   /transl_table=1
FT                   /translation="MPRPPRSPPPAGFDKVEPTLAAFAEQLRDLQGVSAPRGPRASAAA
FT                   WPVFRVTHERSRYVYTMYHRRRAISRALYDWLLRHRYADRYLIAKWRKQGYEKLCCLRC
FT                   IQPGESQYGHTCICRVPRAALELQSGAAFEQCTRCGCRGCASTD"
FT   tRNA            join(complement(432984..433020),complement(432927..432971))
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        complement(433525..435264)
FT                   /codon_start=1
FT                   /gene_family="HOG000000906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761311"
FT                   /locus_tag="AAR052C"
FT                   /orf_name="AGOS_AAR052C"
FT                   /product="AAR052Cp"
FT                   /protein_id="AAS50417.1"
FT                   /db_xref="HOGENOM:HBG058003"
FT                   /db_xref="HOGENOM:HBG395691"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI00002524AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM7"
FT                   /transl_table=1
FT                   /translation="MRNLATVYLTVLAAAVAAQHGSHSAHGSTGQLNNNSIHPVAHESH
FT                   HMHGMPILETQLTAAERAYWEQYDTMTYFNAPSKRKRGLWMHAAAVAGTALVLYPASLV
FT                   LAESESRWYLVCLAAHCLVLWTGLAALAVYAASLPSTLYPGNVYGTLSWIVAIVSVSHA
FT                   ASAVVVRAAKWLAPDAAPYAIPLELLRPERSSSSHEHSQESIDEHEANVGKMYSPGEET
FT                   AELAPDVEQATGGLRDGYRRERMQAPALLRHPIVQQMAERFGTVFGAVYRITNSLQLLL
FT                   LLVYAAVGFAIGNRFAQGKYVFNFLAHWIKGGIFFLLGVLSLARYCGFGAAHGWAWNAI
FT                   AYKARREDVSRWRRLFPQGTTMEGVESFLIFFYGSTNVFLEHLANPGGRWEAKDLQHVS
FT                   IAFMYIGCGLCGLIVERRLASWRCVAAARVVGDCDEGSPGFSPNPFPALTVFFTGILMS
FT                   QHAQASEVSTVIHAQWGKLLAYGSFFRIFTFLLLLLLPRKGKGPAHPFPELVTSFCLVS
FT                   GGMIFMESTDQVIEALEYRGLTPMFTFNLSVGTTVLVMAWIMLLFSWRDAMCAQSSAHR
FT                   VAR"
FT   CDS_pept        435604..440568
FT                   /codon_start=1
FT                   /gene_family="HOG000216604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625274"
FT                   /locus_tag="AAR053W"
FT                   /orf_name="AGOS_AAR053W"
FT                   /product="AAR053Wp"
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="1,3-beta-D-glucan biosynthetic process"
FT                   /cellular_component="1,3-beta-D-glucan synthase complex "
FT                   /protein_id="AAS50418.1"
FT                   /db_xref="GO:0000148"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0006075"
FT                   /db_xref="HOGENOM:HBG056034"
FT                   /db_xref="HOGENOM:HBG332273"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="UniParc:UPI00002524AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM6"
FT                   /transl_table=1
FT                   /translation="MEENAYLDGAGDRETGDQETSDQAYDTGGYSSTSDGGSERAHYGQ
FT                   VEERWGPPRDKDSHWEQDSSEQELMGNKALSEYSEETQRLFTHLQEVFQFQKDNCKNIY
FT                   DYFVALVQSRRRGKRNNFERAVDTLYADYVFGPNSNFHKWYQFVYGEDEMPHWAYGTLD
FT                   DRITQVALYLLIWGEANNVRFMPELLCYIFSIMCNHYYGNMLHDAKTVGPFLDHAITPI
FT                   YDYYYAQLTSGKDHSSVVGYDDINQCFWNRTFIYTLPVKGVGPLKMIPTDEHYVFFNRI
FT                   VWNQCLVKTYYERRTWFHVVTNFHRVLVLHLSVYWYYLAFNVQPLYTKDYSIVEDNTPP
FT                   IYVVLLVMSFAGGLASSITLGALIGEAIFVPRRSPVATPMVTRFLVTTMSVIANTVPAV
FT                   VLLYLDLDFMGTPLGLLVATAILGFSLITVVYYTLQPLKHLYTRAASDPFTSNIHNLSR
FT                   HSQTASVGLWSLIFISKFVESYFFLTLSVKDPIRELFMLRIDNCNEDAWLGKWICENHG
FT                   KILTCLLIITHCVLFFLDTYLWYVLYTTVFSMCRSLHLGVSACVPWKNVFFELPLKFCE
FT                   RLLLKKGDVYDGLSFATMWNEIIFSMYREHILSFEHIKKLRCELDDNGELRGPPIFMKR
FT                   KSKAIKATVFKKSAEARRRLGFFSKSLSCPMPEPYPTSEMPMFSVLIPHFKEKIILSIK
FT                   DIVKGENDSTHVILLEYLKLLYADDWKTFIQETGSLYNDDDEKASNRANALSDHESCAT
FT                   RALFSLPYSFAGFKTDTPEYTLRTRIWASLRTQTLYRTISGFMKYKGAISLLHKYETDC
FT                   TTEEATEMALSKFRIVCSMQRMAKFTEEELEDRDYLMSLFPNLQIAYVDEDYDPATGKK
FT                   VYYSSLIDGYCDTTEDGKWKPRYKIRLSGNPVIGDGKSDNQNHAIIFTRGEYIQLIDAN
FT                   QDNYLEECLKIKSVLSEFENDVPDKTDIRGVLNPVAIVGSREHVFSEKTGVLGDLAAGK
FT                   EQVFGTFFARTLSYIGAKLHYGHPDFVNAIFVTTRGGVSKAQKGLHLSEDLFVGMSSIL
FT                   RGGRIKHCEYTQCGKGRDLGFGSILNFATKISAGMGEQILSREYFYLCSNLPLDRFLSF
FT                   YYAHPGYYLNNVSIILSITLFMILILSIAVLVDTSEICDDHMTHQELQELNCANIKPVI
FT                   RWLRRSVLSIFVVSTASSFPMFAEDISEKSISTGVRRILKHLITGAPMFEIFVCKVYSG
FT                   SLINDLYAGGARYIATGRGLAVIRVPYANLYSKFAPESFYFSFCCLLVLLFATTTMWDP
FT                   VLIYFWFTISSLLLSPFIFNPNQFSWNDFIVDYKNYWRWLSSSRIGANIDSWISYTRNS
FT                   HLKSTSSQNAIMGTPKVKEIMSVCSRTLWTLMIFIPYIFINSRSTVPFSTNTIRYVVMR
FT                   IVVLSAMPIVLNAIWLIILSMVSILCSLTLRKAAPGYPKVICSIAHGLGILSHLASFGL
FT                   LCVLYRWNLRFIIMSLLVVTLLESLFLRIIGLLDFTYNKYAEKSNFAWWSGLWLNEKFS
FT                   WRYALEPLCEYVRKVMELSWFCSDFVLGHLLLFFQIPILLVPNINKIHSFMLFWKKAGF
FT                   QIRPLLFSRKIKRKRQRITRLYSCIFIIMLFFFIALLLSPLLLDRVFHLRFDHTVPSRI
FT                   RILFHSDIRTSNNNPT"
FT   CDS_pept        complement(440682..441083)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082154"
FT                   /locus_tag="AAR054C"
FT                   /orf_name="AGOS_AAR054C"
FT                   /product="AAR054Cp"
FT                   /function="binding"
FT                   /protein_id="AAS50419.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123819"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI00002524AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM5"
FT                   /transl_table=1
FT                   /translation="MVAPARNSDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHL
FT                   ANMSMALLKLERWEDALSACDRALEIMKKGPVTDDKILQKVQWRKKLAHEHLAGTERDI
FT                   KSTAQNVEARYCAIPIEEFDDLPTELQEL"
FT   CDS_pept        441219..442037
FT                   /codon_start=1
FT                   /gene_family="HOG000160430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777820"
FT                   /locus_tag="AAR055W"
FT                   /orf_name="AGOS_AAR055W"
FT                   /product="AAR055Wp"
FT                   /protein_id="AAS50420.1"
FT                   /db_xref="HOGENOM:HBG144558"
FT                   /db_xref="HOGENOM:HBG407584"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00002524AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM4"
FT                   /transl_table=1
FT                   /translation="MALNEEVAEEISAVDAIYPGNLSRLSENRVLIRIPNYEEIAIQIS
FT                   FPSNYPAEEPPHILEISISHEKVQRYERSDLQPVCEELMASVYSKGFVCLFDFISELSN
FT                   VLYERFGAQDDDTEDDELAERMGHLNLDPFDGWIASDPITDRSSTFIAYAAHVNSEEDA
FT                   CLRIDQLKTDNKISKCAHLMTAWRIHGENGVAYKDCDDDGEAAAGSRMLHLLNTMDAWD
FT                   VVVAVARWFGGVHIGPDRFKHINSCTRDALIKGDFVSQAKAGSASKKTKK"
FT   CDS_pept        complement(442147..442614)
FT                   /codon_start=1
FT                   /gene_family="HOG000141979" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625275"
FT                   /locus_tag="AAR056C"
FT                   /orf_name="AGOS_AAR056C"
FT                   /product="AAR056Cp"
FT                   /protein_id="AAS50421.1"
FT                   /db_xref="HOGENOM:HBG103701"
FT                   /db_xref="HOGENOM:HBG124135"
FT                   /db_xref="UniParc:UPI00002524AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM3"
FT                   /transl_table=1
FT                   /translation="MANNMAKEVSGKLSSRVMNMKFMRHAEQAEEEQRVEVEQRKFIDS
FT                   SEWSIPGRRERLRQIPTPRPVVAVGHTVIRTIDAQGGQASATPGRRKFGSTPVEAADAS
FT                   GSETHTASTAEPKAEDLETLWKSEKRTKRPKTGAAERPGGVKKRNRQGAKN"
FT   CDS_pept        442797..445565
FT                   /codon_start=1
FT                   /gene_family="HOG000160363" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930813"
FT                   /locus_tag="AAR057W"
FT                   /orf_name="AGOS_AAR057W"
FT                   /product="AAR057Wp"
FT                   /protein_id="AAS50422.1"
FT                   /db_xref="HOGENOM:HBG037471"
FT                   /db_xref="HOGENOM:HBG721153"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00002524AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EM2"
FT                   /transl_table=1
FT                   /translation="MSYTTERSSKARHWTTMKSDFKFSNLLGTVYRQGNVVFSEDGTLL
FT                   FSPVGNRVSVFDLIGNKSFTFEYEHRRNIARIDVNAQGTLLLSVDVDGRAILVNIKTRN
FT                   VIHHFNFKDKVNDVKFSTDGKLFALACGRFLQIWRTPGVSAERQFAPFVRYRVHAGHFA
FT                   DITSLTWSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRDYVMGAFFSADQEKI
FT                   YTVSKDGALFQWEYTKNPALAEEDDEDEELDLSKYSWRITKKNYFYAKNAKVKCAAFHA
FT                   DSNMLIVGFSNGEFRMYELPDFTFIQQLSMGQNAVNTVAVNRSGEWLAFGSSTLGQLLV
FT                   YEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTS
FT                   SVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCA
FT                   GSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWSIFGRS
FT                   QQVEPIEAYSDVLDISMRPDGKQVAVSTLNGQLSFFDVETSRQVGNIDCKRDIISGRHL
FT                   EDRFTSKNSARSKYFTTIHYSFDGLSIVAGGNNNSICLYDIPNEVLIKRFIVSRNMTLN
FT                   GTMEFLNSSKMTEAGSLDLIDQDAENSDLEDRIDVSLPGSRRGGDMSTRRVRPEIRVTA
FT                   VRFSPSANAFAAASTEGLLVYSVDDSVLFDPFDLDLDITPQAVLDALANGDYLHATVMA
FT                   FRLNEEYLINKVYEAIPPDHISLLCSNLPVVYVPRILKFIGDFAMDSQHLEFNLLWVKF
FT                   LLAAHGHYMVAHKHQFASALRAVQRFLGRVAKDVAAAARSNTHSHTFLTSTHSSLPMSG
FT                   FGADDQELNSEHESSDEDMEMLSDTEGTWLGFSDKEKPVPLTNDDSDEDLI"
FT   CDS_pept        445850..447454
FT                   /codon_start=1
FT                   /gene_family="HOG000000904" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777821"
FT                   /gene_name="CTR86"
FT                   /locus_tag="AAR058W"
FT                   /product="Copper transport protein 86 "
FT                   /function="binding"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50423.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="HOGENOM:HBG049097"
FT                   /db_xref="HOGENOM:HBG058005"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR019156"
FT                   /db_xref="UniParc:UPI00002524B0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EM1"
FT                   /transl_table=1
FT                   /translation="MAHPSEVAQLGLLAKSVNNESAEFTGLSDALEKLGPIVRNSSLDH
FT                   NYRKELSEDRAIWKEICDCLNGAHLDRVEEKEPRHLRMRAVRGMILLGRNLSVENQRLP
FT                   QELALHSRVVELLAQVQCQYDEMEIALHKAAYELLYNLTRASATFDQQSLGNVCRALRY
FT                   PLGAHGSRDLALPVSLYFLNMVRDDEFLFAFLKHPDADKIVYQFMLQGVIKNHTELFDV
FT                   IDNKTHDLENLSSLGAIQMSIWSCLVTHASFSPYLERLESHNWEAFDTILRFAQLVVTS
FT                   SEKWDKEQLTAITVWAFRIFESTASSVEEYTRRGIDDEAEASRLHQKLLVVLDILSVFS
FT                   KYESIRKFIMFYNGVEVLINTLRYLQNHCMRINFTKAKSNMAATFKAYNSNYERVEDEG
FT                   KIKSIINIETSSIKSTNFPECKSLIIEILGFLTYKNREVQDKCRELHGLELVLSNCVID
FT                   DNDPFIKERSIMCIRFLLEDNAENQSFVAQLEAKKAVNDDVLAEAGYEVKVGADGKIGL
FT                   TKNPRAAVEDKMDLNLT"
FT   CDS_pept        complement(447537..449075)
FT                   /codon_start=1
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761312"
FT                   /gene_name="THR4"
FT                   /locus_tag="AAR059C"
FT                   /product="Threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="AAS50424.1"
FT                   /db_xref="EMBL:CAA62506.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG123097"
FT                   /db_xref="HOGENOM:HBG521025"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI0000136ECF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00063"
FT                   /transl_table=1
FT                   /translation="MSQVYRSTRSSSEDTKSFEEAVIQGLAEDGGLFLPAVIPRLREET
FT                   LFEHWAHLSFQDLAMEIMKFYIADWEIPAPELRELIERSYSSFRSEEVTPLRKNVTGDD
FT                   ENLHILELFHGPTYAFKDVALQFVGNLFEYFLERKNRDVSEEERTHLTVVGATSGDTGS
FT                   AAIYGLRGKQDVSVFILYPHGRISPIQEEQMTTVEDENVHTMAIEGSFDNCQDIVKSIF
FT                   VDEEFNRKHNIAAVNSINWARILAQITYYFYSYFRATDGQPGRVKFIVPSGNFGDILAG
FT                   FYAKQMGLPIEKLVIATNENDILDRFLREGVYERSEDVTATHSPAMDILVSSNFERLLW
FT                   FFAREQLAQGDDQEAGSIVNRWFEQLREERRFDVPEHLLDAIRYHFDSERVDNYNTLAS
FT                   IRHIYEHAQNPERYVIDPHTAVGICAANRQIAHDQNNEIHYISLATAHPAKFADAVNEA
FT                   LSSYDDYNFDDVLPDRLRRLGDLEKRIKYVDNTDVDVIKSIIEEELINMGIYNP"
FT   CDS_pept        complement(449348..450718)
FT                   /codon_start=1
FT                   /gene_family="HOG000000860" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082155"
FT                   /locus_tag="AAR060C"
FT                   /orf_name="AGOS_AAR060C"
FT                   /product="AAR060Cp"
FT                   /protein_id="AAS50425.1"
FT                   /db_xref="HOGENOM:HBG058006"
FT                   /db_xref="HOGENOM:HBG204053"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="UniParc:UPI00002524B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL9"
FT                   /transl_table=1
FT                   /translation="MNRAAKPSHKPMQQTSPAPVTQPTDTYVQPFLKELIPELKSLESL
FT                   RDAERRMDVYISRKKIDLHQSITQWTYQKQRDYSESQFLRVFISTIAENQPWQTNSDDL
FT                   DQGTWTLRIEGRLVNDENVQVPTRPKFSTFLQSIALDFHGQDGRAEDGDGDQLMDDEGV
FT                   PAVMPQRKYDIVEWHADPNTPVEFDGLDIKRQGTENVDCTITIQPKGYSGDQLQYSDAL
FT                   AFIIGVARGTVHEAIYSLYKYILLNELLVADPSGNAKSTQNDDKMVIKVDAMIAKLLPP
FT                   AAEPRKYLKLTELPQVVNAHIKPIPPVRINYTIQVDKTSTYGELVFDIRVPRVPVKDPE
FT                   PASAQNSLAQQGMLLLTEFNTVTSQLEPQLATLEKKTQLLSLQLSSTANKYQFFNKLAD
FT                   DPVPMLNDYIKATSNALKVLSGDDGFDEDTVRRSNFYQENEAVLFENLGVLLSNGRM"
FT   CDS_pept        451072..451503
FT                   /codon_start=1
FT                   /gene_family="HOG000057082" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625276"
FT                   /locus_tag="AAR061W"
FT                   /orf_name="AGOS_AAR061W"
FT                   /product="AAR061Wp"
FT                   /protein_id="AAS50426.1"
FT                   /db_xref="HOGENOM:HBG058007"
FT                   /db_xref="HOGENOM:HBG202719"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="UniParc:UPI00002524B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL8"
FT                   /transl_table=1
FT                   /translation="MFRPTLRACSAYSKRNNKVRVQILQNFERFQLYRGEVVNVSPSLM
FT                   RNYLHRNNGARYILWEKDIDQGLVQEAAATRQRMLSQRAAAEASEPDAEPVTIQKTAET
FT                   GSPAAEPTEKEAPAEAPAKRSGLSPRPTVADVKIPGLEL"
FT   CDS_pept        complement(451601..452830)
FT                   /codon_start=1
FT                   /gene_family="HOG000057148" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625277"
FT                   /locus_tag="AAR062C"
FT                   /orf_name="AGOS_AAR062C"
FT                   /product="AAR062Cp"
FT                   /protein_id="AAS50427.1"
FT                   /db_xref="HOGENOM:HBG058008"
FT                   /db_xref="HOGENOM:HBG202718"
FT                   /db_xref="InterPro:IPR012879"
FT                   /db_xref="UniParc:UPI00002524B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL7"
FT                   /transl_table=1
FT                   /translation="MTGVFGFLSKGLDAINSLNSHYFALSVDEQKAMTFVERIRYYNWT
FT                   FEGICVVLLGLMYAVYVAGTKLNERRSDRLFEQLNKFFWEELQFARVGFSSRDKGRLPY
FT                   ISDRNGTWCTAFATGRTCVDHIVVKAHYPARFNPVGLLVEKLLGMFFPQVVDPHGDEFV
FT                   QVTVTPNGKWTKDENSAVQATEDGLNRFRFIASIVNKNGMNDSRGKNYFLSLTHTSEGE
FT                   TLPMEYVFMSENNQLNKLLVSYMDGEAFRQTLKRAAHFLRFIAFTDLPEEKPVTDKLWE
FT                   ANQKPRCVIQCSAVLTDADVALLRELIAAVVAFYDVTTREIVQQSPSLLLTNETLRRSV
FT                   QLRKDELSKIVKIMKQVEREMAQEKKAEEEKKKRRELRDSLSGEQQDKLDQKLKQKRDR
FT                   RKKNKQALRV"
FT   CDS_pept        complement(453075..453737)
FT                   /codon_start=1
FT                   /gene_family="HOG000208262" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761313"
FT                   /locus_tag="AAR063C"
FT                   /orf_name="AGOS_AAR063C"
FT                   /product="AAR063Cp"
FT                   /protein_id="AAS50428.1"
FT                   /db_xref="HOGENOM:HBG051834"
FT                   /db_xref="HOGENOM:HBG396478"
FT                   /db_xref="HSSP:1BD8"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00002524B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL6"
FT                   /transl_table=1
FT                   /translation="MNVWVAASDGLTAQVEELLQQTGADANVKDPNGYTPMHAAAAYGH
FT                   IDLLRLLIANYRGDVNVRDNDGDTPLHHAEDLQTVRVLVEELGADPSLLNADGNTPLAV
FT                   YEDDAENAELIEYMRARLGGSACGPAAADAAADAAADLELPDIDSGKLAEFRESIRYTL
FT                   ENVPADETDPESVQRRQRLEEIMRSDCPDEQLEAYIRDMVRNQFFPSTDDTNAKRRR"
FT   CDS_pept        454054..454797
FT                   /codon_start=1
FT                   /gene_family="HOG000244058" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082156"
FT                   /gene_name="ATP23"
FT                   /locus_tag="AAR064W"
FT                   /product="Mitochondrial inner membrane protease ATP23 "
FT                   /EC_number="3.4.24.-"
FT                   /function="metal ion binding"
FT                   /function="metallopeptidase activity"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50429.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG038161"
FT                   /db_xref="HOGENOM:HBG610808"
FT                   /db_xref="InterPro:IPR019165"
FT                   /db_xref="UniParc:UPI00002524B5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EL5"
FT                   /transl_table=1
FT                   /translation="MSKEPNFPPSEKLEKVEAPADLRSIAGFEWWRRTFEYKTGLGLTP
FT                   EAKVQYEKDYQYVLQREQCKQCYDNRDWLLKYSPTVVFMTQQIAKLNRRRTGDDSLHFD
FT                   TSKIICDVCPEWKSGGFNPSLGILLCQNRIRDKWQMEDTLSHELVHQFDELKFEVDWMN
FT                   LKHHACSEVRASNLSGECRLSQEFFRRGFNGSFGRGHQECVRRRAVLSVMGNPKCKDKA
FT                   EAEQIVDEVWQSCFNDTRPFEEIYR"
FT   CDS_pept        complement(454889..456673)
FT                   /codon_start=1
FT                   /gene_family="HOG000210250" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761314"
FT                   /locus_tag="AAR065C"
FT                   /orf_name="AGOS_AAR065C"
FT                   /product="AAR065Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50430.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG396447"
FT                   /db_xref="HOGENOM:HBG436525"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniParc:UPI00002524B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL4"
FT                   /transl_table=1
FT                   /translation="MAQVLAHNKDFLRIQELNADGERERRSLYEDQLQAVEEEECLEGC
FT                   AQTVVITAAEPTSAEKTREAAVGGRRQTPPPWYTSALMRKERLRFHQGSGEMQSLLRDV
FT                   QFQCRGTIMDAFVNDPLRIYFSGPCFDSDKNRRLEAEVVEGPAVVRGVALGDGGQVTVQ
FT                   TVTTNFSGFYVLFWLSVAFALVKVTAGYYIKNDGNIMQSEIVHYMTTDLWRVAWFDLLM
FT                   YLCTYFVFGVQWMCRRGWLRWAGAGWLLTSVYELLFFAYFTYVAEHTMRFKWISKIFLF
FT                   LHSCVLVMKMHSYAFYNGYLWQILDELQFSRESLALLKDLDDEVDESVLRTLEKSEKFC
FT                   QFELNSQSTSELFPSNITLRNYFMYSMFPTVVYQISYPRTDRIRWSYFMEKLAAIAGII
FT                   FIMMVVAQLLIYPVTIKAMSLRELGMSFSDRAKLWPNLLIEVVPGFIIMYLLVWYLIWD
FT                   AILNCIAELTRFGDRYFYGDWWNCVNWGDFSRLWNVPVHKFLLRHVYHSSLSAFCLSTT
FT                   QATFMTFILSSLIHELAMYVIFGKLRFYLFLFQMAQLPLMALNNSKLLHNKKVLLNVLF
FT                   WLGICTGPSVICTIYLTF"
FT   CDS_pept        457143..457946
FT                   /codon_start=1
FT                   /gene_family="HOG000111527" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761315"
FT                   /locus_tag="AAR066W"
FT                   /orf_name="AGOS_AAR066W"
FT                   /product="AAR066Wp"
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAS50431.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG444343"
FT                   /db_xref="HOGENOM:HBG491094"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="UniParc:UPI00002524B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL3"
FT                   /transl_table=1
FT                   /translation="MSRPEDLAPPEVFYNDGESQKYTSSTRVQHIQAKMTLRALELLNV
FT                   PPCSFILDVGCGSGLSGEILTEEGHMWCGMDIAPSMLATALTREVEGDLVLQDIGVGVP
FT                   FRAGTFDAAISISAIQWLCNADTSYNDPRRRLMRFFNTLFAALKKGGKFVAQFYPKTDE
FT                   QVEQILGAAKVAGFSGGLVIDDPESKKNKKYYLVLSAGAARDEEQVNLQGVTMNADLLQ
FT                   QRARKRKEAESRKEYIMRKKDVMKKRGRKVAKDSKFTGRKRRPRF"
FT   CDS_pept        458109..458681
FT                   /codon_start=1
FT                   /gene_family="HOG000248530" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625278"
FT                   /locus_tag="AAR067W"
FT                   /orf_name="AGOS_AAR067W"
FT                   /product="AAR067Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50432.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058009"
FT                   /db_xref="HOGENOM:HBG272743"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniParc:UPI00002524B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL2"
FT                   /transl_table=1
FT                   /translation="MEPAHRHHHSAYNGDSLRAMLAARLPFAAARPLCRTFQIPTTASK
FT                   VIPVYPPVEQRARDVIKQISEAKLAQLDPQGVRRKLLSKAEEGCVKAGDIVRVMYDTAK
FT                   CNYGTIYGYVLSVDRGKIVEDSSLLLRNHIGKTSVETRVPVFSPLLARIDILRRGDPKR
FT                   RRNKHYYIRNTRLDVGDLESSMRRRKS"
FT   CDS_pept        complement(458918..459583)
FT                   /codon_start=1
FT                   /gene_family="HOG000248887" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761316"
FT                   /locus_tag="AAR068C"
FT                   /orf_name="AGOS_AAR068C"
FT                   /product="AAR068Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50433.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058010"
FT                   /db_xref="HOGENOM:HBG395789"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="UniParc:UPI00002524B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL1"
FT                   /transl_table=1
FT                   /translation="MKLLTEEEISAHRYHTLSGGIKGMMGGLAISAFIFKVVPMRFPRF
FT                   NPMNFSYSIRTAILISPPTLLASICAEEASNHFDRLMYGANADPNTLAEAKRWAELPLG
FT                   DKLLESGLNNKYKIIGSLWAASMYGSWRLVDRDPIMTKVQKAVQARMYAQALTVVMLLA
FT                   SVMLSMYGAKRNPENKEQRRQRQWELLLDQAANEEREFENSRRLSNEERVKGKIYRYD"
FT   CDS_pept        460792..463062
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761317"
FT                   /locus_tag="AGOS_AAR069W"
FT                   /product="AAR069Wp"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50434.2"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG058011"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI0001DB27CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EL0"
FT                   /transl_table=1
FT                   /translation="MLYKRTVYWLLSVLLLSDGISAEEYVITLKAPKTLSKLLAVKLGN
FT                   RTLKQILDARIKQKFSFGKFEAITVDIPPFLADTLTENKWISHISLNEEYNLLGDEYAG
FT                   EEDTGDDNGDEFENESDDDDGDDEDEEEEEEEDGDGEDGDDDDDTEEDDSRGPPRPEYP
FT                   VAPPSPQRPVFPPEPETPIEVPDPEPEPPVEFPEPEEPIEKPGPKRPVNPPEDEEPYNP
FT                   PEPEAPAEPQPDHPISPPESEQPSDPDTQPPNDPPSFDPQPDQPVERPDLDRPEPEKPG
FT                   NDEPSEGAPEFPTNPEEPQPPSDSPETPEPSNPPESDPIVPSDPETPSDPEPEQPVDVP
FT                   VPAPVTPPGPEEPTSTPDPDSPPDKEQRPDDFDQPRENPNDQQPSPNPDRPEPIRGIPA
FT                   EPVAGAPGEGLHQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVN
FT                   VYVLDSGIYKSHPEFDGRAHFGIDTTKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYE
FT                   IKVMTVDGRGSTSNIIAGVEFAVKHCQQSGKRCVANMSLGGLSFGHSALDSAVEAAIEE
FT                   GLVFVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVA
FT                   SLSNSPSNTMRVLNGTSMSAPITAGVVAVLLDQGIEPHEVKDHLLSISTKGLFHKRRLV
FT                   SSRTPDRALFTGVKREDDSFSTEKFPFVNEEAYLKFIGDDLKKVQGPSLFRKVLRSSLS
FT                   KVI"
FT   CDS_pept        complement(463313..464116)
FT                   /codon_start=1
FT                   /gene_family="HOG000166435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930814"
FT                   /locus_tag="AAR070C"
FT                   /orf_name="AGOS_AAR070C"
FT                   /product="AAR070Cp"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane
FT                   presequence translocase complex"
FT                   /protein_id="AAS50435.1"
FT                   /db_xref="GO:0005744"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG052163"
FT                   /db_xref="HOGENOM:HBG396465"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="InterPro:IPR005681"
FT                   /db_xref="UniParc:UPI00002524BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK9"
FT                   /transl_table=1
FT                   /translation="MCHVMNEKFSASSRRATRAQSHHQVKHDGGPTEHRPVEGSHKVSA
FT                   RQGYQTKELRWDMSFLFGSKKQDSGADDRKLQETLGFDPQQVTNVANIIATPGALDPSR
FT                   LHPLAGLERGVEYLDLDEEKLSSVEGSQGLIPSRGWTDDLCYGTGSVYLTGLGLGGAYG
FT                   FFEGLRNIPPNAPGKLQLNTVLNHITRRGPFLGNNAGVLALTYNLINSTIEGLRGKHDA
FT                   AGSIASGAIAGALFKSSKGLKPMYYASGSMALVAAGWCGLKTLLL"
FT   CDS_pept        466766..473461
FT                   /codon_start=1
FT                   /gene_family="HOG000214115" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761318"
FT                   /locus_tag="AAR071W"
FT                   /orf_name="AGOS_AAR071W"
FT                   /product="AAR071Wp"
FT                   /function="ATP binding"
FT                   /function="acetyl-CoA carboxylase activity"
FT                   /function="biotin binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="AAS50436.1"
FT                   /db_xref="GO:0003989"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG268453"
FT                   /db_xref="HOGENOM:HBG320067"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI00002524BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK8"
FT                   /transl_table=1
FT                   /translation="MSEGSFTEAMESQKRYEFTDYSAKHARLAPHFIGLNTVEQAEASP
FT                   LRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLE
FT                   ANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHASENPLLPEKL
FT                   ARSKRKVVFIGPPGSAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDQVEIDPHTKLVSV
FT                   ADDIYQKGCCLSPEDGLNKAKQIGFPVMVKASEGGGGKGIRKVVREEDFISLYQQAANE
FT                   IPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPD
FT                   TFAEMERAAVRLGKLVGYVSAGTVEYLYSHEEDKFYFLELNPRLQVEHPTTEMVTGVNL
FT                   PAAQLQIAMGIPLHRIRDIRLFYGLDPHTATEIDFEFSSADALQTQRRPIPKGHCTACR
FT                   ITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQ
FT                   ASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDLISQKISAEKPD
FT                   PMLAVICGATTKAHIASEQALQEYASYLKRGQVPNKNMLKTMYPVEFIHEEKRYKFTVA
FT                   KSADDRYNLFINGSRCEVGLRKLSDGGLLIAAGGKSHTVYWKEEVAATRLSIDHQTTLL
FT                   ETENDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPLIAQESGVLQLLRQ
FT                   PGSTLAAGDILAILTLDDPSKVKYAMPFEGMLPDLGAPVIEGTKPAYKFRSLVSTLENV
FT                   LKGYDNQVIMNASLQKLIEVLRDPQLPYSEWKMQVSALHSRLPQALDQQLEQLVERCHK
FT                   RSADFPAKQLGKILENAINERKSDPLFQTVVEPLTSITTRYKTGLQDHEHAVLGSFLEN
FT                   YYSVEKLFSGSKVNEEDVILKLRDENADDLNKVVMTVLSHSRVSAKNNLISAILKHYRP
FT                   LCKLSSEVAAKISVPLKHIVQLESKATAKVALQAREILIQAALPSVRERTEQLEHILKS
FT                   SVVKPTYGATEMNHTDPNIEVLKDLIDSNYVVFDVLTQFLNHRDKYVIAAAAEVYIRRA
FT                   YRVYTVGDIKYHSGFDTPIFEWKFQLPSAAFTSRPQVTSRLGVNRAISISDLTYVSEAE
FT                   NQPSRTGLLVPAPHLDDVDSILSNALSVIPMQLSHSGPLPDRSAAANPSLSNVVNVVIS
FT                   STEGFDSEAEVLDRLKEILELNKSELLASAIRRITFVFGYRDGSYPKYYTFRGSDYVED
FT                   KTIRHIEPALAYQLELGRMSNFHIKPIFTENRNIHVYEAIGKNSPVDKRFFTRGIIRTG
FT                   RIRDDITIQEYLTSEANRLMSDILDNLEVTDTSNSDLNHIFINFSAVFDVSPADVEAAF
FT                   GGFLERFGKRLLRLRVAAAEIRIMIKDPGSGTPVALRALINNVSGYVVRTELYTEVKNA
FT                   NGDRIFKSLDKPGSMHLRPIATPYPVKEWLQPKRYKAHLMGTTYVYDFPELFRQATLSQ
FT                   WRKHSPKMQLSDDFFIANELISDENGELTEVDREPGTNSIGMVAFKVTVKTPEYPHGRQ
FT                   FVIIANDITYMIGSFGPQEDEFFEKVTNYARKRGIPRIYLSANSGARIGIAEELVPMFS
FT                   VAWKTPGNPEKGFDYLYFTTEMYETLKQSGKENVVITERIVEDGEERYAIKAIIGSEDG
FT                   LGVECLRGSGLIAGATSKAYKDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTG
FT                   APAINKVLGKEVYSSNLQLGGTQIMYNNGVSHLTAQDDLAGVEQIMEWLSYIPAKRNMP
FT                   VPILQSEDNWDRDVEYTPTLSQPYDVRWMIEGRQGPDGFEYGLFDKGSFQETLSGWARG
FT                   VVVGRARMGGIPLGVIAVDTRTIETVIPADPANPASTETLIQEAGLVWYPNSAFKTAQA
FT                   IADFNHGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPVFVYIPPTGE
FT                   LRGGSWVVVDPTINSDQMEMYADSDSRAGVLEPAGMVGIKYRREKLLKTMERLDAKYKE
FT                   LKDSLSDSSLSSEEHQKLANELAAREKLLLPIYQQVSIQFAGLHDKAGRMLAKGVIRKE
FT                   LQWVNARRFFFWRLRRRLNEEYLIRRLESELPNASRLEKFARLRSWYPASVDQENDQQV
FT                   ATWIEENYQVLEDYLQALKLESFAQNLAKAIRSDHDNAITGLAEVLKLLSAEDKEKIMK
FT                   SLK"
FT   CDS_pept        complement(473583..474737)
FT                   /codon_start=1
FT                   /gene_family="HOG000195580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761319"
FT                   /locus_tag="AAR072C"
FT                   /orf_name="AGOS_AAR072C"
FT                   /product="tRNA-dihydrouridine synthase "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="AAS50437.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058012"
FT                   /db_xref="HOGENOM:HBG396464"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI00002524BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK7"
FT                   /transl_table=1
FT                   /translation="MANYAGKLVLAPMVRAGELPTRLLALRHGADLVWGPEIIDKKLVQ
FT                   CQRVPNDELQTVDYVLPSTHAGKPPVVVFRTAPALEGGRVIFQLGTASPTLAVRAANTV
FT                   IGDVAGIDVNAGCPKHFSIHAGMGAALLRTPDTLCGILRALVDEVGRPHSKPISVKIRL
FT                   LDDLAATLDLVEKLCATGISNLTVHCRTTPMRNREAPIRSYLASIFELCQASKVSLIMN
FT                   GALEGRKHFEEVRAELKLPTDVGGMIAEAAEANPTVFSLNPLPWHQAVPEYLQIADQYR
FT                   NHTSNTKYMMNRMVPGKSPFYQYFIRCKTSDDFLYVGKQLGPNGECLSDPTEYLAKSRK
FT                   EEQQEKKATKGKLLQHHDESQSKGKRVLEDENSQESKRTKTEQA"
FT   CDS_pept        475508..479134
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777822"
FT                   /locus_tag="AAR073W"
FT                   /orf_name="AGOS_AAR073W"
FT                   /product="AAR073Wp"
FT                   /protein_id="AAS50438.1"
FT                   /db_xref="HOGENOM:HBG058013"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="UniParc:UPI00002524BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK6"
FT                   /transl_table=1
FT                   /translation="MFKALKKKIQHGKHHAGKAGSDKALDDGRHRSIFGNCGPRLSGAA
FT                   ALGPEIQLIPKQQTLQRGPTRVKPEVCEELLTAAAIYERLRQEDQANGRLIDAYYVYDR
FT                   EAYKAAPAGQDGRDPAFDVFASACVTPTSGRYVIFQLAAFFIEQLNSQLGTGSNSTDMI
FT                   RAAMEIFKPNLSHYSFSETQQIRQLLASFFPRAGCTLAGTALREAIEREFRNNWNRLIL
FT                   ALRILWAELPESIVPWDCFITFKRLEERDGYPTSAFFMLLKQVLPSHDYMCTTYAFLEI
FT                   LVTIVGRTDLLVEKTTQMDLIFTAGQVCFPSCKAVEEYKDANDEGNDDELILNKIYRNR
FT                   GSALYHLFVAYLRSLADKGKIKDFYLLDNFDVHEYPPGPYRPMTQRALTLTVPRFIPES
FT                   DMRNDFNQLIKFVAKAGSRIYSSQHAFSKLENSFLDKFEENPLKVVEGLFSKSSKRYLY
FT                   KFDKHFSTNYFKTLNDRQGWNRALHELDPTNQYAVSTWIESCKQHGFSEFLSMLEDNMG
FT                   GEGTLALGHPLLASLTEELSFNAKEEEEELAAVRLSKMGVSEWFISSWKYEMFLGKIYN
FT                   TLVIKLTKRVGDCDWIVISTDDRVSTSAMLQNRPLPTPPTTNPSRSDSKEEVLPKPVKP
FT                   YCPTVHSTYSDQSSIRMRPPPLDTATDPFDSPMISSPTSAHTRRRSVVSNGKINEGSVS
FT                   SSKHLSETGDTSSTAGTGKLFITSESPISSSTPIDNRLYFKDKPRQPPAISNIVIPQPL
FT                   PVSDPGRQEERLFTPTGGAFVLPRPHIPMKIQNPSMNSFPKSAADRHISMIREEEVEQV
FT                   SSPSSVRGPRSVSEPPTVPSHLMQGVPAMVPEAASEDELDKPLIPPAKPVDFRCRELQL
FT                   IAKMAPDLCKPLPMPKEPSSLMSPVSDASDKEEPAFPEPMQAAVNTLLSENGDLRKPGN
FT                   RATVIVYPKYDSVPDEEEDEDDEFSEDDSAVDPAEQLPVGVTEKPPQETSAVAPHDGQS
FT                   TSEWASDDAPSDGLDFSMPPNQGFAKPSPAANGMKTLSLPPEAPASTNDFLEDFIDGYN
FT                   EHSMLPPASHNPPEAPADETLFERVKRYYEDSPFERVPTIRSATAPVAEDSGVDRHVAL
FT                   ERSPTTPKPLTPGPLERPAVKRLSWSQESSVRSAERGALRRRQASWTYSMASTVPPDED
FT                   NGFFDSDASESPDDDGLHISRFKNALLKTKRSINRLNSNHKA"
FT   CDS_pept        complement(479294..479845)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761320"
FT                   /locus_tag="AAR074C"
FT                   /orf_name="AGOS_AAR074C"
FT                   /product="AAR074Cp"
FT                   /protein_id="AAS50439.1"
FT                   /db_xref="HOGENOM:HBG058014"
FT                   /db_xref="UniParc:UPI00002524BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK5"
FT                   /transl_table=1
FT                   /translation="MADSQNTPVNAQITLCAVADSRPEQWAGADIRAWALQRPLSNSQK
FT                   ICDLYQCVHCGEVAARRAKRRSARRASETHAEGPWDEPAARSLHITVSYEEVEWRLRRR
FT                   TLPILPSAQDARGARGAAPLFQASVDEDDAGSCEESESAPGSAGARAGDDVVLTSPCSR
FT                   HHHRRNSIAVRFTKTCLKTL"
FT   CDS_pept        complement(480356..480877)
FT                   /codon_start=1
FT                   /gene_family="HOG000185150" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761321"
FT                   /locus_tag="AAR075C"
FT                   /orf_name="AGOS_AAR075C"
FT                   /product="AAR075Cp"
FT                   /protein_id="AAS50440.1"
FT                   /db_xref="HOGENOM:HBG398237"
FT                   /db_xref="HOGENOM:HBG494750"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI00002524C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK4"
FT                   /transl_table=1
FT                   /translation="MVLWYKNTHVFERDFQTVSLAFFNRYPNPYAAHVLSIDTIARDVD
FT                   ADGRLHTTRLIKKMGKLPAWARPLLGRISESWIIEMSSVDAARQEMRTYTRNLDHTKVI
FT                   KVEEYTCYRFRDGATVADSRVRFSSGIRMGIKGRIESWSHRTFDENIKRSRLGMAFVMD
FT                   KLEERAKLLL"
FT   CDS_pept        complement(481159..481818)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761322"
FT                   /locus_tag="AAR076C"
FT                   /orf_name="AGOS_AAR076C"
FT                   /product="AAR076Cp"
FT                   /protein_id="AAS50441.1"
FT                   /db_xref="HOGENOM:HBG058015"
FT                   /db_xref="UniParc:UPI00002524C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK3"
FT                   /transl_table=1
FT                   /translation="MKLYPAAIALFAAYVRAAADDDSDSDSVRPQSRTSASTARNNGQF
FT                   AVPPSTTITLTRDGTVYTSYAWWLPEASDAYGSDKPLDYATTTDSRGRTTTSPVWWRAG
FT                   TESAKPSRSASASVASDAESSTGASRSRRQTTSLAGSSAASSGSASARSASSSASSASS
FT                   ASARSASSSSLSDISTTTNGSPSPLRALRALPAGSAHYSAGTLASAICVIAAAALL"
FT   CDS_pept        complement(482261..483619)
FT                   /codon_start=1
FT                   /gene_family="HOG000189123" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761323"
FT                   /gene_name="NMT1"
FT                   /locus_tag="AAR077C"
FT                   /product="Glycylpeptide N-tetradecanoyltransferase "
FT                   /EC_number="2.3.1.97"
FT                   /function="glycylpeptide N-tetradecanoyltransferase
FT                   activity"
FT                   /biological_process="N-terminal protein myristoylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50442.1"
FT                   /db_xref="GO:0004379"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006499"
FT                   /db_xref="HOGENOM:HBG011427"
FT                   /db_xref="HOGENOM:HBG314670"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniParc:UPI00002524C2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EK2"
FT                   /transl_table=1
FT                   /translation="MGDSGDAQKMQRLLEMLALNSGDMSKLTQQQRKAFEEYKFWKTQP
FT                   VARFDEKVEEEGPINPPRRVEDVRDEPYPLLEEFEWRTMDITTGQDLEDVFVLLNENYI
FT                   EDKDSTFRFNYTREFFNWALKPPGWRKEWHVGVRVRQSGRLVAFISAVPTTLEVRGREM
FT                   KSVEINFLCIHKKLRSKRLAPILIKEITRRVNKCDIWHALYSAGIVLPSPISTCRYTHR
FT                   PLNWSKLFDVGFTALPANATKTQMLAKYTLPKKPLVEGLRPMTDADVDGAFDLFNRYQK
FT                   RFELIQTFDKSEFRHWFLGNEETPSVIYSYVVQNSEGKITDFVSFYSLPFTILKNPLHK
FT                   ELGIGYLFYYASDADFDYEDRYDPTATELLRKRLTQLINDVCILARDLKMDVFNALTSQ
FT                   DNALFLEDLKFGPGDGFLNFYLFNYRANPIRGGLTEDKKFDAKNRSNQGVVML"
FT   CDS_pept        483964..485652
FT                   /codon_start=1
FT                   /gene_family="HOG000212580" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761324"
FT                   /locus_tag="AAR078W"
FT                   /orf_name="AGOS_AAR078W"
FT                   /product="AAR078Wp"
FT                   /protein_id="AAS50443.1"
FT                   /db_xref="HOGENOM:HBG266723"
FT                   /db_xref="HOGENOM:HBG748186"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00002524C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK1"
FT                   /transl_table=1
FT                   /translation="MLSSTTWVPRGFASEFPEKYELDDAEMARINELAQLQLDDAEEGL
FT                   EEAGGAQEGAALWAQLDGDDDLKEYDLEHYDEEDAGAGAEVTMFPGLSGEARFHEGEEG
FT                   QDAYLSLPTVEEEQEERAELQVYPTDNLVLATRTEDDISYLDVYVYDDGAGFHDEAVPQ
FT                   EAGDAQDPDVARGLIRDASLYVHHDLMLPAFPLCVEWVNYRPGSNSDAPANFAAVGTFD
FT                   PTIELWNLDCVDRAFPDMILGEPADSATASKKSKKKKKGKKQHVATHHTDAVLSLAHNR
FT                   HFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPSDGSILLTAGYDSR
FT                   VALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLAGTDSGNVYSFDLRNGEDSAP
FT                   LWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGASAQEGPRMVLSRDFG
FT                   VGNVLSTSFAPDVEVASTFVVGGTSPGLKLWDAFTNRTVRKSFASELQAVQQRAREEAK
FT                   QLGKASRIARKYISNSNPDTVVTVDDNGSDEEEQEGAADDWEDEE"
FT   CDS_pept        complement(485801..486352)
FT                   /codon_start=1
FT                   /gene_family="HOG000141819" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082157"
FT                   /locus_tag="AAR079C"
FT                   /orf_name="AGOS_AAR079C"
FT                   /product="AAR079Cp"
FT                   /protein_id="AAS50444.1"
FT                   /db_xref="HOGENOM:HBG058016"
FT                   /db_xref="HOGENOM:HBG104223"
FT                   /db_xref="UniParc:UPI00002524C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EK0"
FT                   /transl_table=1
FT                   /translation="MTNKVFLSECMLQSEKSVAYSTSFASEPYAGSATCQFTISTSESQ
FT                   GFSWNQDIFASQYQQLCKVIYDGHVDSVDKLLQKITPPGNHEENVYMDVFEAERGAERG
FT                   AEYGQRFGPAEASPSRRGSNFDEWRSRMSRELSKPRRRSEQSISFASDSKNGTYRAADV
FT                   VVIDVEAATPENMHFKELLS"
FT   CDS_pept        487074..488789
FT                   /codon_start=1
FT                   /gene_family="HOG000179662" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082158"
FT                   /locus_tag="AGOS_AAR080W"
FT                   /product="AAR080Wp"
FT                   /protein_id="AAS50445.2"
FT                   /db_xref="HOGENOM:HBG058017"
FT                   /db_xref="UniParc:UPI0001DB27CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ9"
FT                   /transl_table=1
FT                   /translation="MAREDMDRGSSWIKETEGGSQTSGPSKGADMQVSVTLDEQQPLVG
FT                   GQRADEEVLARWRGRWVFPAWLLVCFSTGPTYVMMRSFVPASLQTIAHELGHPKGHPAA
FT                   HCRPRGDDCYIYVGGRDVQFTAYVLYMRALYTSIEGLIAIVLMGLADFSNYRKWLMTLS
FT                   IVMYGALATPFVSQGSKTYGALILMSVLYCLMLCCNTIYTITEGSYIPVFMDMARLAAA
FT                   RDAASAKLGDGVEERTAGEPVNPMLRRGAKVSVLGLIMGNLGSIVAVLVGIIITYSRGK
FT                   PQAEGYSAFLLTITIAGCATIVLGSVASLGIPAIHGSRFPFDPQENKLITICKFPFRRF
FT                   MYILRDLTHYREAFKYVVAWVLWNIAYSNFMQLFQLSFRATLGSTADKEYFVWQLMTSV
FT                   IACVGSLTWMAVFRHFSARRTLRAQTQLLKTCLYAMMAVGVVVNFWGSLGASSRVPIGF
FT                   KHRWEFWFFQVIYVSTSSAIRSLNRVAYSAMLPAGRENQYFGLEIMLGLATGWSQSLLV
FT                   SVIQDRTGNARFPYIPNTLLLIVSLGFYYWSDLSHGMLAAGKAELHRAAPQDAS"
FT   CDS_pept        complement(488829..490082)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930815"
FT                   /locus_tag="AAR081C"
FT                   /orf_name="AGOS_AAR081C"
FT                   /product="AAR081Cp"
FT                   /protein_id="AAS50446.1"
FT                   /db_xref="HOGENOM:HBG058018"
FT                   /db_xref="UniParc:UPI00002524C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ8"
FT                   /transl_table=1
FT                   /translation="MASLSVVDIAAVGAGPPRRPDNCAADWPRGGPISSGRSRARPRRG
FT                   LYARARRRPLPAAETMIAASIQMEAPAAEPYPGAAAQLKAVRGSVAEQLDAWRDYACAL
FT                   LARWLDAGPAHAALGAEAARAVLHMAACYEQLAQELAERAYDDKNAVSEAWRASTAMSK
FT                   RAIGLAAFIRRLDIPPTAADAALRETYHRVWVLDQQVRVLILAVAKMQRRLGGNRYDEL
FT                   LTLQESDPEKLLENAQVYGRLAQGCAQECRRLGGSAVEPQAARLGVFLEALALALFSVG
FT                   QYERGECGVALGMVEAAEEQLVAGDIAPREYLGMLREPRRQARQARLRGKLQQLRQRVR
FT                   RRPAARLHPFVQRVADEFLTPLVVLLRYRYGRANDTLYMQPVVRQWQLPQGRVAETAGT
FT                   RWEFDGELHEVGAEEQYF"
FT   CDS_pept        490287..491675
FT                   /codon_start=1
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761325"
FT                   /locus_tag="AAR082W"
FT                   /orf_name="AGOS_AAR082W"
FT                   /product="AAR082Wp"
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50447.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380231"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI00002524C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ7"
FT                   /transl_table=1
FT                   /translation="MVRVLEEKYDGATVAFTFMGSALVFVMVPGLGFLYSGLARRKSAL
FT                   ALIWVVFSALIVGIVQWYMWGFSLAFSKTAVDNKFIGNLNSFGLRDVYGKASPDADYPE
FT                   LVFAVFQGLFMCVTLAIIAGATAERGRLLPHMVFLFLFATVVYCPVAYWVWSPGGWAAQ
FT                   WGVLDWAGGGPVEILSGVGGFVYSYFLGARRESLLINFRPHNVSMVTLGTSLLWFGWLG
FT                   FNGCTSLSPNLRSVYAFLNSMMSAAVGGMAWCVLDFRLERKWSTVGLCSGVISGLVAAT
FT                   PSSGCIPLYASLIQGVVAGVVCNFATKLKYYAKTDDSMDILAEHGIAGIIGLLFNAVFA
FT                   ADWVVGLDGSTEHDGGWLTQNWPQMYKQIAYIVAVSGYSILVTSIICYVLNCIPGMQLR
FT                   ASEAAEERGMDEDQIGEFAYDYVEVRRDYFSWGVQNDQSANPSVASSVAEKNAPGVPDD
FT                   SEGK"
FT   tRNA            complement(491716..491789)
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        complement(492350..493870)
FT                   /codon_start=1
FT                   /gene_family="HOG000172698" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761326"
FT                   /locus_tag="AGOS_AAR083C"
FT                   /product="AAR083Cp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50448.2"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011236"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013235"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001DB27D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ6"
FT                   /transl_table=1
FT                   /translation="MTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSN
FT                   RALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVRAK
FT                   PGDEAVRRALEVCERMLRRERFERAIRADGDEEQRRLCKTLSLASFAGNADLASYDGPA
FT                   LELEQETDAEGAPAGARVANMSAEFVRYMVEELFVQGKRLPKKYVAAIVSHAERLFAAE
FT                   PTVVELRTAELGCRVSVCGDTHGQLYDVLNVFQRFGKVGDDHVYLFNGDFVDRGSWSCE
FT                   VAVLFYSLKILYPGRFFLNRGNHETNNMNKVYGFEDECKYKYSQRIFNLFAESFESLPL
FT                   ATVIDDAYLVMHGGLMSDDSVTLADMKAIDRFHQPPREGAFMELLWSDPQAAEGLGPSQ
FT                   RGLGYAFGPDVTARFLEKNGLKKIIRSHEVRMGGVAFEHAGKLVTVFSAPNYCDTQGNL
FT                   GGIIHVVPGKGNKGELGNDDENLYVETFAAVPHPDIKPMAYSSGVLGF"
FT   CDS_pept        494098..495153
FT                   /codon_start=1
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777823"
FT                   /locus_tag="AGOS_AAR084W"
FT                   /product="AAR084Wp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50449.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB27D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ5"
FT                   /transl_table=1
FT                   /translation="MSSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSG
FT                   VCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSC
FT                   EACEQGHESNCPDADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY
FT                   KALKSANLRAGNWVAISGACGGLGSLAIQYARAMGYRVLGIDGGDEKEALFRKLGGEVF
FT                   VDFRKSKDVVADVVKATGGGAHGVINVSVSEAAIESSTEYVRSNGTVVLVGLPGGAKCK
FT                   SDVFNHVVKSVSIVGSYVGNRADTREALDFFARGLVQCPIKVVGLSELPDIYGKMERGE
FT                   VAGRYVVDTSK"
FT   CDS_pept        495271..496188
FT                   /codon_start=1
FT                   /gene_family="HOG000111209" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761327"
FT                   /locus_tag="AAR085W"
FT                   /orf_name="AGOS_AAR085W"
FT                   /product="AAR085Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50450.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058019"
FT                   /db_xref="HOGENOM:HBG203990"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI00002524CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ4"
FT                   /transl_table=1
FT                   /translation="MELVRLALGAPVHPLIGEQLVPFLRRHGVVRSEEMLSHMHLVIYV
FT                   ALFYHCCYLVGKHMLFPGLVRWRRAVAPQRLLVQSAIHWVSLVQSVVILTLCYASWPLH
FT                   TRATHPRPEDRVFATTPVNSVLASFALGYFLWDTVISLRHSSVAFALHGAVSTVVFLIG
FT                   MTPYINYYAGMFLLFELSNPFLNGHWFARHYLPLGSQTHPHAGDARLVRWSARFALAND
FT                   LVFFTVFFCARIAYGYYKIGELALDFYRVRADPRFMPYGTAFILGGNLVLNVLNAIWFR
FT                   TMVCMARDQLYGKRSAAAEQKRAT"
FT   CDS_pept        496576..498999
FT                   /codon_start=1
FT                   /gene_family="HOG000034101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777824"
FT                   /locus_tag="AAR086W"
FT                   /orf_name="AGOS_AAR086W"
FT                   /product="AAR086Wp"
FT                   /protein_id="AAS50451.1"
FT                   /db_xref="HOGENOM:HBG058020"
FT                   /db_xref="HOGENOM:HBG204369"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00002524CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ3"
FT                   /transl_table=1
FT                   /translation="MQLDAIEDAESGSSSDDDYLLELADVTEFEGVLPKDHYSSPFYVD
FT                   VPVPQSLGDHRHLGDDTQSYVREYPTSILADRFDKWRKLLKSLVAYLREVAAAQEQHAR
FT                   INAHLKSAVKFSFLADLEEGTNKVVEQLKRPSSPSQSGAESAQDSYFQVQEGCSNGFLR
FT                   YGSGSIQDLQVSLKKYHMTVSNQQLKASRELNNVVIPKLEELRRNLSSKIKEIKELSND
FT                   FKTNIHEQVALTGQLLQKYIASVDLLSTAEDSTSSKSTGQRLKPKHDPYLLKLQLDLQL
FT                   KRQLLEENYLQEAYINLQTSGMELEKIVYGQIQTALQKFAHYMDIESCAAINGICQELR
FT                   RGILSKPTTIEWDDFVGLHPTCLLNWKSSDPVPPPRRLSDIRYPKMKSPMAKCIRAGYL
FT                   MKKSKLLKNYNKGYFVLTSNYLHEFKSSDFFKMANNGEKPSLKKINFDPLGSIPLNEST
FT                   VTEALPQKFVLCSTWAGIDSQEAGLSATSSGTSFTSMQGSRSSVSLGKLLKGAAKPGKA
FT                   LTSAKASTSEITKGHVWTFKPSTTQSEKDFKKWCGELRQLAGFNSTLERCRYIEEKIVK
FT                   AHSRASSKASQSSIGTPPEGPGRAQKPQFIDIKGLSPIGYNIASPINTPAFDDNGNLIM
FT                   AGDRNMSLLTPSGLSFQGAPSLTNTISSDGTSLQSRSPTPVDTAATFTEGNLNAVQPGV
FT                   GQSGGGGSISSPRSTESINNSGGYFAIPVNRSQPQRDSVPSSQSRADRAPPSGSVPLLR
FT                   VTSQSGNVEQPGRPSLYKQTSSPSLTSIKSRQTQLVLKHKRNLSFQSLAEMVSK"
FT   CDS_pept        complement(499143..499841)
FT                   /codon_start=1
FT                   /gene_family="HOG000093530" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625279"
FT                   /locus_tag="AAR087C"
FT                   /orf_name="AGOS_AAR087C"
FT                   /product="AAR087Cp"
FT                   /function="FMN binding"
FT                   /protein_id="AAS50452.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="HOGENOM:HBG008466"
FT                   /db_xref="HOGENOM:HBG396346"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI00002524CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ2"
FT                   /transl_table=1
FT                   /translation="MLSRSVITLQRDALRQYYSHYVTQQKFKETMSRISNQVMILTTSS
FT                   MKGVTLGSATSLALQPRPMIQFNLQLPSFTSQELHKRRKFALHLMAPTEQSVKLARLFS
FT                   KGAIRRPDSGVMPTRPFEALAAGADFALHKTSASTGGSLEPVVEDEILDHGLDKPALGA
FT                   RTVELPVLASAERVLICECIRCFRVGDHEIWVGMVEEILSPANNAPNSAVTGGLMYCNR
FT                   QFFKIGSPIE"
FT   CDS_pept        500080..500946
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761328"
FT                   /locus_tag="AGOS_AAR088W"
FT                   /product="AAR088Wp"
FT                   /protein_id="AAS50453.2"
FT                   /db_xref="HOGENOM:HBG058021"
FT                   /db_xref="UniParc:UPI0001DB27EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ1"
FT                   /transl_table=1
FT                   /translation="MPRSVPDMSELLVKGVKHVYGRKMRKTRPTLPNVESPLVTHFHRW
FT                   AGKRIRLSFLAAELGTREGQHILPDWNLRGNLFAGLLAAPMRWDRLGNLRVPKSFLMQT
FT                   KARALEAPSDGKLVKIISVVEERGPGSSSYVPQSKAALQRAKQAMFVPVALQQSDMRYF
FT                   SSEEIAVDKDTLLAEYSAQLISKVKEGLEVLLSMSGTSHERVELEDWDVVVTYDPDNAN
FT                   DIELRKCKGIPGDPVVIILNMGCLKCTELEELVNLRLRNHEYGLVLKVLKNERLLKFMY
FT                   RLITFSR"
FT   CDS_pept        complement(500926..505782)
FT                   /codon_start=1
FT                   /gene_family="HOG000065988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930816"
FT                   /locus_tag="AGOS_AAR089C"
FT                   /product="AAR089Cp"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50454.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG124676"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="UniParc:UPI0001DB27EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EJ0"
FT                   /transl_table=1
FT                   /translation="MAREKEVLNVINLNTPIMRNSWTGAAGGTTKHEKPLVEAFNSSTN
FT                   RLHFVDRLPFDVTEGFREVQRFVQEGKGEADKVREALTGLYRELKQRHQLGRVAEVSRQ
FT                   HMGVVVRLLEAGQDAAAAREVVALYNQTNYRPAGGLGDVLMADFGVSNERYLSTAKILA
FT                   MQLIIRMRQVESHAETVVRIFAADERYILRDPKLKVHTVVKLILNFFSLLPQYKVLFAL
FT                   KFLQYVSQFRLDFSTYIKNMDLAKFQKQVLKFAGAGLESSLPFLDIYYRSYSQHMTSIG
FT                   KLMWQDFRVPDRGDTKLNPEDPIILQQILHGRRTLDNAEFDAYTKHITTKLSKGVSPTD
FT                   AFLGALKVYILNCSLKRLRLQKAHVILLDKIAIFINTNVVHVSVESIHTILKSLAEYFI
FT                   DAKEYKRLNNVVNISFNAYVMYKHESLIRLAADLELFLFMSVKQDWSMFTKFEKFISVA
FT                   SGDISVSLFEQCFNVYVMFADPSLAGLWDVCLNKSLKCFKKLGLTSYTDFKASSEPMLV
FT                   LVYSGFVSDIFTIPYNGWAPLSKMLFMALNGVYKFGYMDVDCKIKSVDVLAKYEMLIKS
FT                   TYSLNMEMETHGTLQLSKIANMYVSRWVSSLPTDERISGLEVRFVKALVQYLRFNKFHK
FT                   KLIELCQLLKSKGEYYESFKNDIRVWLLEAYTALKMVQATKLQIQSVLKIHSSFSIERA
FT                   TFDSLYEYLYARLLIISWERDNDSFNHLVQELRVSQTNFFDINNNSNLPVSQFLKLLLL
FT                   NIRIEKLASLLQFHNNNMFESLLEAKKALKLCQSLIKKQQKLSQFHRLEVISLLQDLFA
FT                   QVIGIYIQVGVSKDCEFYVKDFMRVVGELQDWTPIYDCLCFVYDYYKLTEQNQLASATL
FT                   SRLNRTFDMLDGSENIDALAKFMYYNDEPDKLRNSLALFFSGDLEDTFLVDEWNLRLGI
FT                   VIENTREQPQLKALSDVNKSNELYLRILKQMELDPFFSNMCESVIAIPSCFSPKVEEIR
FT                   PAVSNVWSPAGSPYHSPRPSSLTPRGKCLRQKFDRSNAINNLQMIKRLIESVNLDEMQN
FT                   HEVSKTSCLYSLSLSFLSNISSKTDFRHALIKRFTMAELPKYMPMYYDKMFSRMGNEVY
FT                   GSFMPMEVKSMCTPFFTVQQKVDGIQTNFNSWDEPFQAISVDICKYNGDLLLSKVVSTT
FT                   GKHFHLRLPLNRHESRDLSQETLTFALLMEELNDIIEKNNRTTSIEVTSVIKTKEDRRE
FT                   WWEERYSLDKRMCDLMRRIEDSWICGFCGFFSQKQLDKNHFALFKLGFQKVLQQNLPTR
FT                   RQYGNPSMFLQVDDFILELFLKVDWDALPHEKKVEFMEDLIYFIFDILLFHGEENAYDE
FT                   IDVHLIHIQLEELIHDYHAKAPEAPRLGHTFLVISSECSLVPWESLSIFSDASVSRVPS
FT                   INFLHELLTKFRGEISPKINLDSRLSIVLNPHGDLTRTELRFKEHFTRLCCDLGSTRIV
FT                   TGSKPEEDEFVRMITNSSTFIYIGHGGGEQYFRSKTLKLQDNAAPSFLLGCSSAYMKQY
FT                   GKLEPSSVLYSYLLGGSPMVIGNLWDVTDKDIDAFTEAMFQKLGIFPSQRDRFLNVSEA
FT                   VSSSRDVCHLRYLNGAAPVVYGLPFRYNTTEPMLPGKGY"
FT   CDS_pept        506057..508036
FT                   /codon_start=1
FT                   /gene_family="HOG000141891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761329"
FT                   /locus_tag="AAR090W"
FT                   /orf_name="AGOS_AAR090W"
FT                   /product="AAR090Wp"
FT                   /protein_id="AAS50455.1"
FT                   /db_xref="HOGENOM:HBG058022"
FT                   /db_xref="HOGENOM:HBG204371"
FT                   /db_xref="InterPro:IPR019337"
FT                   /db_xref="UniParc:UPI00002524CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EI9"
FT                   /transl_table=1
FT                   /translation="MHFQVLETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYES
FT                   LPSRLQAMLRRLCGKSSVLMSQVVVAAQQVRGRPEAGIYQRVLRETLEREPGALAHQLA
FT                   GGGPTQRRLVTALFFGSRVFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPEDAEVLVA
FT                   LLRFHPTQAADALVDLVLCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNV
FT                   QAAYDLLLTLDYRLFNLLELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTDD
FT                   EKRCNLFAILIARMAGPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESL
FT                   KYEAAHIKLPVPPLRPKGTICFEEITTPRASAYVNNSAVEPQLGALTLEDSDDSDVDSD
FT                   GERRGREIVFLKDLLVELEAPDLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTA
FT                   VATISNSQSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQRMAILSALALA
FT                   ARELRGLEDKYVLKPVFDFPTRRLPRNDAPSRALESRESGTSSEGTISAHHTVWRSRKL
FT                   DSAPAPERPNAFRKHAPAFFFPLAHAWLNGIDLGTFDALFKKHYLSTLRLILAAANPHA
FT                   EFDRMSELMSYVLQDAEAHDISIE"
FT   CDS_pept        508378..511176
FT                   /codon_start=1
FT                   /gene_family="HOG000173111" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761330"
FT                   /locus_tag="AAR091W"
FT                   /orf_name="AGOS_AAR091W"
FT                   /product="AAR091Wp"
FT                   /function="Rab GTPase activator activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50456.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG055297"
FT                   /db_xref="HOGENOM:HBG327941"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI00002524D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EI8"
FT                   /transl_table=1
FT                   /translation="MSFFQALRQKASQISFLDILSDNLTSPLSRDERFRLEYRLPDDEQ
FT                   ILKDMNVDISVRGAYTAEGEPSYVYSGRLYLTAHYLVFRDSLDHNTCAFTMNLSTIKRV
FT                   ERAASTSFAFCLNIQLYSGATFMVQFVGPRYASEEFSHLLKVQLRQNIKNTKLLGPFLE
FT                   TCYSEYIISKNLQHKPDLQPPAGGLGQLFKYPGDPIAHKEKAKLRLWFDYFKKNGTNLS
FT                   LLRNHMFHRLIRVGVPNRLRGEIWELCSGSMYLRFSSQGEYQRIGKENKEKHSQAIDEI
FT                   EKDLSRSLPEYAAYQGPEGIERLRNVLVTYSWKDPDVGYCQAMNIVVAALLIFMTEEQA
FT                   FWCLGKLCDSYLPGYYSKTMYGALLDQKVFESFVENKLPELWDHIVRNDIQLSTVSLPW
FT                   FLSLFFTSMPLIFAFRVLDLFFLNGPKALFQVALAVLKVNLEDLLEVDEDGMFIAILKN
FT                   YFQTLEHSAYPDATDPKYQRVTKFQELLVVAFKRFDVITAEMVDIERNKHKKVILQNIE
FT                   TFAKRTQMRTIPPVRHLKSEHISNIYDIYYESIESYKIGLGTGSSRMDFPAFVQFLGKF
FT                   CEWCKKSDSEENLSYQKQKESFLRRLFNNWDITSSGELSLGDVISGVDKLVSNDLMETM
FT                   NNFFSLYEDSKKGEVQREEILQMSEGLLFLTEPWKTGRCADKITQKAIENDIAENLVQQ
FT                   SELSNLEDIEIPRGVEIDDQKYKQQQLERYLQAASNFLNRCFEYARPVEPSSAPRDAAP
FT                   ASPTEMTRGDPDTVANKELDPMRANVALHPEKPCVIDLPTFRMIILADETYELFFAHTL
FT                   RNSVRVDSPVTFFDGKVKALKNVFDGLIADGRRVAHEVRRRVDSVATRGNSSEPLDERQ
FT                   DDLDDFTTEHPDEHSKLLSGDLLDLDMDQDEDNRPQKRLEKVNMPPAGTNGELPNLIEF
FT                   EA"
FT   CDS_pept        511431..512438
FT                   /codon_start=1
FT                   /gene_family="HOG000000958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761331"
FT                   /locus_tag="AGOS_AAR092W"
FT                   /product="AAR092Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50457.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058023"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniParc:UPI0001DB27EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EI7"
FT                   /transl_table=1
FT                   /translation="MSLSTFTRSYGRCFFLSNAIHLQVRPVQASVPFRNVFTPLLAKLN
FT                   PVPSTALARAVRNFSSTTSKSNLGGYFGGPQSKYTRLNRFQQYSPGHPNNQLLRITGWG
FT                   LLFMTGTFFGTPFLFDLPPFSYFKAHPAHLTYAIIGLNCVVFGLWQRPRFWLPLQRYAL
FT                   LQKDHIYSKWSLIGSAFSHQEFWHFGMNMICLWSFGTSLAMSLGPANFASLYMNSALGA
FT                   SLFSLWYPRIARIALMGPSLGASGALFGMFAMFSYLAPNSKIMLFFLPIPIDAWVGFLG
FT                   MTTWNLAGCVFRWGTFDYAAHVGGTAMGLLYGWWMSRKIQQQRRARRLISFPRF"
FT   CDS_pept        complement(512487..513059)
FT                   /codon_start=1
FT                   /gene_family="HOG000000959" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082159"
FT                   /locus_tag="AAR093C"
FT                   /orf_name="AGOS_AAR093C"
FT                   /product="AAR093Cp"
FT                   /protein_id="AAS50458.1"
FT                   /db_xref="HOGENOM:HBG058024"
FT                   /db_xref="HOGENOM:HBG204372"
FT                   /db_xref="UniParc:UPI00002524D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EI6"
FT                   /transl_table=1
FT                   /translation="MPLARLVEGEKHDECTYVAASSLLIGRHKMLRSLIYASRRWSSSV
FT                   GARFSSREELQAYLARPAWQPEDYLPSAEDIARQQLSEEETRKLLKLSGLPEADIQEVR
FT                   RRLATQLSFVSQLQSVEVDDCADPQYAKAMQRHPAAIGYEELVRRAELDAKDTSLGEKS
FT                   GSWDSTATATLKKDGYFVLREGLLQKR"
FT   CDS_pept        513341..515131
FT                   /codon_start=1
FT                   /gene_family="HOG000006022" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777825"
FT                   /gene_name="NOP7"
FT                   /locus_tag="AAR094W"
FT                   /product="Pescadillo homolog"
FT                   /biological_process="cell proliferation"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="nucleoplasm"
FT                   /protein_id="AAS50459.1"
FT                   /db_xref="GO:0005654"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008283"
FT                   /db_xref="HOGENOM:HBG270529"
FT                   /db_xref="HOGENOM:HBG410102"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR010613"
FT                   /db_xref="UniParc:UPI00002524D3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EI5"
FT                   /transl_table=1
FT                   /translation="MRVKKKNTTGNARNFVTRSQAVRKLQISLADFRRLCIFKGIYPRE
FT                   PRNKKKANKGSTAPTTFYYYKDIQYLQHEPVLAKFREHKTFAKKLTRALGRGEVSSAKK
FT                   LEENKSHYKLDHIIKERYPSFADALRDLDDALNMLFLFANLPATDQVSTRVTKDAQELC
FT                   NQWLALIARERLVRKVFVSIKGVYYQANVRGEEVRWLVPYKFPENIPSDVDFRIMLTFL
FT                   EFYSTLLHFVLYKLYTDNGLVYPPKLDIKKNKLIGGISAYILESKDAPFLSSVDGSADS
FT                   ENQEVQVLDKKALRHAMKADDKAGSEADEGDADSNEQVTNIELDDFEDKNKNHGDILEQ
FT                   PSQYDSPTSTLFSEFVFYIGREVPVDILEFLIVSCGGSVISEAALDQADAANVDVSKVT
FT                   HQLVDRPVVKNKVAGRTYIQPQWVFDSINKGELVPANLYLPGESLPPHLSPWGDSVGYD
FT                   PAAELAEEEAESEEEEEVSDEAEGDEEATLAAEEDEEDEAEAEELRAQKELELEAQGVT
FT                   YSEAADSAAPSKKASKQKKRKTEEEEEKDLKLIMMSNKQRKLFKKMKYSNQQKEQEIET
FT                   LKQKKKQIAKTKAKLKKLEN"
FT   CDS_pept        complement(515215..516081)
FT                   /codon_start=1
FT                   /gene_family="HOG000113528" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761332"
FT                   /gene_name="SRB5"
FT                   /gene_synonym="MED18"
FT                   /locus_tag="AAR095C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 18"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS50460.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG058025"
FT                   /db_xref="HOGENOM:HBG204374"
FT                   /db_xref="InterPro:IPR019095"
FT                   /db_xref="UniParc:UPI00002524D4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EI4"
FT                   /transl_table=1
FT                   /translation="MEKVHCGDVRIPAVNRTEIRDSYSDSGVTRMVQQLSLYSVIDEGS
FT                   FDLLIATISALSGRSPVLFANYNHVAHPNPNYAIEKVNAKNQLVEQTRVQLMQEIPFEK
FT                   LQTEEYSYKLCTKMTGDGPPIETEYLNSLMRSCGDGTRPWSLSLWDIPSAGKDRKVCTQ
FT                   AVVESVVTSTGGAHSSILSFLAELGYVPGYQFVQLGTQFYLENGIVFQISKLWALHGES
FT                   GKTSAVTKDGFLIKAYLNVPKATDLESINQGTAHLQQLKRELRDYLELSIPDRKSMDSR
FT                   VGHLNDF"
FT   CDS_pept        join(516142..516161,516224..516437)
FT                   /codon_start=1
FT                   /gene_family="HOG000234560" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761333"
FT                   /gene_name="VMA21"
FT                   /locus_tag="AAR096W"
FT                   /product="Vacuolar ATPase assembly integral membrane
FT                   protein VMA21"
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="ER-Golgi intermediate compartment
FT                   membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50461.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033116"
FT                   /db_xref="HOGENOM:HBG252938"
FT                   /db_xref="HOGENOM:HBG396435"
FT                   /db_xref="InterPro:IPR019013"
FT                   /db_xref="UniParc:UPI00002524D5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EI3"
FT                   /transl_table=1
FT                   /translation="MAVDVPTSVIVKLMFFTLAMVSFPVLTFFVSQQYTSNTLVNGGLA
FT                   ALAANVVLFAYVIMAFSEDVPQSDGKESKKQQ"
FT   CDS_pept        complement(516540..517337)
FT                   /codon_start=1
FT                   /gene_family="HOG000141890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761334"
FT                   /locus_tag="AAR097C"
FT                   /orf_name="AGOS_AAR097C"
FT                   /product="AAR097Cp"
FT                   /protein_id="AAS50462.1"
FT                   /db_xref="HOGENOM:HBG058026"
FT                   /db_xref="UniParc:UPI00002524D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EI2"
FT                   /transl_table=1
FT                   /translation="MHLRIVFLALLEAAVAAAGVASFVSVKAERYRNGLEIKGAQDLRE
FT                   LVRLGTEQEPVVVVQFGAYRLFSELEKAGAGTQRFLHRLLASDSLNVLNGDEALQPHSS
FT                   TRVAEFEELPVELPAEVRGGAGSLLLHLKAPDYALDEVDGFLQRCHEQLPSLDNIVLQF
FT                   PHDILLVAADVQESAARQKKDSVEVTDPEGDSKPKPSDHDKAPDGHKETDELSAIWTEG
FT                   LLSCLLVSLLLFGILATAVSWILSVEVSYGALEKSTNPLKKTN"
FT   tRNA            517845..517925
FT                   /gene_name="tRNA-Leu"
FT   CDS_pept        518070..519281
FT                   /codon_start=1
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761335"
FT                   /gene_name="MRI1"
FT                   /locus_tag="AAR098W"
FT                   /product="Methylthioribose-1-phosphate isomerase "
FT                   /EC_number="5.3.1.23"
FT                   /function="S-methyl-5-thioribose-1-phosphate isomerase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50463.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046523"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="HOGENOM:HBG682649"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniParc:UPI00002524D7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EI1"
FT                   /transl_table=1
FT                   /translation="MSLQAIQFQRGDKSQVSVRVLDQLLLPYVSRYIPIQTVDDGFAVI
FT                   RSMQVRGAPAIAIVGVLSVLVECQLLCNEDFVAVQAFYDLSSYAAFGRTMRMRLAHLLG
FT                   SRPTAVNLSHALRDVERLLDSATSLSQFRDRMYDYACELLDMDVANNVRMGDNGARFLL
FT                   DALIAEGFDGSFAVLTICNTGSLATAGYGTALGAIRSLWQHAEAGLTAPKKQKASACAP
FT                   RMTHVFPLETRPYNQGSRLTAYELLHDAIPATLITDSSVAYRIQTSPVPIKAAFVGADR
FT                   IARNGDTANKIGTLQLALVCRHFGIRFFVVAPRSTVDGTTAAGTDIPVEERCPDEFRVV
FT                   TGAAAGATGDPTTASVAIAPRDMPVWNPAFDVTPHAYIDAIVTETRVFTKDAAGNFDLD
FT                   ELFT"
FT   tRNA            join(complement(519355..519391),complement(519302..519337))
FT                   /gene_name="tRNA-Lys"
FT   CDS_pept        520459..522126
FT                   /codon_start=1
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777826"
FT                   /locus_tag="AAR099W"
FT                   /orf_name="AGOS_AAR099W"
FT                   /product="AAR099Wp"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50464.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG436276"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniParc:UPI00002524D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EI0"
FT                   /transl_table=1
FT                   /translation="MSSVNKENYRGVPSGRGMKNPVLAGAKRAVLNNVTNTTLSQEAAN
FT                   SNAHSGSGYTNSFGKVLRQAKSKLQSARVAGSLIPQMKREGLASSQEDKENVVPTGVAP
FT                   AAVAAAAAAAQMAPAIAKPILQSISEESHQECQSLLKDGGSDEGASTVSTKSSDTELAP
FT                   SSSSSLQSAPANSEEPVVLESGTQLVERRRPQTLNTTLTGSVASSSDCTTSTGQLTEST
FT                   AGELTTTQNQLRPSVAVAESKKKRPISTIVEPEELKKFKISDQGNQCEWEDLDAEDIND
FT                   PFMVSEYVNDIFEYLHKLEVMTLPNRHDLFKHANIQQNRDILVNWMVKIHNKFGLLPET
FT                   LYLALNIMDRFLGKELVQLEKLQLVGTACLFIASKYEEVYSPSVKHFAYETDGACDEEE
FT                   IKEGEKFILKTLQFNLNYPNPMNFLRRISKADDYDIQSRTLAKYLLEISVVDFKFIGIL
FT                   PSLCAAASMFLSRKMLGKGKWDGNLIHYSGGYSTTELAPICNMLMDYLVQPVVHDELFK
FT                   KYASRRFMKASVISRQWAKKVMTRSYDIMTLHETQTEY"
FT   CDS_pept        complement(522980..524194)
FT                   /codon_start=1
FT                   /gene_family="HOG000000929" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761336"
FT                   /locus_tag="AAR100C"
FT                   /orf_name="AGOS_AAR100C"
FT                   /product="AAR100Cp"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50465.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG436276"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniParc:UPI00002524D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH9"
FT                   /transl_table=1
FT                   /translation="MSPVGETRRVSDENEAAGARRRGELAKKRGNTVLGVPRKALGAVG
FT                   VNTRKQERDGAATGSGAGGARGAGTKRMVYHDSEGEETQEPEEKRVSKKAKAERQCPSP
FT                   AAQTESPEAARGALVREPHPHRDLDALEADDLTMCVDYTNEIFAHLLQREQETTCVVNY
FT                   VQERQCAFYIRPSMRAILVDWLIEVHLKFQLLPEALYLAINIMDRYLSTNKVSLSKLQL
FT                   VAITSLLIAAKFEEVNLPKLSNYVYITDNAYTVEEVKQSECNILNALEFNIGWPNPMNF
FT                   LRRISKADNYNHNTRNYAKVFLEYAMCCPKFVAITPSVLAAMSMRCAMMLNYGAEGFEW
FT                   DDTMEWYSSMATTSAKFDFQKLCDDLIKDIQEPSTQLNALIYKYKKLGLWVAVKTWCDE
FT                   QKIVR"
FT   tRNA            524771..524842
FT                   /gene_name="tRNA-His"
FT   CDS_pept        525273..525797
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930817"
FT                   /locus_tag="AAR101W"
FT                   /orf_name="AGOS_AAR101W"
FT                   /product="AAR101Wp"
FT                   /protein_id="AAS50466.1"
FT                   /db_xref="HOGENOM:HBG058027"
FT                   /db_xref="UniParc:UPI00002524DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH8"
FT                   /transl_table=1
FT                   /translation="MQGILVMGLVAAASAASLTTTSTSTITTTTTIYYGADGVNSVVLD
FT                   MAKGLMAVGMSASVNTSSTVSAWNSQLWSAGNTTTATANHTSAATHGSTVQLTTHNKTS
FT                   TAVTAPPASVTPTAALSSSAAPSSSNASGPASAPASSPGPSVSSSAGAALLDARGAILL
FT                   GALGAVVLDLC"
FT   CDS_pept        complement(526032..527807)
FT                   /codon_start=1
FT                   /gene_family="HOG000188732" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082160"
FT                   /locus_tag="AAR102C"
FT                   /orf_name="AGOS_AAR102C"
FT                   /product="AAR102Cp"
FT                   /protein_id="AAS50467.1"
FT                   /db_xref="HOGENOM:HBG355976"
FT                   /db_xref="HOGENOM:HBG713247"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000018D412"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH7"
FT                   /transl_table=1
FT                   /translation="MRKALSPLVSRNSHIARTMARGSDSASRKRTRQKTTEKNNVVDEE
FT                   ISGVSSNEEGSSSDEQELEDVADAELDSDEEFANENPADKRRRLAKQYLENIKEEANEI
FT                   MHGDSEAHADDAQGQGFADAYNNFDARDLDRDIISARLKQDVAEQRGSVYRWIADKLLL
FT                   SEAKKSFTRVGEKNLTALSCYQQAMNKFSHREIQSKSKGLMFAYTVSKDMQLTKYDITD
FT                   FNARPTKVKYTKGGRKYIPEGNQGFQNTTEGHYDEILTVAASPDGKYVVTGGRDKKLIV
FT                   WSTESLAPVKVIPTKDRRGEVLGLAFRRNTDQLYAACADYKIRTFAINQFSQLEVLYGH
FT                   QDIVADISALNMERCVTVGSRDRTCMLWKIADETRLTFRGGDDPEKLLRRWQKANSEQE
FT                   NKDADDNTPAEPPVFYGEGSIDCITMLDDSHFISGSDNGNISLWSLSKKKPLFVQRVAH
FT                   GVQPQPDNTKISGERDPAVRTQQAQGNRLAQPYWITALHAVPYSNVFFSGSWNGTMKVW
FT                   KLHENMRSFEPLGELDGCKGLVTKIQTVEAGKSGRETLRVLASVSKEHRLGRWMGKLPG
FT                   ARNGLFSAVIDQAGF"
FT   CDS_pept        complement(527935..530571)
FT                   /codon_start=1
FT                   /gene_family="HOG000066013" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761337"
FT                   /locus_tag="AAR103C"
FT                   /orf_name="AGOS_AAR103C"
FT                   /product="AAR103Cp"
FT                   /protein_id="AAS50468.1"
FT                   /db_xref="HOGENOM:HBG058028"
FT                   /db_xref="HOGENOM:HBG203996"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022100"
FT                   /db_xref="UniParc:UPI00002524DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH6"
FT                   /transl_table=1
FT                   /translation="MPEIIDKLVFASGGKTLVTYQNDRDTLFAVNKNQLTKILQLDKPE
FT                   DEPEILSTCNEPTSIHLCSDRRLLVTSANGDVHLYSANGKDDLLFRSPLPIRDCAAIHD
FT                   ETMCVVGGDDLELTFIELKTAGNKETLKLDEQVSQLSYSPHMNILAVTLVNGNVHFYSL
FT                   TSATPNEVKKLEDYAVSNFYSDSSDTASQTDGVQYCDENRICTRVAWHPRGLHFAIPCK
FT                   DYTVKIFNLSDFSISKTLASGSTSHFTNLSFDPFQGRYVAAVDLSNNLLVWELSSGQIS
FT                   YSKRLDYKVSNVCWKLDGDSMHLLLGTWDGELLTVKDIGQYDRTAGKLAADNASAQTKK
FT                   PKNALFLDSDDENDSDVSPASPTLIGEQGRNTISADIPTDTEHGDENEKGAYNYEDDEQ
FT                   FIDDDDNAGYVPIKRKSAYVPSLVSNSKRPRIADSGPVFRYKPISPGGTPFGSSDKRYL
FT                   TMNGIGYVWTVRGTEGQYSVTVSFFDVGRYREYHFEDLFGYDLCSLTDEGTFFGQSKTG
FT                   ELLYRVHSFNGTKWTKRIPLAPSEIITGIASTGKKLVVATSLGYIRTFNEHGLPLALEK
FT                   MTPIVALAAQEHKIFAVHYSIYHGLSYSLFEQNPETGSKYYQRECSLPLTLPLFGPENK
FT                   YISTGDTFNDFNPIGIKSLFFSTFGDPCIFGSDNVLLVLCKWRNSMESRWVPIVDSNLE
FT                   IWKLSGGKQPEDIHVWPLGLNYDMLNYILIKGKNLWPGFPLPLPSEMEIRLPLLDKTQV
FT                   LKNDTSPDEEVVIPPALAAEEEFLRSQVLAGLLADTLKYDGEFFGNENEILANLNGVRD
FT                   KSLLRLFASACSDHNTEKALSLVKELKQDKALNAAQKIAERAELLRLVSSINDIRNSRF
FT                   ESELNNL"
FT   CDS_pept        530968..531735
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761338"
FT                   /locus_tag="AAR104W"
FT                   /orf_name="AGOS_AAR104W"
FT                   /product="AAR104Wp"
FT                   /biological_process="Golgi organization"
FT                   /biological_process="protein transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50469.1"
FT                   /db_xref="GO:0007030"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058030"
FT                   /db_xref="InterPro:IPR009316"
FT                   /db_xref="UniParc:UPI00002524DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH5"
FT                   /transl_table=1
FT                   /translation="MEQALEDLELLVVGDVTRDLFTEAVAQQHLDTGEQLDVSQFLLAN
FT                   NLQYVFIDDLHKQLKQLEQDISNALLNEVKHSYAEYASLCAQFGGKHNSEILDSLQQVR
FT                   YEVAAFENKLRQLVHVELRSTRDNVESKIEYLKALDTLDTLLQKHVALDSIFQFSARLS
FT                   RSLEVACQDAPAIDDELVSELLKELYKLLQCAHSILIEFQDLSSPLVTRFRNNYQNNVH
FT                   VFHSIVSILIDKCSEKSAEFPSMTSTLVAVAKR"
FT   CDS_pept        531949..534018
FT                   /codon_start=1
FT                   /gene_family="HOG000246824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761339"
FT                   /locus_tag="AAR105W"
FT                   /orf_name="AGOS_AAR105W"
FT                   /product="AAR105Wp"
FT                   /protein_id="AAS50470.1"
FT                   /db_xref="HOGENOM:HBG191315"
FT                   /db_xref="HOGENOM:HBG448154"
FT                   /db_xref="UniParc:UPI00002524DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH4"
FT                   /transl_table=1
FT                   /translation="MFNFGANSGMNSNTGSTGGGLFGSTTNGGGFSFGNNNASQNNTNV
FT                   FSNTGTGVPPAGQGTSNGGLFGNNNQTTNTGIGGGNSGGLFGGAANTQNNTAGGGLFGQ
FT                   GTQNATTGGGLFGQNTQGNAGTGLFGQNTQSGTTGGGLFGQNSQAGNTGGGLFGQNTQG
FT                   GNAAGGLFGSSAQTGNASSNLFGQSNTQAGTTGTGTGLFGQSNTQSGTTGTGTGLFGQA
FT                   NTQSRTTGTGTGLFGQSNTQTGTTGTGNGLFGQANTQSGTTGSGTGLFGQSNTQAGATG
FT                   TGTGLFAQSGARSGPTATTGSLFGNSMSGTSTIGGNNATTGGLFGQNTQSGTTGTGLFG
FT                   QGTNTTQQPPTSLFSTGTANTSQPTFAWSQQPLQNMSNSMPQQQGQAQSQALPQQAQSS
FT                   QLQFSGQQPLINQQQPNQQASNYPQQIQEQVLKCKESWDPNNQRSKLRTFVYNKCNETE
FT                   AMLYSKPANVTQEDWDKALLHKPNANVIPVEVKGFEELIQRHNLQRDHVAQARIILTQI
FT                   LDKLTCISQRHELDTATRILKAQARNSTIQHRIMLLANQLAVLKNKGLPLNVQEETLIT
FT                   EFRKLLERSNDPAGLGKNNELWARLAVLKERAKTLSSQLDSTLVVIAENGGGRAAAGSA
FT                   NGDHPDSEERRVDEEVVNSVNKIADILMNQQRGLIYLNDIIEKDAQIVDRYLKK"
FT   CDS_pept        complement(534676..534828)
FT                   /codon_start=1
FT                   /gene_family="HOG000001005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761340"
FT                   /locus_tag="AAR106C"
FT                   /orf_name="AGOS_AAR106C"
FT                   /product="AAR106Cp"
FT                   /protein_id="AAS50471.1"
FT                   /db_xref="HOGENOM:HBG058031"
FT                   /db_xref="HOGENOM:HBG398798"
FT                   /db_xref="InterPro:IPR019603"
FT                   /db_xref="UniParc:UPI00002524DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH3"
FT                   /transl_table=1
FT                   /translation="MFGFPQQQPSEEELKKHQEQTNSTVMTAAYAAAFLWVSPIVWNFI
FT                   RKQWK"
FT   CDS_pept        535055..536167
FT                   /codon_start=1
FT                   /gene_family="HOG000001004" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777827"
FT                   /gene_name="IWS1"
FT                   /locus_tag="AAR107W"
FT                   /product="Transcription factor IWS1 "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="translation elongation factor activity "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription elongation, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50472.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006354"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG191292"
FT                   /db_xref="HOGENOM:HBG395904"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI00002524DF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EH2"
FT                   /transl_table=1
FT                   /translation="MSGSSSVHSGTAASEEWGMPSVGEIGAAGEAVETNEVERAQHQER
FT                   QRKHIATSDNDEEESGNKWSVSTLPITSYGGDGDAAGGSGRRQALEAKMERLLKKPKAR
FT                   HSRQDEEDLEQYLDEKILRLKDEMNMAAQKDIETLNRRLETGDNRLIAMEKVTLLPKVI
FT                   SVLNKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAAIENLPIKTEHLKES
FT                   GLGKVVIFYTKSKRVEHKLARLADRLVAEWTRPIIGASDNYRDKRVLKMDFDVEKHRKK
FT                   AALDSAKSKKRRKAAVDEEKHKSLYELAAAKRNRAAAPAQTTTDYKYAPVSNISNVQTG
FT                   IRTAGVGSTLNNNDLYKRLNSRLAKSKRSK"
FT   CDS_pept        join(complement(536821..536885),complement(536316..536688))
FT                   /codon_start=1
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761341"
FT                   /locus_tag="AAR108C"
FT                   /orf_name="AGOS_AAR108C"
FT                   /product="AAR108Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS50473.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG046904"
FT                   /db_xref="HOGENOM:HBG747181"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00002524E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH1"
FT                   /transl_table=1
FT                   /translation="MGKGKPRGLNSARKLRVHRRNNRWAEQTYKKRLLGTAFKSSPFGG
FT                   SSHAKGIVLEKIGVESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLL
FT                   AGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
FT   CDS_pept        537757..537987
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059102"
FT                   /locus_tag="AGOS_AAR108WB"
FT                   /product="AAR108W-Bp"
FT                   /protein_id="ADJ41748.1"
FT                   /db_xref="UniParc:UPI0001DB27ED"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGA5"
FT                   /transl_table=1
FT                   /translation="MLRRLTWNPRRGLRHFASTSPPLHHWNNASVLYGCYLTVGFTVPF
FT                   LLSYYETYSQHASTYPSKHRCCARAIFARWI"
FT   CDS_pept        539185..539397
FT                   /codon_start=1
FT                   /gene_family="HOG000170763" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761342"
FT                   /locus_tag="AAR108W-A"
FT                   /orf_name="AGOS_AAR108WA"
FT                   /product="AAR108W-Ap"
FT                   /protein_id="AAS50474.1"
FT                   /db_xref="HOGENOM:HBG058032"
FT                   /db_xref="InterPro:IPR021278"
FT                   /db_xref="UniParc:UPI00002524E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EH0"
FT                   /transl_table=1
FT                   /translation="MGQAYNIFGKPVQPHVLVLGTLFTLFGGVSLYKARGRASQQPAVA
FT                   APAKTTSDDIDFEQLLGEMLKEEKN"
FT   CDS_pept        complement(539504..540142)
FT                   /codon_start=1
FT                   /gene_family="HOG000208878" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777828"
FT                   /locus_tag="AAR109C"
FT                   /orf_name="AGOS_AAR109C"
FT                   /product="AAR109Cp"
FT                   /protein_id="AAS50475.1"
FT                   /db_xref="HOGENOM:HBG286668"
FT                   /db_xref="HOGENOM:HBG507886"
FT                   /db_xref="InterPro:IPR007364"
FT                   /db_xref="UniParc:UPI00002524E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG9"
FT                   /transl_table=1
FT                   /translation="MKYIIEHMESGFSEWVTLEYAQIIRDVGAENLILSSLPEGTTASD
FT                   IPQLLTDLGLQWTTQPLDKVHLALPNVAPLMDGRVCLLDPRASGDLAPSDKDQFDYFVF
FT                   GGILGDHPPRDRTSELKESYPSLLVGKRLGDKQMTTDTAVRTTQLIVEKQLPLEKISFI
FT                   DYPEFRFNSNEATEMPFRYVLDAAGRPILPSGMLELIKKDSEQSLDDLL"
FT   CDS_pept        complement(540226..542160)
FT                   /codon_start=1
FT                   /gene_family="HOG000093626" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761343"
FT                   /locus_tag="AAR110C"
FT                   /orf_name="AGOS_AAR110C"
FT                   /product="AAR110Cp"
FT                   /function="metal ion binding"
FT                   /protein_id="AAS50476.1"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058033"
FT                   /db_xref="HOGENOM:HBG396169"
FT                   /db_xref="InterPro:IPR004177"
FT                   /db_xref="UniParc:UPI00002524E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG8"
FT                   /transl_table=1
FT                   /translation="MFLSQHKRSIVRRICWPSAKRYHSELVRWFYATDSPLEKPYEPNY
FT                   KPVKPPVNFIPFSKSDSDRLERFYSLERPSENPISVNEDYLFEVYLEARRLKPAYWDGP
FT                   VYEVRRGTWFNSDGMPLSEDLSAELAELSAKCDEEKDFFKLEGKYDEGRYVLFKGEKKD
FT                   EALLIPELYGGTLQLSLLRKSTLIPIGFVKVTKGYSESLTKGVIQKAAEGLETQVLDQT
FT                   KQMGKLSDLLGWEFMDLLLGSASSSSGDKLNEAMTHKMDREEVKQNINTRAQATKFQTN
FT                   YREIDHLILCVHGIGQNLGKKYQYVNFAHTVNLLRSNLKRLYNNGDSWKAYNRDVVKRP
FT                   DWEFNSRVQVLPITWRHDIGFSTDEFVKEKEQPELPTLADITVDGIRPLRRVFGDVALD
FT                   VLLYGEEYYRNRIMEKVASRLNNVYDKFCHKNPSFNGRVSLIGHSLGSLILFDILAQHE
FT                   KYHLHFDVENYFAIGSPIGVLKLIQQTKIAHYGGPLQTDFGLRIDRPKCNRFYNLFHSC
FT                   DPIAYRVEPLIDTKLGQYRQKIVPAVRESQLEVRVRELGDTFTSDSGLEMVKMPDSLLK
FT                   KVTKLNHLGRVDFSFEPRLWEVDALNAIKAHVSYFEEELAASFFLDQLLRPVEPVTEVY
FT                   CQALKKPAL"
FT   CDS_pept        complement(542362..543990)
FT                   /codon_start=1
FT                   /gene_family="HOG000033862" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625280"
FT                   /locus_tag="AAR111C"
FT                   /orf_name="AGOS_AAR111C"
FT                   /product="AAR111Cp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50477.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058034"
FT                   /db_xref="HOGENOM:HBG202804"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00002524E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG7"
FT                   /transl_table=1
FT                   /translation="MTLTGTLRNKRQHSRIQHRSSEEFHGAEEPIAHSDSGQLISSPQV
FT                   LLMDSEDITGRPHIGAGPAYYQVATPKSPHELSLGDDEYSGLRAEEGPLGRESEETERI
FT                   KYEIAKREILEQLHLQVMIKHREMDDLEAESRGLGAKLEVLEMLHDDPELLAKVDAHQE
FT                   QQAQLRLAQLEARRRREQQMAALPPAPLSSSSGGEYYYHTRSKSMNSHQGRSSTLRPAD
FT                   GNVIGLRVLGSKTVADASSPGTTSPPFSSFQQADPFAPQHFNQHHRRNYSSNCISSNSG
FT                   VVGKTDSGDAIFRRLDGLLIVITCCKCGKSGFTSAQGIVNHSRLKHANSYSSQPLAVLH
FT                   NQRILPEEQQNKIVMDKFKELHLDPQTEYLPNPTVVSQSPSSSANSNACITATEGRDIS
FT                   PTHISSSLSPTCVQPVSQFHSTKHLEKLYGKEGFQQIVDYVKESKDDLDVIMRVDSDIE
FT                   DDPTPLHMEDQSDLLSQHNSERSTDLKRRASPNMDKALRERMRPAEKRVRPDAMALVEL
FT                   PAEEKRSSHYNLRARSKLKSLSKHE"
FT   tRNA            544323..544404
FT                   /gene_name="tRNA-Ser"
FT   CDS_pept        complement(544497..545774)
FT                   /codon_start=1
FT                   /gene_family="HOG000200133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761344"
FT                   /gene_name="ISN1"
FT                   /locus_tag="AAR112C"
FT                   /product="IMP-specific 5'-nucleotidase 1 "
FT                   /EC_number="3.1.3.-"
FT                   /function="magnesium ion binding"
FT                   /function="phosphatase activity"
FT                   /biological_process="nucleotide metabolic process "
FT                   /protein_id="AAS50478.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009117"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG144858"
FT                   /db_xref="HOGENOM:HBG324632"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="UniParc:UPI00002524E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EG6"
FT                   /transl_table=1
FT                   /translation="MSSRYRVEYQLKAHRKDAFIEWIKGLLAVPFVLHSVTERDNAQEK
FT                   YRRVFEDVETLINEKITVDSDESLTRAAGVSRLDKLVPTIGTFFTPLPLTEAFLRQNAR
FT                   RAISERAYVSPSFNDIRHILNTAQIVQLARAGELSLVTFDGDVTLYEDGASLAAEDKVI
FT                   GRLLRLLGAGMHVGIVTAAGYDDAENYERRLFGLLRRLERADLPNEAKRRLCVMGGESN
FT                   FLFRCYERDGRAGFERVPESVWMSAELHQWNQQDINATLDLAEVMLRALREKLRLPAET
FT                   QIIRKVRAVGIVPGQRFDPELGREIRVPLLRETLEEIVLTVQGRLENFPPAQRVQFSCF
FT                   DGGSDVWCDIGGKDLGVAFLQRFYSPERPIRPEQSLHVGDQFAPVGSANDFKARLAGCT
FT                   AWISSPQETVALLDDLLAELEAQKNM"
FT   CDS_pept        546188..547849
FT                   /codon_start=1
FT                   /gene_family="HOG000198767" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082161"
FT                   /gene_name="PNS1"
FT                   /locus_tag="AAR113W"
FT                   /product="Protein PNS1"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS50479.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053734"
FT                   /db_xref="HOGENOM:HBG395525"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniParc:UPI00002524E6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EG5"
FT                   /transl_table=1
FT                   /translation="MYGKSGPPPEGYVPQHPPAQGYAPHNPPPGYVHENPFQEPVPQGQ
FT                   EYSPQGQQYQFRKDQYYNLDHQGSGAPIGDASFEDKFPTEAGNRLKFNDWPFTIIFLLT
FT                   VGAFIAVAVLTLRGWSLSPTSNGSGIYDGDNTHTLNTNAAILLLISCGVAVALSVFGLV
FT                   LAGMYTKFFIYAAMILNTVVGLGTAITYLVLRHWSAGIVFMIFTILTAVCYWLMRSRIP
FT                   FSVAVLRTVMSVMKKHPQTWLVSLLGTIVSAAFSVIFSVVLVATYIKYDPKSENGGCDV
FT                   SGGSCSRGKLIGILVLVFFCGFYISEVIRNVIHCTIAGIYGCWYYFSKSDQGMPRWPAF
FT                   GSLKRALTTSFGSICFGSLIVSLIQLLRQIIQLLRNGIISGISDSGWMQCLWLILDAVV
FT                   GVFEWMAEYFNHYAYCFIALYGKPYLRAAKETWHMLREKGIDALINDNLINLALGFYTL
FT                   FVGYTTALFSYLFLRFTKPDYNSGGGFNAVLMAFSFLIAIQLTHVATETIRSGTATFFV
FT                   ALGNDPEIFRVSYPQRFDEIFRAYPDVLNKLSHQHV"
FT   CDS_pept        548273..548794
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777829"
FT                   /locus_tag="AAR114W"
FT                   /orf_name="AGOS_AAR114W"
FT                   /product="AAR114Wp"
FT                   /protein_id="AAS50480.1"
FT                   /db_xref="HOGENOM:HBG058036"
FT                   /db_xref="UniParc:UPI00002524E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG4"
FT                   /transl_table=1
FT                   /translation="MKHINEFPTEIKLILLSLAPELGSASRDYYYLLKGRMPRALPQIE
FT                   LLPDDIKLRILWFAPKMRFASRNWYCLHNELYRSKCKSLDTERWTYKHMRLAKLVQVHS
FT                   PDIQPLRRLCYNYHLRILKKVTRAQAERSVMPFISDSWYFLYRNSSLLLEGEHSQFPRM
FT                   ICSGTPKAFD"
FT   CDS_pept        complement(549026..551920)
FT                   /codon_start=1
FT                   /gene_family="HOG000181190" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761345"
FT                   /locus_tag="AGOS_AAR115C"
FT                   /product="AAR115Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="AAS50481.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG175020"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2805"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG3"
FT                   /transl_table=1
FT                   /translation="MAYQLADIKQALQCVSSNMGQKEKASALQYLEQFQKTTDAWQLCH
FT                   SVLAGGEGEALEIQVFAAQTLRNKVTYDLNQLEESLGPFKESLLQLLVQHQHRLIVTQL
FT                   SVTIARLSIQYLAWRNPIGEIISVLNPYPDKLLGFLKILPEETLDMKSTPLSEDEFKSR
FT                   THELINQIAEDVLSFLIKCIDAAQDTGSVQVEQILSCLSTWIYEFPIEQLLTVTPLINL
FT                   VFRVLMESHDDYPDAFEAAVDCLSVLLRETRDVANVQMIQMLYEQLMQLQSRLLPPVEK
FT                   VDDWSEYEDVMDALTRLFVEAGESWCVFIGKEPQTFKPLVQVILLLTCKNTDLDVVKYT
FT                   FPFWFNLKQMLVLARYNEQKLQYQDIYVGLINGIIKHLEYPEESFTSKEEEDKYREFRY
FT                   DMGDVLKDCTAVAGPENALSQPFQLLKSHLALDASNIRWQKLEAPLFSLRTMGQEIPTT
FT                   ENNILPQIFQMLCNLPEHPKLRYAVTLVLGRYTEWTSKHSEFLEMELNYIFNGFQTGNN
FT                   DKDLFTASSHALMYFCQDCSSLLSGYVEQLISFTWKIEPMVDMLCMFEVCQGLSSVINE
FT                   QPLDKLTYSFELFYKPNSEKLQQAIEVWKGHSTDNEAAIKVADLVDLLFALFESLRPRY
FT                   EYPSQGAEPLVPYIKSLWLTLSDLLNYPGCGSNTIIVERVMKLLRRLFEKYHVFLQDIL
FT                   PAVVDMLAKNYAETGLGSYLWCSGSLIYVFGDDESYPVPPELKNAVWLFACSQCGTFLE
FT                   NFAKINPSELDLYFENIQDFFLMMLDVLMFYPKQFITTSALVESVADCALSSVDKLNNF
FT                   DSYITVIRCLDEILSWGFPTPPISTMEIETVPMEWRANVLNIMVLQKGGRMVSAIVNGL
FT                   TSNLNSNAHPEAIGLLVKLFKLATQANNDDPSICMQWLSNSLEQLRPVSANEKNKLMSI
FT                   GSALTQGDYRRVRTNIKDFIGWYLRKHVSPRLYK"
FT   CDS_pept        552310..552603
FT                   /codon_start=1
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777830"
FT                   /locus_tag="AAR116W"
FT                   /orf_name="AGOS_AAR116W"
FT                   /product="AAR116Wp"
FT                   /protein_id="AAS50482.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00002524E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU5"
FT                   /transl_table=1
FT                   /translation="MSGKQQKPMMPPINCIYNYLQQQTTVTFWLFQQTQMRIKGRISGF
FT                   DEFMNVVVDEAVEVPVDEKSGEEQVGRSTRLGRILLKGDNITLITAAEEEGV"
FT   CDS_pept        complement(552612..553502)
FT                   /codon_start=1
FT                   /gene_family="HOG000248282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625281"
FT                   /locus_tag="AAR117C"
FT                   /orf_name="AGOS_AAR117C"
FT                   /product="AAR117Cp"
FT                   /protein_id="AAS50483.1"
FT                   /db_xref="HOGENOM:HBG058037"
FT                   /db_xref="HOGENOM:HBG398627"
FT                   /db_xref="UniParc:UPI00002524EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU4"
FT                   /transl_table=1
FT                   /translation="MGKVIAKFGFKSGILPKPRPILKHPTVNMTAKVQEALAPKPKGPS
FT                   GVGYADNIAHPAGSRREPEPVKFIDVEQMIKATVPEPQQARQPASEQQAAKNRIAAMRR
FT                   EYLSDAFRAEERRLLRQEELLRQRQQLLEEESQRQLAEATRERASDLTIPTLEELVNEP
FT                   LMRQRTPEEQKLVDMKRKHNREVLALRIQERRMAQLVSLYHAAEEYIVTEPQLLRHIDE
FT                   VFSSENAHTLKNRPLVSASGRENENERAVLDTLFGTVAAGRFDGLPAVRDFLAGEQRAA
FT                   ASAPAPDSASQPPVN"
FT   CDS_pept        complement(553656..557252)
FT                   /codon_start=1
FT                   /gene_family="HOG000142077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930818"
FT                   /locus_tag="AAR118C"
FT                   /orf_name="AGOS_AAR118C"
FT                   /product="AAR118Cp"
FT                   /protein_id="AAS50484.1"
FT                   /db_xref="HOGENOM:HBG058038"
FT                   /db_xref="HOGENOM:HBG203284"
FT                   /db_xref="InterPro:IPR013935"
FT                   /db_xref="UniParc:UPI00002524EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EU3"
FT                   /transl_table=1
FT                   /translation="MEGVCGPARVRVLVVPASDGWRRGEFLGYVERLRESPEVRLVDIT
FT                   PIADSMFNPQGFPQGKLLFEIEVEAKDESSMLFLYDFEPYRKTFVVVGLCQGTAGAEAA
FT                   GRLAKLEAKFPHCIGHCLIYQTAGAANERVLGFGASSETLMCDVGRCFLRALHTYYLSY
FT                   KHVTLRSPGAVGGNAVLKTTFMCRPAGPNAKRLSATLENGTGSKKGSLKGAKVAAPDRS
FT                   QQRAKGRQLKILANFQLLAGQYMSALANFSEAAHTAHKVRDHLWLGSALEGVFISMILL
FT                   SYLAVPFQIPAVVVQLCPPKSYVVASASSSQRSSSSSISGSPNSGANGAFQSPRPSMSG
FT                   PNAPVLHSNEVLLGNLLKCLNERVLHYYELSLTQSVEYTPQVVYCQSLLRMLQFMSECH
FT                   KSNSLGEPALRSMVLGVTHEPEAPADTMEPILFSKMEIYQLSNRFFELQLKDLDLITQV
FT                   RFYITLASVYGNLSLERKRAFVLRILFVSLLPNIEALPWRDEYDNLMEELLRTYGIASW
FT                   EPENKIQDALSVHWVTLQKNVLILLINIVKKAGRARKVLKFSRWAITRYSHILTHTEQT
FT                   RLFKDFLLPAAQQHPEEFEYCDPFLLRNISLLKLEHHRQVPTVEHLEIASNSENKGEIF
FT                   NPFKYNDVAAPEASNDDIENFMVSERAEFICSFQNPFNYDLDITSLSLCQEDVKYLRIC
FT                   GNQVSSEAPFIVKAHSMRALHLTVEFLQDTPGHKLRALNIGLFKLPARKYPICNSEQKS
FT                   VFASSRAVLGECKLVIIEDQPQLDFLSSDLPRASCMLLTGVKKRLQCKVHNTSLSKTAN
FT                   YFRFCINTNVSSQLKDDYWRTIAADDLYDMELQLEQLKEKCIKVTNFPDEIKPNEVVLF
FT                   DLEIDSTCAPLHLDHFDLVINYGNNHSGNNAVYVRKLVIPFNVTLKRSVEVTNMEIVQI
FT                   HEELPSTVDVDWINYIRAQMREQQLSFSAFALMLLDIRNSWTSKVVLELGYDDFSASPH
FT                   EIGSCQTIRIIVPIKKLRGNSDLSDRPIPSIVRGRQFVHSGLSDDQLHDLQTHFWCREH
FT                   LLSKLHCTWKGSSFAGTVNFRLFMPKLSNNAIAVMYRSKKTPYTLELRTSDPHVSVCEE
FT                   VTITATIDASLEHDSTSTVFVQFQFFERRTGKQIPNSNKQLLYNGTLMNSIDLRTQQEL
FT                   TLKVLPIESGDYEFHGSIVGTDAAAYSLVHVT"
FT   CDS_pept        557409..558188
FT                   /codon_start=1
FT                   /gene_family="HOG000182856" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761346"
FT                   /locus_tag="AAR119W"
FT                   /orf_name="AGOS_AAR119W"
FT                   /product="AAR119Wp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS50485.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG316821"
FT                   /db_xref="HOGENOM:HBG497931"
FT                   /db_xref="HSSP:1G0U"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI00002524EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG2"
FT                   /transl_table=1
FT                   /translation="MAGLSFDNYQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAA
FT                   DTRSTQGPIVANKNCEKLHRIAPRIWCAGAGTAADTEAVTWLIGSNLELHSLYTGREPR
FT                   VVSALQKLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSVHAHGSTDVGQYQSLGSGSLAA
FT                   MAVLEAQWREGMGRADAMALAAAAIEAGIWNDLGSGSNVDLCVMEVGKDAELFRNYITP
FT                   NTREAKQNSYKFARGTTAVLRESTLQIYDEEIVDTAA"
FT   CDS_pept        complement(558247..558894)
FT                   /codon_start=1
FT                   /gene_family="HOG000033575" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761347"
FT                   /locus_tag="AGOS_AAR120C"
FT                   /product="AAR120Cp"
FT                   /function="methyltransferase activity"
FT                   /function="phosphoribosylglycinamide formyltransferase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="AAS50486.2"
FT                   /db_xref="GO:0004644"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG061800"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniParc:UPI0001DB2806"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG1"
FT                   /transl_table=1
FT                   /translation="MSGPKVTVLISGSGSNLQALLDAQRQGKLPVEFVRVISSSAKAYG
FT                   LTRAAQHDIPATVHSLYKYNAGIEKEQTAERAAARRRFEEDLASLVLQDGPDLVVCAGW
FT                   LLILGPTFLQRVRGVPIINLHPALPGAFDGTTHAIELAWNKCQQDGAPLRAGCMVHYVI
FT                   EQVDKGTPLVVKELEIVPGAETLDEYEQRVHRTEHVAIVEGVAAALRAQGKL"
FT   CDS_pept        559401..562094
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761348"
FT                   /locus_tag="AAR121W"
FT                   /orf_name="AGOS_AAR121W"
FT                   /product="AAR121Wp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50487.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058039"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00002524EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EG0"
FT                   /transl_table=1
FT                   /translation="MSTPIKYDIQQTCHEMSLLRVPELKAVCRSIGLPLSGRKADLQAR
FT                   IKEYVENSLRPNHVDPFRPKAIMALIQKSKVGDVLPTYESILQALRTGAFTHPVATGHA
FT                   PPSSLFPSDSVDGAPHDESGDQHQTARAVGRKGSPSSVFYPSPFYNLKRMVSGSPKMAA
FT                   KSPGRGTCNMKFRLSETESKFILDSKDTKLLLFCGPVSQGNRVHIQFPHPNEIKLNDNM
FT                   IKDNVRGLKNKIGTAKPADLTPFVKHNAENYLQLVYAFTKEDFLVYLYIVTMNTPEKIL
FT                   EGVLARPKIVKPATLAYIKKILSEDEDDDLMTTSTIMTLQCPISYSRMKYPVKSVRCDH
FT                   LQCFDAMSFILSQMQIPTWQCPVCQKQIEIKDLAVCDYVDDIIKSSNENVEQVVINSDG
FT                   SWVAKEEEPENRPGKSTDTEQPAQTNIKDEDIDQVILDEEMSTKKAANDPIVISLDSDD
FT                   EDDDVSLAEELAKLKNHPQSHSNSHTSPQKQSRTPDSLLNGKVSRASSVPLAVEQTSSF
FT                   SPNERSISSNGGNAPLDRTISTEGSARVISLPSRSAGVLSTGSGSLSNHPVTTLNHTLQ
FT                   DNGISTITRLPRDMPATNLHRVLTDYNPSGHLNSQHDATLSNLSSKTGDVHRPSNSSSS
FT                   FNGAQKRASIPNILGSAPLSNQSRTPDNRLTHGTSIHENPRLELNGDQSLLFGGNTGQA
FT                   SGNLAGVSPAENSRRSNSHDQSQYRLHSNAFHSTAPPNEPSKNTSPGTTVAPASVVGTN
FT                   TRNTQRGPTGDVSQESVEQPQSASRASDESSARIMSPSHHTEPVVSVSTISSNTRPPIL
FT                   PPLPSIHRPLISPSPPVDDAPSGYYPTRQDHSKAYPSTNPRNKKPPVSPFIPRKYSSVV
FT                   PKKRLLSTSDGAAKGDTNNACTNHGD"
FT   CDS_pept        complement(562339..563091)
FT                   /codon_start=1
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777831"
FT                   /locus_tag="AAR122C"
FT                   /orf_name="AGOS_AAR122C"
FT                   /product="AAR122Cp"
FT                   /function="protein C-terminal S-isoprenylcysteine carboxyl
FT                   O-methyltransferase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50488.1"
FT                   /db_xref="GO:0004671"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG299304"
FT                   /db_xref="HOGENOM:HBG737603"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniParc:UPI00002524EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF9"
FT                   /transl_table=1
FT                   /translation="MTTGNGAASHEEEPLVIDGAVYPDIVKNPLDEISCTSYVLGILFG
FT                   ASVALLPIARFWNFNLYVAALCAFHFLEFYITARYNPGKVEVGSFVLRNGKSYFLAQAL
FT                   SVCEVWLELWLFPNWKNTWRSTGHTACVVVGIVLLLFGQYVRSQAMVTAGQSFSHLIKT
FT                   TKEPDHVLVTTGIYRISRHPSYLGYFWWTLGTQLVLLNPVTFVVFAIILCKYFSDRIRY
FT                   EEHYLLQFFGKVYVSYRESTGVYIPFIP"
FT   CDS_pept        complement(563378..564154)
FT                   /codon_start=1
FT                   /gene_family="HOG000000746" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777832"
FT                   /locus_tag="AAR123C"
FT                   /orf_name="AGOS_AAR123C"
FT                   /product="AAR123Cp"
FT                   /protein_id="AAS50489.1"
FT                   /db_xref="HOGENOM:HBG058040"
FT                   /db_xref="HOGENOM:HBG203556"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI00002524F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF8"
FT                   /transl_table=1
FT                   /translation="MGFVEEINLKTYDPDVYFTSIHARTSSARNRIPKSLSTGSETNRP
FT                   NRRVNYSLADLENRIYNQRGSSQGADDTDKADSYSAERYTQAELLKSNKRFMELDTENF
FT                   GDARDVPYLMSALTGINKDRIDQAATGISGGAVPTQSSSNRARNKFELPKNMQMMYRCT
FT                   RPPIPKRKNTNRIVALKKTLSSRRPLSSYLDALDHVNRSIIYNNVYNKKFTKVLPVVTV
FT                   CSICGGYRSLSSCVKCMDKICSLKCYTLHNETRCSS"
FT   tRNA            564328..564401
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        complement(564485..566437)
FT                   /codon_start=1
FT                   /gene_family="HOG000233845" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761349"
FT                   /locus_tag="AAR124C"
FT                   /orf_name="AGOS_AAR124C"
FT                   /product="AAR124Cp"
FT                   /function="acyltransferase activity"
FT                   /protein_id="AAS50490.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG266464"
FT                   /db_xref="HOGENOM:HBG618916"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniParc:UPI00002524F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF7"
FT                   /transl_table=1
FT                   /translation="MIRCRQAQVILRRSMATRAFAFETGNGEQYVAREANQHYQQQRPG
FT                   FKGVTFAQQGKLPSLPVPALGETLQRYLQSVEPLCGSQEELARQRELCAEFEAGAGQEL
FT                   HARLEAFARDKRNWMSEFWDNQSYLEYNDPIVPYVSYFYGHRPLAGPQRVLEQDHLVKA
FT                   TALVSAVVKFIEVLKDEALPAEQVRGAPFCMNSFNLMFNTSRLPGKGRDSNVFYSLYEN
FT                   DFITVAYRGQFYKVVTHEGGRPLGPGAIWQQLYDVVNKAAVGKGAGDHAGVGLLTTLPR
FT                   DEWYVAHRHLEVNAVSRASLETIHRSSFLLALDTDQHPISLEDKAHNNWHGDGVNRFND
FT                   KALQFFVCGNGVSGFLAEHSKMDGTPTLFLNQYVMSELSRLDAADFINQIKTTAPGSNY
FT                   QPKHLPFVVTPALQEMIRDAEGQFRDVIGEHDLRVWNYVKYGKKAIKAFGFSPDAYIQQ
FT                   IIQLAIYKYVGRQLPTYEAGSTRKFFKGRTEAGRGVSPASAKFVKTWQSPEASPSEKIA
FT                   ALRESAKNHSSLLKMAADGQGVDRHFFGMKNMLRDGEEHPALFRDPLFQHSCTWYVSTS
FT                   QLSSEYFEGYGWSQVNENGFGLAYMINNDWLHINIVTKPKKSGYSVHELHYYLTEAANE
FT                   MYELLSNETKVSSKL"
FT   CDS_pept        complement(566727..567884)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761350"
FT                   /locus_tag="AAR125C"
FT                   /orf_name="AGOS_AAR125C"
FT                   /product="AAR125Cp"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS50491.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG058041"
FT                   /db_xref="HSSP:1AUC"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00002524F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF6"
FT                   /transl_table=1
FT                   /translation="MPSMTSTVHSNGGIGRFLSEIPLVTRGLLLALLLWCFNAFMRFSQ
FT                   LQVLVFAWNFRRHDYEFWRLYGRFIAVNSNSAAALLALYQIYRNSSSLELDYFQANPVD
FT                   YAFYLAFCTTTCAALTAACHALLGIEPGSLFPALDGMLLYTWALLNANVTVNYIVFNIR
FT                   GKYLPLLNLFVHMLGGEPSGVLIILLGYAAAYIYCCLETRTAGPLYGKLAGLPHYGYPT
FT                   LRDSHFRGSALLAPLIATQSGGPPSAAAAVSGNFRGKGRRLHDGKAVAAPRHAARAAGT
FT                   GAVVPLTSTSALAAALAGPGLAVIDFYAVWCGPCKQLAPLLDQYAAKHTAVRFYKIDVD
FT                   RFPGVAATHEVHAMPTVLFFRAGKEVARVQGANPSAIRAALQSYS"
FT   CDS_pept        568087..568872
FT                   /codon_start=1
FT                   /gene_family="HOG000248508" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761351"
FT                   /locus_tag="AAR126W"
FT                   /orf_name="AGOS_AAR126W"
FT                   /product="AAR126Wp"
FT                   /protein_id="AAS50492.1"
FT                   /db_xref="HOGENOM:HBG058042"
FT                   /db_xref="HOGENOM:HBG395819"
FT                   /db_xref="InterPro:IPR019186"
FT                   /db_xref="UniParc:UPI00002524F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF5"
FT                   /transl_table=1
FT                   /translation="MVCDYRLGGCSSVSLDMKIFYIGAGDAISSRAARLEHRLEKVPAS
FT                   IRSLTMERKNRQILSRGQKYKQKAARTHGATEVVFDKDSRLEYLTGFHKRKLERQKKAQ
FT                   EFAKEQERLARVEERRKQREQRRSEMEQQLESARAAMAGSLDSDGDAGEEDSWHGFSDS
FT                   EEGVRPILKRHQDVYDDATVEIETLEPNDNFAYLARMNNVALERSEKVLDDSIDRAKKY
FT                   AEFLGVADKPKQKKKKFRYLTKAERRTNQRKATSNKRRK"
FT   CDS_pept        complement(568932..570077)
FT                   /codon_start=1
FT                   /gene_family="HOG000112387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761352"
FT                   /locus_tag="AAR127C"
FT                   /orf_name="AGOS_AAR127C"
FT                   /product="AAR127Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50493.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124551"
FT                   /db_xref="HOGENOM:HBG203287"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniParc:UPI00002524F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF4"
FT                   /transl_table=1
FT                   /translation="MPGTKGAEGGSPLPVDIWSVLLLAPQHVVLLALVGLWLWYWELAV
FT                   LSKKIDLSRVILCNEPYDIRPQPSSLRILQSTRSCVARITKIVVPMYIGASYVAYRAAL
FT                   GAELPWWQVLAANTAALVQLAALVWVILRSSRMVRRCVARMLLGGGIEGKPLRTNYILL
FT                   ADTLTSYGKPLMDFTAYLVLLFRTPLADPLAVRDLPSNAALHIDLVVGAIPSVIRLVQC
FT                   LREYRRKEDAWAARRASLFNALKYSSQLPILVHALLSRSGAAHGGQRWVRWAMLLNSVY
FT                   SFWWDVTMDWKLGLFNFSSAGMERDEVLRHRRLYSVKYYYGAVLYDFVMKFMWLWELHV
FT                   GRALFRRDLNPVWLHLLEVIRRWIWTFFKIEAEYFSANAKK"
FT   ncRNA           570248..570278
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR53"
FT                   /product="AgSNR53"
FT   ncRNA           complement(570375..570451)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR67"
FT                   /product="AgSNR67"
FT   CDS_pept        570939..572096
FT                   /codon_start=1
FT                   /gene_family="HOG000232982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761353"
FT                   /locus_tag="AAR128W"
FT                   /orf_name="AGOS_AAR128W"
FT                   /product="AAR128Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /function="transferase activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS50494.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG155458"
FT                   /db_xref="HOGENOM:HBG748739"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniParc:UPI00002524F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF3"
FT                   /transl_table=1
FT                   /translation="MLMFSSLRASLALTGAGFQSQLRLLSRTAVARQTAGDAEAKPSVQ
FT                   VSPSLLKIVPDTSDIVLLEKQDELIQRRRKLSKEITKMRKLKPVSPGLRWFRAPIYPHL
FT                   HKGKPERSLTVALKAKGGRNHSGKITVRHRGGGHKRRIRIVDMLRWENGDQTVQRIEYD
FT                   PGRTAHIALIKHNETGKLSYILACDGLRAGDTVASYRKGVPESMKTEMGGVVDPAILSV
FT                   RTAQRGNCLPISMIPVGSIIHNVGITPVGPGKFCRSAGTYARVMSKIVEQKRAVIRLQS
FT                   GEHRYVSLEACATLGVVSNIDHQNASLGKAGRSRWRGIRPGVRGVAMNKCDHPHGGGRG
FT                   KSKSNKLSMSPWGTLAKGYKTRRGKRVNKMKVKDRPRGKSSRSRT"
FT   CDS_pept        complement(572267..573394)
FT                   /codon_start=1
FT                   /gene_family="HOG000217592" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777833"
FT                   /locus_tag="AAR129C"
FT                   /orf_name="AGOS_AAR129C"
FT                   /product="AAR129Cp"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50495.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG054432"
FT                   /db_xref="HOGENOM:HBG328999"
FT                   /db_xref="HSSP:1AMP"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00002524F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF2"
FT                   /transl_table=1
FT                   /translation="MKLALILTAIGAASALPLEGRRRLQFNETYIADVTEEEKLAYALS
FT                   GKSFFDITGLKQTQQLHGVSGLARSSSAAPGRQYEYPANLTHVSEVNSIIGGIDTKYMY
FT                   DKLDKFSSFFTRYYTSPTGAQSARWLFDTLKTATAPISGKVILRQFKHDWDQFSIIVSI
FT                   PGSARPDKIVAFGAHQDSIAGPDPATTRSPGADDDGSGVITNLEALRLYAKYIADTGKW
FT                   PENTIEFHFYSAEEVGLLGSLQIMTEYHDDPKKNVVAFFQHDMTGYVKNAADAHIGVIV
FT                   DYTDHNLTTFMEKLIGQYLTIPGRVTKCGYACSDHASATKQGFPSAFAFESVFEDSSEF
FT                   IHSPQDTIDRVNITHMAEFSKLAIGAVVELSDWVA"
FT   CDS_pept        complement(573696..574529)
FT                   /codon_start=1
FT                   /gene_family="HOG000230791" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761354"
FT                   /locus_tag="AAR130C"
FT                   /orf_name="AGOS_AAR130C"
FT                   /product="AAR130Cp"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting two-sector ATPase
FT                   complex, catalytic domain"
FT                   /protein_id="AAS50496.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033178"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG311291"
FT                   /db_xref="HOGENOM:HBG732046"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniParc:UPI00002524F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EF1"
FT                   /transl_table=1
FT                   /translation="MSNNREQVFPTRMTLGLMKSKLKGANQGHSLLKRKSEALTKRFRE
FT                   ITRRIDESKQRMGAVMQTASFSLAEVTYATGENIGYQVQESVANARFKVGARQENVSGV
FT                   YLPQFESQLDSDINDFKLTGLGRGGQQVQRAKNIYTKVVESLVQLASLQTAFVILDEVI
FT                   KVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQRDVVALDAEMK
FT                   RKRLEKAATSTDAAVADAVPDDDIRGEGELDEHGQPDVEVGNQDILAEQEEDVIF"
FT   CDS_pept        574770..577181
FT                   /codon_start=1
FT                   /gene_family="HOG000065931" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18930819"
FT                   /gene_name="SYF1"
FT                   /locus_tag="AAR131W"
FT                   /product="Pre-mRNA-splicing factor SYF1 "
FT                   /function="binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS50497.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058043"
FT                   /db_xref="HOGENOM:HBG103486"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001DB2807"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EF0"
FT                   /transl_table=1
FT                   /translation="MDEFVTAEDLVHEYSVLQEPDSVVNWSRYIAAKRDDPCSVSWVYE
FT                   RCLQALPAQWEVWREYLQFRMRLLDGVCAVQHAAEFEKVNRLFWRCVEHNAAVVEAWRL
FT                   FLGHAQRQGALALVRQVVDAALRGVGLAKHRTVWEDVVAYIEELLPAEETDLGEEQDLH
FT                   ELVRGALFGGAGAEDAGADIWSSAMLRRYIQVAEDAEAVLALLQRTHDYATVVAVYEKH
FT                   VLPVTRAKHKGRQSYESQFRYLVALDHTGATAKLEDAVARCAQLFPERAPSLTIFLAKH
FT                   YVKQGNYNRCTDVLTDSLKHTAKSSEFASLYDFLVVFEESLIEVVLEHLQEHPENEERW
FT                   GADLERHTDQLDGLLADHALLLNDLKLRQEPDNVKHWLDRVELFDKAASKASVYADAIA
FT                   SINYKSQTVPGQLGTLWWQYAQLYIDDGQYETAKTILDKALNVPYNFLQDPELIWTKWA
FT                   EEELKRAGLDAAMQVLSHALQIPDDHELLRDKFESHEKMPAQTVIFSSLKLWSFYIDLL
FT                   EASSESDEHLERTKAAYEATIQLKIATPLLFVNYAHYLQDKGNHVESFSIYERAVDIFP
FT                   AETAFEIWDIYIGEALKYGLPKEQIRDLFESSLKMANEGVECKPFFLLYAKFERDNGMI
FT                   ETAANILHRACRAAQTMDAKRSLWTLCLNWCRQELGGSYARALYEECIQALPNHVAVVY
FT                   VLEYAKVEEGLKQVKRARALLQYGARLLHPANNADLWEYWELFELRHGNKDTYKDMLQL
FT                   KRKVEELLEGDGLPVPNQIGNIAFVASTDGLQNPGGESTNINNDELELDM"
FT   CDS_pept        complement(577314..578762)
FT                   /codon_start=1
FT                   /gene_family="HOG000259600" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625282"
FT                   /locus_tag="AAR132C"
FT                   /orf_name="AGOS_AAR132C"
FT                   /product="AAR132Cp"
FT                   /function="ATP binding"
FT                   /protein_id="AAS50498.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG320636"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI00002524F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE9"
FT                   /transl_table=1
FT                   /translation="MGTVWLRGARGWRAAVQLAGQMRRNATAATPLLEYDRRVGAGQLR
FT                   DDTHQRRIIASLAHLHEQLAAYEPPAVQTPSPLEQVGWRTSVLGRLLRRREQYSSEGVC
FT                   KGIYLYGDVGCGKTMLMDLFYATVPRHLSKRRIHFHQFMQYVHRRSHEIVREQNLDALG
FT                   EAKGRTIDPIPLLAAEIATQWRVLCFDEFQVTDVADAMILRRLLTLLLSNRYGVVLFTT
FT                   SNRRPDELYMNGIQRESFVPCIELLKRRTEVIFLDSPTDYRKIPRPVSSVYYFPARGVR
FT                   YRSATCEAARARHVRDWYDYFAQLQSEEQPVPAARPQILHDFRVNTWGRELVVPSCIPG
FT                   RVAQFSFKQLCAQPLSAGDYLALANSFNAFIVTDIPYLSIFVRDEVRRFITFLDAVYDS
FT                   GGKLATTGAASFSELFVEPEQLLNDYQLKEEPQTPHNADESPSDIAKRSTMFILDEERF
FT                   AFARALSRLSHMSTSEWVEKKRAE"
FT   CDS_pept        579222..581513
FT                   /codon_start=1
FT                   /gene_family="HOG000113467" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082162"
FT                   /locus_tag="AAR133W"
FT                   /orf_name="AGOS_AAR133W"
FT                   /product="AAR133Wp"
FT                   /protein_id="AAS50499.1"
FT                   /db_xref="HOGENOM:HBG058045"
FT                   /db_xref="HOGENOM:HBG203706"
FT                   /db_xref="InterPro:IPR007244"
FT                   /db_xref="UniParc:UPI00002524FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE8"
FT                   /transl_table=1
FT                   /translation="MGEIESSLRALSICDDEELVDITEHVRQLASQLRAETIVRLADFD
FT                   LFEGTHALEINNGKLDSVLLELTAAEEDFDCAQAYGAGAAEQLGYVTGTVERLSQSLMD
FT                   WLHDYQSLPTTVLSCRYVEHLSQRQGAEAGLAAARLATGSELYDRVLSSCVFATLAWVN
FT                   FVGNLLRAGVVYEEEDLNCNTMGLDVLADVAVADVLAELAAARALLEQKYAGAARLLLL
FT                   VRLFECLLHIPNYRPSAEHEPSDDVGPMHELIRIAAELARSPCAAEAPPGTFSQGIQKR
FT                   LSNQFPPKQLYEPVGHEFAAYQTMAEDILKVLDVRHATSVIEVRQFAWFFNRCSQRHVV
FT                   ARALFPLYLMRDDQSIIGIYSFADFTHQTLLNFSCCGTELDRRLADPGNSRALKDLDAF
FT                   YQEISGILFEWYQNMSQNVCRYRQGYNRQLLLWDSLQAKLEPFETRLVDEGIADLVSEL
FT                   DNAPLMPVNSWVYFMKLSAMLEFLLKGFDLEVYKPWEFFTIYWYAYYLSHHLESCLKRV
FT                   HSFAQQRIASIVAMGKKVKKSKAGPKKESLRAAYQYQSQNVLPQLRLNVNFLDYLLADC
FT                   VVTKSLALSQTFQFGILKSYGAVSNSSPGASIFSSDSYLHQLRFKTFSSIGVPDLPSYE
FT                   TFKSSLEAFTISEPGLSMKLKTSLQLMNNELDTSRKALQSILKEVEEASAGPVHGLFAG
FT                   TRLVTDSAKQWYTSLDKTVDAIALNGRTIEATLGAVESAQETEQKVELIYPSDSCRYFP
FT                   ILQLHNSSDK"
FT   CDS_pept        582009..582506
FT                   /codon_start=1
FT                   /gene_family="HOG000082125" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625283"
FT                   /locus_tag="AAR134W"
FT                   /orf_name="AGOS_AAR134W"
FT                   /product="AAR134Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50500.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG023340"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniParc:UPI00002524FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE7"
FT                   /transl_table=1
FT                   /translation="MPPKFDPNEVKFLYLRAVGGEVGASAALAPKIGPLGLSPKKVGED
FT                   IAKATKDFKGIKVTVQLRIQNRQATASVVPSASSLVITALKEPPRDRKKEKNVKHTGNL
FT                   QLDDIIEIARQMREKSFGKNLASVTKEILGTAQSVGARVNYKNPHDIIEAINAGEIEIP
FT                   EN"
FT   ncRNA           582740..582923
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR80"
FT                   /product="AgSNR80"
FT   CDS_pept        583189..584073
FT                   /codon_start=1
FT                   /gene_family="HOG000144428" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18930820"
FT                   /locus_tag="AAR135W"
FT                   /orf_name="AGOS_AAR135W"
FT                   /product="AAR135Wp"
FT                   /function="acyl-CoA binding"
FT                   /protein_id="AAS50501.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="HOGENOM:HBG058046"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="UniParc:UPI00002524FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE6"
FT                   /transl_table=1
FT                   /translation="MSDDSVDIVFEKAIATIQTLSSVKGYHALPRPPASTRIQLYALFK
FT                   QSTEGDVERILPRPQGNPNVPEFNIALKKWETWKSKEGMSSTEAKKRYIQLLINTMKTY
FT                   AMGTLAARELLSELEFLWWQVSRNKEDGSEVVSDTHAESESMVLLSRGDRLDPQTLRMK
FT                   EEIYYALLKERNSHFGLLKARALARRDDDKPDPDITDKVRRRLVWLTGAILRHAWKVLR
FT                   RLAQWLLVVAAVFVLGRLSTGGRPLKLVFKPASPAPRTNLLSYVGRAVLWAFQLLNSRL
FT                   GRYQLHTLYIKLE"
FT   CDS_pept        584182..586035
FT                   /codon_start=1
FT                   /gene_family="HOG000065930" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777834"
FT                   /locus_tag="AGOS_AAR136W"
FT                   /product="AAR136Wp"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="damaged DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50502.2"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058047"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniParc:UPI0001DB2808"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE5"
FT                   /transl_table=1
FT                   /translation="MSSFYWRDLLAINSSHATHLSPLACVAHIDVNAFFAQVEQVRCGY
FT                   GKDDPVVCVQWSSVIAVSYACRKYGITRLDSVAEAMKKCPTLIPIHTAVFKKGEDFWQY
FT                   HDGYGPWNTDPSRQLDPAIHKVALDPYRRESRKLLKMIQKRCPIVEKASIDEVFVDLGP
FT                   QCFAQLLLGDDGAEFQELRRLFVEGSYSLDEPLPPLPRSVKLQFAGDVYGADAERTSFL
FT                   DWDDVIMCLGSRLALALRQEVEDALGYTTSCGVSRTKSVSKLASNYRKPNAQTIVRNAA
FT                   VETFLDQGGFELPSFWTLGGAIGKELLDLLELPPAGSIPALRALCPESPEQLHACLLRR
FT                   IRDRPLPHDAAPYLIDEQAAEALATKLFYLVRGTHCVPVNPRPTVSSMTSRKNMRGNAC
FT                   KSLADCHPWLEVFSAELAGRLQDLHQEYDRIYLPRTLTVAAQGRAHQRVSRSTGLHAPT
FT                   ANVTALTLLKAGARLVNELDERFCGADMYPLSALSMSLANFDVLQPGKTIVDLLPRAPA
FT                   TPPSPPARAASPASLPAAAAAACPQCRAPLPSQRALQVHLDGHLAQKLSDSLNGVSDAS
FT                   ALSYGERRLLLRPKHGGPAAPKKQRRTTKDIASYFGPTGQP"
FT   CDS_pept        586596..589262
FT                   /codon_start=1
FT                   /gene_family="HOG000034091" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625284"
FT                   /locus_tag="AAR137W"
FT                   /orf_name="AGOS_AAR137W"
FT                   /product="AAR137Wp"
FT                   /protein_id="AAS50503.1"
FT                   /db_xref="HOGENOM:HBG058048"
FT                   /db_xref="HOGENOM:HBG202821"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniParc:UPI00002524FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE4"
FT                   /transl_table=1
FT                   /translation="MQQLININERPDPRMERGLSSPSPDPLRSFQTVHNNSCTRDTART
FT                   PSTEVISDSLEKVSSDLLKLTPVNIGCFSSPAKEAAEAAGSAMHPALYRENFNLISRQL
FT                   ENLLNNLNVVYREIGYSNTEISAREKMIFNKLSSSISSFFYQADEEKAKLSQENEVCQE
FT                   VLRRLLEVINDPKGVRTIPDLYTRNSIMGMESQSPNKKPISLLNRKRVLTTAKLFVMKK
FT                   YTPQLLCFLESSMKLRRLIDSMADYTPEDDKALIKKVPPIDTCKFFKSYFMEHMDDVDL
FT                   NYQFLLDNREVLLQSINFTDVTEAMVGNIMDVAKLYQKELSNRLGKAKRTCHGLLKLLQ
FT                   TLGMNIMDLGDEIKDKIRIYTQKSEETICDLSHSTLSMLEDVVAEYEAIKTKRAFEKET
FT                   LVKRCESLWEKLKISPCYIDKFKQENDSLTVQHLNNFVKELDRLESMKKKLIRSLIEDS
FT                   WARIKDLWNLMHFNDNERTEFTILYENMVSTSSSLEENEKVLDLCEKQIRVLEKKYALV
FT                   KPMLELVDEFKVLHKERLQLEESSKDSSRLLSRNSHKILLQEEKARKRVTRHFPSVIYQ
FT                   LKMKLVQYVEEFREDFLVDGRPFLEIVNEEQEQLHSKYPRMRFTSGARKPLLRSKSLPI
FT                   RYSIQKKSKLVRGANSSISKSFAEKTPLRSTENVNVIRAKPDGSTQAPNNKIVNFPSLP
FT                   RTIQGTQVVSPQKKAEKAYSASLLDKSSPTKIPALTRASSHIILRSPERKEDNGTSSKY
FT                   TQLSALSTHKLNKRTLIPILSTHINTFPLNQEDKENNCTLESPAIITKKYRQQLLSSPI
FT                   KGNGQPIYATTEGEDTKASSTIEDIKVNTMAGDESSMMEDKNFTEWKRLQLAKLNDSSI
FT                   RSGNELTTRINWEHDVF"
FT   CDS_pept        complement(589403..590509)
FT                   /codon_start=1
FT                   /gene_family="HOG000141743" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082163"
FT                   /locus_tag="AAR138C"
FT                   /orf_name="AGOS_AAR138C"
FT                   /product="AAR138Cp"
FT                   /function="binding"
FT                   /protein_id="AAS50504.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058049"
FT                   /db_xref="HOGENOM:HBG202820"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR007699"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI00002524FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE3"
FT                   /transl_table=1
FT                   /translation="MPIEVDLKNAYRLLYDEKEPEKALELYDNVLQQSSTNLIALIYKA
FT                   AALEKLYYSTKSWHSDGTLEEARGLLEKALDLAEQRGDRGKLALVNFRAFVYHFNRREY
FT                   AAAEPYMTRAKQLGYDDATLGIWEANLEKKLKKAAAPGAAENRDEPKAPTEEPASAEQH
FT                   APVKSRMEWYQTTQKVTISLFVSKLPRSHSEVIVQVVNGKDLTVSYPITAGGSEFQYSL
FT                   TLAHPVDSECYSVVVLTKKVEVVLQKKDSIHWKTLEDVGQGDVQSFPAEHASVDSAPSN
FT                   SSNLQYPSSSRKKINWDALELDEAEDDQQSADAFFQSLYANADPDTKRAMMKSFLESGG
FT                   TALNTDWNEVSKGRIEPSLPDGVEMKEF"
FT   CDS_pept        590796..592112
FT                   /codon_start=1
FT                   /gene_family="HOG000159692" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625285"
FT                   /locus_tag="AAR139W"
FT                   /orf_name="AGOS_AAR139W"
FT                   /product="AAR139Wp"
FT                   /protein_id="AAS50505.1"
FT                   /db_xref="HOGENOM:HBG347991"
FT                   /db_xref="HOGENOM:HBG379306"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="UniParc:UPI0000252500"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE2"
FT                   /transl_table=1
FT                   /translation="MASIPHVHSLVLDATPLITQPYAHYKGYAQNFYTTPTVFHEIKDE
FT                   NAKKNLDIWQAAGALKLRHPSESSIKRVSDFAKLTGDASVLSANDIHILALTYELEVEL
FT                   NGDKGRLRRYPGEALVPKAAPPPEQPAGEKKKRRRGGKKQRAKREEAAQQAAARDEPVE
FT                   TADGTESPEKSAETPVEGLEEPALAAQAAEELTEEYDEADDDGDWITPDNLTEIMIQDS
FT                   GEDTTGNEGVAASDSALYNQVALATGDFAIQNVALQINLNLMNFTSGMRIKKLRNYMMR
FT                   CHACFKLLPTPRDGRPVHFCPSCGGAGTVLRCAVSVDAETGAISPHLKANFQWNNRGNR
FT                   YSLPSPLSKASQKRFGNKGFVHTRHQQEVPLLREDQKEFQQAMKQEDWTRRHNEKVLNS
FT                   WIGGGSADNYMSPFAITGLKHHSVRVGRGRHVNSSNKRK"
FT   CDS_pept        592500..594446
FT                   /codon_start=1
FT                   /gene_family="HOG000141744" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761355"
FT                   /locus_tag="AAR140W"
FT                   /orf_name="AGOS_AAR140W"
FT                   /product="AAR140Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50506.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG190978"
FT                   /db_xref="HOGENOM:HBG396789"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniParc:UPI0000252501"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EE1"
FT                   /transl_table=1
FT                   /translation="MSDSSGKQQGIISPHVTNAVKRANLEGCLTPGAGPGHGASGIGSP
FT                   GPSVSACVSPTQAVTKSIMNASGTSGAVVSNTPEPGLKRVPTVTFSDPKQLPAKQSGTG
FT                   QGGRVISGDSTTSGATASEDTDTQSHLQMKVASPIHHPTAQHSTPPPLLSHGGGNGAAA
FT                   VGMSHIRSTSPTSGSEVHPPKQAVGNIVHKLLHQFDGSGAGTPTSDVEKLHLHDEHPHF
FT                   FVSDPLHTSPTVLRSRSNSISPKPISVLSETKPADILNLDSAIESTQQQQIAPNIPKRD
FT                   PGKNVDPRLPQDDGKLHVLFGATGSLSVLKIKSMIKKLEEIYGWDHISIQVILTQAAAQ
FT                   FFANKNPKKKNLYVSSETNSFSNSVAHQGNLQQNNSDASYTAVNSVSNTPAVGGRTPTP
FT                   ADLLQGAAPQGAGSGLSQGAAAAKIELPPHIQVWTDQDEWDVWKQRTDPVLHIELRRWA
FT                   DILVVAPLTANTLSKIALGLCDNLLTSVIRAWNPMFPIFLAPSMVSGSYNSTITKRHLK
FT                   MIKEEMPWITVFKPSEKIMGIHGDIGLGGMMDGNEIVDKVVMKLGGYPKDADEDDDEDD
FT                   KAGKTNGKEDDDDDDEEELDEDDEDDDDDDDDDDDDDDDDDDDDDDDDDDSSQSPLKNA
FT                   AATSPSHSSTAHT"
FT   CDS_pept        594741..595652
FT                   /codon_start=1
FT                   /gene_family="HOG000209024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761356"
FT                   /gene_name="DRE2"
FT                   /locus_tag="AAR141W"
FT                   /product="Fe-S cluster assembly protein DRE2 "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="metal ion binding"
FT                   /biological_process="apoptosis"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="AAS50507.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG124796"
FT                   /db_xref="HOGENOM:HBG397900"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="UniParc:UPI0000252502"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EE0"
FT                   /transl_table=1
FT                   /translation="MTHSRTALVLIHPATTTRPELLTAAKQHSSLSGANIEQHLVNKLN
FT                   DGSLQLQDNSYDVIFYVTPEAADEILFPRRLIGVLAAALRAGGSLHGLYDKYQVDALLS
FT                   GFDIVREPTYHWQKRAVTASAPVKLAPRQPVSAAGLPRFKRASAPSPAAVTPTLDEVPP
FT                   AAVDPVKAALLDSAAGDAPIAENDLVVGHDSTPITLLTCGRTQTRRRKACKDCTCGLRE
FT                   ENEKEISDTHARQEKLLLGDAVKFSEPELAEIDFTIEGKKVGGCGSCSLGDAFRCSGCP
FT                   YLGLPAFKPGQPINLSAISDDL"
FT   CDS_pept        complement(595981..596619)
FT                   /codon_start=1
FT                   /gene_family="HOG000001133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761357"
FT                   /locus_tag="AAR142C"
FT                   /orf_name="AGOS_AAR142C"
FT                   /product="AAR142Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50508.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG202529"
FT                   /db_xref="HOGENOM:HBG252382"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013085"
FT                   /db_xref="UniParc:UPI0000252503"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED9"
FT                   /transl_table=1
FT                   /translation="MARYYCDYCHAYLTHDSLSVRKSHLIGKNHIRLTADYYYNKAQQQ
FT                   AKPFLFPKVRSRPQGGIQLPAQRRTLHCETNRVKRQRRLIHQVAPAATPLRELYAHSPG
FT                   FHKVFTPECRLDVGDTLRVSKLPQRANQKVKTAAPAAGRSEVYAPRYAANPVLPPPSAL
FT                   TLWGGNISNNSNIYAADETLLRTVSKVREKLTSSRTEKVGRTMQSIRRH"
FT   CDS_pept        598502..599794
FT                   /codon_start=1
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082164"
FT                   /locus_tag="AAR143W"
FT                   /orf_name="AGOS_AAR143W"
FT                   /product="AAR143Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50509.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="HSSP:1AIP"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI0000252504"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED8"
FT                   /transl_table=1
FT                   /translation="MSFLASRLSTRFLARPAVSAGVRSFVSTPLRRATFDRSKPHLNIG
FT                   TIGHVDHGKTTLTAAITKTLASRGGADFLDYSSIDKAPEERARGITISTAHVEYQTEKR
FT                   HYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVF
FT                   VNKVDTIDDPEMLELVEMEMRELLNHYGFDGDNTPVVMGSALCALEGRQPEIGEQAIMK
FT                   LLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLNKGEEIEIVGHNA
FT                   TPFKTTVTGIEMFRKELDKAMAGDNAGVLLRGVRRDQLKRGMVLCKPNTIKAHTKFLAS
FT                   LYVLTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPESVADHSMQVMPGDNVEMVCEL
FT                   VHPTPIEAGQRFNIREGGKTVGTGLVTRIIE"
FT   CDS_pept        600201..602102
FT                   /codon_start=1
FT                   /gene_family="HOG000175620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625286"
FT                   /locus_tag="AAR144W"
FT                   /orf_name="AGOS_AAR144W"
FT                   /product="AAR144Wp"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="AAS50510.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="HOGENOM:HBG009517"
FT                   /db_xref="HOGENOM:HBG738311"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI0000252505"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED1"
FT                   /transl_table=1
FT                   /translation="MLWNSQVCQNGRASPWGFIRLICSVSLFSVLVREGAALYIQPQKA
FT                   RLNGGNTHNIDIGPLNRSATLTPAAYYRKVGVNGAISSDLELCNRMTVHDILLGIPGAN
FT                   AADAAVTMSLCIGMINFFNSGIGGGGFAVYTDGQDPERHLAFDFREMAPELAHKEMYAS
FT                   DPNASKIGGLAIAIPGELAGLYEMYEKRGSGVARWEELLRPVIELGFQGWAVGPALAAS
FT                   LQEYEAYFKAHLDDWSFVYNHKEGRVLRAGEWISRPELAKTLQNLAASGGVKPFYDAES
FT                   DLVKTMVNKIQSAGGVLSESDFENYEVDVTRPLSLKIRSSWEYLPNNDLTVLTTSGSSS
FT                   GAALLSALKILDQFPNKEDGDFQPEQAYQLIEAMKWMASARSRLGDFGGGEELAPQVRD
FT                   VLGDAWTDYAVNLIKAGYIDGHFGTLVDWHDYLPEYELNDPHGTAHISIVDHFNNAVSL
FT                   TTTVNLLFGSLVHDPSTGIVFNNEMDDFSQPGRPNAFGLQPSRYNFPEPFKRPLSSTCP
FT                   TVVLNDVGLPDLVVGAAGGSRILTSVLQLIVRTYWYNMPLLEAVAYPRIHHQLLPEVLE
FT                   VESLALLGPDTVDAIRRMGHSIVEVTPKSVVNAIRHWHGTWHAVSDYWRKRGISVAY"
FT   CDS_pept        602560..605823
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082165"
FT                   /locus_tag="AAR145W"
FT                   /orf_name="AGOS_AAR145W"
FT                   /product="AAR145Wp"
FT                   /protein_id="AAS50511.1"
FT                   /db_xref="HOGENOM:HBG058050"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="UniParc:UPI0000252506"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED0"
FT                   /transl_table=1
FT                   /translation="MDKIQQPPHPQMTGQAGAEGEIGRQEREEEFEFYQAFAAESVKGV
FT                   VHMITLQLKAEGVADSYVLLPFRPEHANRKLLAFLNAVFPLGNGQAVPRAKARHVIGET
FT                   DSWTLVQALKYIWCRLPGEQVIGWETYWRFRAEERKLGYPSDAFMQVLPGCLSSSSHAS
FT                   IVYDFFDLLVAVAANVSENRMSGRKVAKMSAIWAFGDYRHPDGGGNNSFQEGLAQWRRG
FT                   ANAMFHLFLAFLRAFAVDEQKSGKFTRELEAILFQNAYPPPEDLQEDPAKLISVPVLTL
FT                   KTDRFSRKPWELFERCNSLFQTAGHYGGPLEDYTLLQSLFMRKNQANALSKKMTGETRR
FT                   LLKEMSTKHSTFQAGWGNRNPLPNRLNLTESISWTRTEISDYFIWTWMSTLSHEQISSK
FT                   KKIFGRSFIAEFELDGFKKCIIVEESDITLDRMRTGAPATEPEKATANVMASPNELHLS
FT                   PGYLKFQESVEDASKSASPPDIDPSHRQSSSSYSSRCSVRSRGSRGSNGKPYSNNSSTS
FT                   SRCSINGNGHTAAYSTIALPKRQMNTKPATPSSCGNSPASLAGPGFTITTSSNYDTESE
FT                   RSLHIESDISVIRAPNTELPPCSPLSADVPQRKSYLDASGRFDRDMDRLLQRTDALNLQ
FT                   GQAAPAGRRPNEYMGREAIPEKPRSYDLLQPAQSSKNFYAGLDTGSSVMLATESCVMGK
FT                   ELPESGSQGRSTGGASWMPHSNNVADESFVSSSSGGTQATPRTTQAPSDPSFLQGRAQW
FT                   QRPAQVPKGSAHRNPYGTACNNFAGEEGAPSQLTVGNRSPPDPSPPAHVQGAAAEDALG
FT                   SPGFAAPRHKRQSALAATGYTHSTSASSEYVGPATASSDVRRPYTYYDVPPGRASPPSP
FT                   QKLDPAQTSHVRMPPQLAAVRTLQAASGGDTAAPHTYQHVGQAYDQTAYQQRSPPESPS
FT                   LPEQAYVPEQAYAPEQAYAPEQAYAAAHAPRRSTHGFPNHPQMLQPHSQRHPYALSHGS
FT                   PTHHPSHAVPSVYPEPQSFGRPTSAASAPKTHLPNAARPASPVKADPMATTQQPHGNAV
FT                   PMNYAPVVLPSNRLHGGNMTKQQGRKQLYKDIRDGNFGL"
FT   tRNA            complement(605847..605918)
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        606034..606288
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082166"
FT                   /locus_tag="AAR145W-A"
FT                   /orf_name="AGOS_AAR145WA"
FT                   /product="AAR145W-Ap"
FT                   /protein_id="AAS50512.1"
FT                   /db_xref="HOGENOM:HBG058051"
FT                   /db_xref="UniParc:UPI0000252507"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC9"
FT                   /transl_table=1
FT                   /translation="MSQEQPPADPTPQASPAAPGPKSLAPPGARPARPAHWLAATIPVK
FT                   SFSGYSLQFAGWAADPAAKPENANSAQPKPTGPRPPAAA"
FT   CDS_pept        606915..608243
FT                   /codon_start=1
FT                   /gene_family="HOG000114462" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761358"
FT                   /locus_tag="AAR146W"
FT                   /orf_name="AGOS_AAR146W"
FT                   /product="AAR146Wp"
FT                   /function="actin filament binding"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /function="protein binding, bridging"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50513.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030674"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="HOGENOM:HBG176634"
FT                   /db_xref="HOGENOM:HBG735468"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI0000252508"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC8"
FT                   /transl_table=1
FT                   /translation="MMRTVTSSTLMLALGMALWCLSGVAARPLPALTPNSIQVVTNTKR
FT                   YFDYENKTMRGVNLGGWLVLEPYITPSLFEPFRKNPDNDDGIPVDEYNLCKTLGREKAH
FT                   ERLSKHWSTFYTEKDFHAMKAAGLNIVRVPIGYWAFELLEDDPYAQGQEEYLDKAIEWS
FT                   RAAGLKVWVDLHGAPGSQNGFDNSGRRDQIEFLKPHNLELLHKVLEHTLGKYSQDEFAD
FT                   VVIGVEVLNEPLGPAVDIQGVRDLYYYAYDLMRNKFKRDQVVVIHDAFMPSQFWNSDLT
FT                   LDKGYWGVVVDHHHYQVFSPGELARSMDDKVKTACAWGHDVISESHWPVCGEWSAALDD
FT                   CAKWLNGVGVGARWDGTFNKNGDKAPYQGDCHQFYESWPEEKKKNTRRYIEAQLDAYEL
FT                   RGGWIFWCWKTETLTEWDFQRLLAHGLMPQPLEDRKYPNQCPF"
FT   CDS_pept        608839..613581
FT                   /codon_start=1
FT                   /gene_family="HOG000141990" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625287"
FT                   /locus_tag="AAR147W"
FT                   /orf_name="AGOS_AAR147W"
FT                   /product="AAR147Wp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50514.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058052"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI0000252509"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC7"
FT                   /transl_table=1
FT                   /translation="MASQVPVVDLTSDEAEDNGRNGQQDPPGALRRLYEDFGDGKERNE
FT                   MGREEPGANEATRRLASLNRAASSAMRSGAASPTGMGLYNPKPADVRLPWRSPGVDMAE
FT                   PEHKPSAWAPAGGVKRRRLSVAPGAPAVRCAEAGSNDGQDYDEDFSGLESSPETPDPEI
FT                   LVDTEEDPLLRRVLDDRGEVRLYRAQSVPSTQGSNDTPILLLSSDDEAGRPSGEREPNS
FT                   ASAKAAQSSWKMTTMKSSSDREIEYPSQDALLQHLARREQDYYDKLVQLKTTKQILQSK
FT                   ISRRETQIRAKGDSNEKLIDANRNTQGKLTNAEALLRRTELDYAAFQRQKREALLRMQL
FT                   SMVDQKADKVRYQQTKMALLRVQLDNAPHTFGDEAELKNELRRIRSELSSLSVSEETHA
FT                   DRSEASHGIFKRTCMKALELLEASDRSQENRQAVQRLIKEVLRLEEHFLSKSLSAGERE
FT                   RGSKISQELQRQGIRMPFVYNRLQSICDTPESVVANINENLGAAEFISALNSALSSGNT
FT                   MTEKSQTANSAAFFYTISKVRSILASSNRSPELKTDINNNLLAIEAYQQLVFCGLTPDD
FT                   ERKSAVLKAIRMLYKQGVKMPLVYQVLEEQGLNWRYDPTGALKNISDARDLIAQNTKRS
FT                   AETKQKIYNLLDEVEKTIKETMQNVTPTIYKTTNISLNLTALKNLGVKMPVVDRTVAAY
FT                   LKRMKKSSQQPQKSVKVESETSTDSINGDEEMRYFQSIQQAVSTYSTALNRARLGYDRV
FT                   RRILLALEALRAYRELFHRADAPLFWNQKVQDSLNTLMDINLQLPPVFRYLKQRGFHTG
FT                   DNKYVNSDDIDKDGVIEPLMIQGDPEDADLKELGDLAAGNQLQMANIYTSRDHQSLNEL
FT                   LESLKQAETSIDGEELTPPDMTVNLLKHQRQGLYWLLKTESSKFKGGLLADDMGLGKTV
FT                   QAIALMLANRSADSTCKTNLVVGPVAVLRVWHDEINTKVKKQAQFSVMIYGGFGGKKVE
FT                   NFKAMHNYDVVLVSYQTLAVEFKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYW
FT                   SPFFSDDSNFYRIILDEAQNIKNKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLL
FT                   RFLRIAPYNREQKFKEDIGNALLSRGGDFDSMDTKRALKKVRVLLRAIMLRRAKTSQIN
FT                   GQPILELPAKHIRKKEDILDGQDLEFYKSLEHETAIQARALLNERKASSSSNILTLLLR
FT                   LRQACCHQELVKLGKAKAIGTRVVNGMDFIKDWLRLYNVAKRIGTEGKGTVSQSLENMI
FT                   CPFCMEQMEIESLSVLTPCGHLLCDACVEPYLEDARESEYARKGPKGTRSTFVPCLVCE
FT                   KLINDHEIISYQLYHQAVVKGISTDELREEYENEMTKRRHKLKYDYQLNFENLHQSKKV
FT                   QQCLGIIKTVLDNSTDEKLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASV
FT                   IERFYREKNERLLLISMKAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQRE
FT                   VYIHRLLLKNTIEDRIVELQNRKRTLVENAMDPTELREVNRLGRQELGFLFGINSLPGR
FT                   E"
FT   tRNA            613850..613921
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        complement(614067..614759)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777835"
FT                   /locus_tag="AAR148C"
FT                   /orf_name="AGOS_AAR148C"
FT                   /product="AAR148Cp"
FT                   /protein_id="AAS50515.1"
FT                   /db_xref="HOGENOM:HBG058053"
FT                   /db_xref="UniParc:UPI000025250A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC6"
FT                   /transl_table=1
FT                   /translation="MIVKHDKNHFNWHEEMLSPLPSLPSLEQDSDGDSDVDMELESPIA
FT                   FQDCTDNIQLICTPYEGLKAARVHLDPATDSNLRRLSDTLQLECNSLKDQRLCVVHQVK
FT                   LVKTTVQAIKLDFFWSDDEDLSPSMPVDGFNFYTVSIKLPRNDPLIWKHYLLKSQYNQM
FT                   VEFLSPFEQRPRYESSYLMKSERLVDFVMQQVWLQDVREHNAQDESQLFELPQLYTCLY
FT                   QEVQSRYN"
FT   CDS_pept        615201..615608
FT                   /codon_start=1
FT                   /gene_family="HOG000214661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761359"
FT                   /locus_tag="AAR149W"
FT                   /orf_name="AGOS_AAR149W"
FT                   /product="AAR149Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50516.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG381817"
FT                   /db_xref="HOGENOM:HBG599090"
FT                   /db_xref="InterPro:IPR003377"
FT                   /db_xref="UniParc:UPI000025250B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC5"
FT                   /transl_table=1
FT                   /translation="MGAWLFVFAFVMNAVSMFLQVHFTIMYADLEADYVNPIELCSKVN
FT                   RLITPEAGVHAFISLLFLLNGYWFVFLLNLPVLFYNAKKIYHKMQLLDATEIFRTLSKH
FT                   KRESFLKLGFYLLLFFFYLYRMIMALIAEDN"
FT   CDS_pept        complement(615667..616413)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761360"
FT                   /locus_tag="AAR150C"
FT                   /orf_name="AGOS_AAR150C"
FT                   /product="AAR150Cp"
FT                   /protein_id="AAS50517.1"
FT                   /db_xref="HOGENOM:HBG058054"
FT                   /db_xref="UniParc:UPI000025250C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC4"
FT                   /transl_table=1
FT                   /translation="MERRVKLLYRQRGSALRRVEQEVVIQDGAPAAATAAEESVEPPEE
FT                   PADLPQLEAGDWAVGSPGDAAAWEPPEAVDEAPSAAGSPAAGGEAPGEAADEASRFAGL
FT                   SATQLATSITSVATVEVLSEVVTALFSQQLAPQCAERFRRARTRAERLSYKLELRIFER
FT                   LEAQVRADLRDIVDIHRSNNELCYQMKQILRLRHELTEELVAVRAQRAELDLAAARDSA
FT                   QAQDLAALLRLNARLHGLRTAAARSL"
FT   CDS_pept        617408..618853
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761361"
FT                   /locus_tag="AAR151W"
FT                   /orf_name="AGOS_AAR151W"
FT                   /product="AAR151Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50518.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="HSSP:1AUD"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000025250D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC3"
FT                   /transl_table=1
FT                   /translation="MADTQIPEPPSTTVQTSSEPPRTLWMGDLDPSFDEATIQHVWLTV
FT                   GHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQINGVSFIDPNTTQLHHAGYCFVQ
FT                   FANLQEAQAGLQLNATPLPNVVSPTTRNPTNPTGKRNFRLNWASGATLQSDIPATPEFS
FT                   LFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALA
FT                   EMNGVWCQGRQLRVAYATPRNNLLQQQQAHPAPPAPPSPPAPPAQTLPDSLGLLVGVPS
FT                   LAQLDAASLGRAQQPLLLGAAGSLVGSNSLPLAAPRQLPADTANTTVFIGGLSNMISEG
FT                   QLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFIVGGNAIRLSWGRTH
FT                   SHSGSSGSSGSSGSSGSLAIDHHPYHQHPQQQRLAWASQQLGDGVNLRFSGTGSMAAAA
FT                   TAATGLLQSAAPQQTAIHPSLLP"
FT   CDS_pept        619088..619876
FT                   /codon_start=1
FT                   /gene_family="HOG000181024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082167"
FT                   /locus_tag="AAR152W"
FT                   /orf_name="AGOS_AAR152W"
FT                   /product="AAR152Wp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="AAS50519.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG204207"
FT                   /db_xref="HOGENOM:HBG434714"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000025250E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC2"
FT                   /transl_table=1
FT                   /translation="MLSLPLAHQMGGRHVLLVGCGAVGMTRVDKLVPTGCKLTVVAPEV
FT                   DAGLAAYMPGGMEVAAGATWVNKGWEPGQVYRVARREFAAGDEGLEAFAFVLACVPAGG
FT                   LGARVHALSHARGVQCNVADVPALCDFYFGSQCALGERGLQVLVSSNGAAPRLTALLRA
FT                   DIERRYAALDWDEMCGRLRALRERARALSTQAGLPAEEALRFRMDWMRQVTDAFGLEHC
FT                   AAMDVERLAGLFGEMAAAAAAGRPRALPADLVSVYTESST"
FT   CDS_pept        complement(619927..621363)
FT                   /codon_start=1
FT                   /gene_family="HOG000270353" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777836"
FT                   /locus_tag="AAR153C"
FT                   /orf_name="AGOS_AAR153C"
FT                   /product="AAR153Cp"
FT                   /function="heme binding"
FT                   /function="stearoyl-CoA 9-desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50520.1"
FT                   /db_xref="GO:0004768"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG191686"
FT                   /db_xref="HOGENOM:HBG520703"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000025250F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EC1"
FT                   /transl_table=1
FT                   /translation="MEQVDLPNANKIAAGANKASVRVVNGLGALMGSKAMAAVDFEKDS
FT                   MAEMLARDQREKEHYRHHKHISEQPWTLNNWHLHVNWVNIVLVVVVPIIGLYLALSGRV
FT                   PPRFEVLALAIVYYSLGGLGITAGYHRLWAHRSYSARWPLRVMYALFGASSVEGSIKWW
FT                   GHSHRIHHRYTDTPRDPYDARRGLWYSHMGWMLLQPNPRYRARADIEDLMNDWVVRLQH
FT                   RHYVLIMAFMAFLLPAIICHFIFRDFWGGLVYAGILRVFAIQQATFCINSLAHYLGDQP
FT                   FDDRRTPRDNWITALVTLGEGYHNFHHEFPTDYRNAIRWYQYDPTKVFIYCASLVGLAY
FT                   DLKKFSQNAIQQGLIQQKQKKLDNARSRLNWGTPLSQLPVWDRSEFVRASRENSGLVVI
FT                   SGIVHDVSGYITEHPGGETLIQAALGKDATRAFNGGVYMHSNAAHNILATMRVAVVKEG
FT                   QDAATRFAARRGEALEKKTA"
FT   CDS_pept        623890..625353
FT                   /codon_start=1
FT                   /gene_family="HOG000048307" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15761362"
FT                   /gene_name="SDS23"
FT                   /locus_tag="AAR154W"
FT                   /product="Protein SDS23"
FT                   /function="catalytic activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50521.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG058056"
FT                   /db_xref="HOGENOM:HBG395800"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016711"
FT                   /db_xref="UniParc:UPI0000252510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EC0"
FT                   /transl_table=1
FT                   /translation="MREKQQGTTGAGGMSSGAAAASPGQRHASIVEMLSTPPPAIVVQT
FT                   GMEDENVRATGGETAADGDERRTLSRQSSTSSTESHASATSCLTKVHAQKWQHIELSQL
FT                   VEENKLVFINAEMSVEEAFNTLVEHNLTSLPVERYPGDMDCVTFDYNDLNSYLLLVLGK
FT                   TTVADEEITRQCQSGQPVPVGRIVKLTPKNPFYKVPETEDLSTVMGILGSGVHRVAIVD
FT                   STSSSIRGILSQRRLMKYLWDNARQFSNLEVLLNSSLQKLGIGVLDPHTPPTSRQSRVI
FT                   SILDTEPLLVALHKMHTERISSIAVIDHQGMLLGNISVTDVKQVTRTSQYPLLHNTCRH
FT                   FISVILNNRGLEMGKDSFPIFHVYPTSSLARTVAKLVATKAHRLWIVQPVEQGVLVSPP
FT                   VAPTTIDGSSEFSSRHVSPSPAPSPAGSHGPLTTSASPLGTLDKEYSTGKLIGVVSLTD
FT                   ILGLLARKHTENKLVDPLSARRQRGSVAR"
FT   CDS_pept        625556..626260
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19777837"
FT                   /gene_name="GEP7"
FT                   /locus_tag="AAR155W"
FT                   /product="Genetic interactor of prohibitin 7, mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS50522.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG058057"
FT                   /db_xref="UniParc:UPI0000252511"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EB9"
FT                   /transl_table=1
FT                   /translation="MKRTCALASRAVPKSLLERQARRTGSKVGASQEASKFVVASLRDI
FT                   GSLFSGSSSGDDEEQEALRLHSDTVSKLNSGELTEVVRQRYCVDNKDRCETRMLLTKYP
FT                   GPAREREMLQVATAELSARDWRKMPRVWQQVSYYHAFGSWGPRTGLSFVGRRPEDFFVT
FT                   DQKGLWTCSAPRRAEYERSSRALDPASRAVLYAAALVAAVAALGDLWRRQDADRQVTVA
FT                   ELDLAEPTSSPT"
FT   transit_peptide 625556..625753
FT                   /gene_name="GEP7"
FT                   /locus_tag="AAR155W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EB9 "
FT   mat_peptide     625754..626257
FT                   /gene_name="GEP7"
FT                   /locus_tag="AAR155W"
FT                   /product="Genetic interactor of prohibitin 7, mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EB9 "
FT   CDS_pept        complement(626346..626858)
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082168"
FT                   /gene_name="UBC2"
FT                   /locus_tag="AAR156C"
FT                   /product="Ubiquitin-conjugating enzyme E2 2 "
FT                   /EC_number="6.3.2.19"
FT                   /function="ATP binding"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="sporulation resulting in formation of
FT                   a cellular spore"
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50523.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0030435"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252512"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EB8"
FT                   /transl_table=1
FT                   /translation="MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPAD
FT                   TPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVAS
FT                   ILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKSWEDDLKDMDDGDDDD
FT                   DDDDDDD"
FT   CDS_pept        complement(627104..628615)
FT                   /codon_start=1
FT                   /gene_family="HOG000160241" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777838"
FT                   /locus_tag="AAR157C"
FT                   /orf_name="AGOS_AAR157C"
FT                   /product="AAR157Cp"
FT                   /function="ATP binding"
FT                   /protein_id="AAS50524.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG058631"
FT                   /db_xref="HOGENOM:HBG447871"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="UniParc:UPI0000252513"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EB7"
FT                   /transl_table=1
FT                   /translation="MLHSRAARVLQRSGSEAQMQQLRAQHHKRYSMASPTISQVPDFSK
FT                   YFPTWPVTELAPFINEVMRAYPRNSKYVNQQHYYHNRKVLVERYLQRQPHAVSLKHLAQ
FT                   YYDDSNRLTKQKVIRSGQFAKEELTVRMAHKLRELQDLPFNVVNNFHFVQVYESYYNIF
FT                   ERFRRFPAIRTLEDNERFAELLHQIMSDFNSLNLPHLIMGALESCILDLYPQDAMDRLM
FT                   SSFLRARISRRLIVEEHLSVTSNYMSGKSENTLVLGDIFQECSAREYLLHAARICENAI
FT                   RDMFYPDIPLPDFIIDGCADLRFYFLPSQLHYLFGETLRNSYEATVKEAIRRGLPKPDP
FT                   ITVTVVQNPESYLFRISDRGGGIPHPDRTIWSFGKSKLLAQQALDNFHKLPGAQTVSLY
FT                   DHMYDADARRVAAACKLSNTSLQSMAETNLTKGRYKFDFPRPLVGLLERPFRYKLGIGL
FT                   AMCKVYAEYWNGDLTVHSIHGHGTDTVLKLGNLMYHTDHLQLDRV"
FT   CDS_pept        join(628866..628884,628969..630665)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15761363"
FT                   /locus_tag="AAR158W"
FT                   /orf_name="AGOS_AAR158W"
FT                   /product="AAR158Wp"
FT                   /protein_id="AAS50525.1"
FT                   /db_xref="HOGENOM:HBG058058"
FT                   /db_xref="InterPro:IPR014840"
FT                   /db_xref="UniParc:UPI0000252514"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EB6"
FT                   /transl_table=1
FT                   /translation="MIPGREVIEDEERQAGTSGGAAKRALDSGGTEVDGMKKQKSIPNI
FT                   ANELAKNRAEVRAPISSINKTLVQPVARPRMHAIPLSSLLSPSVDYGYPKLSPSPQFPA
FT                   LSPTVVPKLESPAEQVLGAPHAPQVPAFQLPVLDSGAIGGGARAGVAPAAEASVNNPSG
FT                   QAEAAVANAPARKSAPRKKKADGAGAAAKKKAEGSRPAAKKASSRPVKKEEPAAVPSDA
FT                   SAGGAGTNKVVLPSQEGGQANDSPLPSDANTEDQGATPLRASPPANKTNKSLKRTQSNL
FT                   SSGQKAGSQESQKARKSLSASNLGNGTTSTSPPPAAGASTAPASKKASGTSGAKKESKG
FT                   KSKSAASKKKETAAASTTVPDTSSAAAIASHTPKVLAPAQPIKSPSVMDVLDQKFIGTQ
FT                   AAEEDDPVIVVDVPLYQVDTNDYLDENGQVVFNFYNLVHEKFNTQQNSQSRTTSSATKD
FT                   RLEQGDDIAMADDDDDDDEDDEDDDDPSASGAAGASPSKSKKKSNPMKGKSRVGKYDIE
FT                   DPFIDDSELLWEEQRAATKDGFFVYFGPLIQKGQYATFERVDGTMKKGGVRNPR"
FT   CDS_pept        complement(630834..632675)
FT                   /codon_start=1
FT                   /gene_family="HOG000141987" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777839"
FT                   /locus_tag="AAR159C"
FT                   /orf_name="AGOS_AAR159C"
FT                   /product="AAR159Cp"
FT                   /protein_id="AAS50526.1"
FT                   /db_xref="HOGENOM:HBG124609"
FT                   /db_xref="InterPro:IPR013877"
FT                   /db_xref="UniParc:UPI0000252515"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EB5"
FT                   /transl_table=1
FT                   /translation="MKRHATTEGESLGVLFAEQAGDVISLAAGIELCAEQALASGNAGR
FT                   VASFLEALWEQLREHPALVGDLGWDIPKVLVRCIRADNFNLNEGLGDDMVWRLLVGCFR
FT                   EVGREGNARECFLTGCQQLAELSVAAEEEEDADLREEMFALKFHMLMEFVTTTLGRTTT
FT                   AYPSRFLGEIIGVLVKLVERNADELCDVHLLLRRLYTFCRDYTAPVSSSEDEELRAQED
FT                   YLQRTLFRSFLAYALAQLLRRQSVRWAPEYFAKSHGLEFKLHDDHVELRETLGRYFQLA
FT                   HSFDIDIEGAFQKQCILESRDVYACVSADADKADGAEVIYQLAYTYELKKIAELQSMPI
FT                   DARGIFVLAVLHHFETGKPICLSLRLDDAIYMFLRFNTPEIYSKSFGNIAVTDASLYFV
FT                   LLALEGNSHEENHKLVREFPQTVFAVFIQVLLLNMCRLPSREIGRMTHSILARVLFLAS
FT                   ETTAFDFVIDTLLQCPYETAKQIILEIAKIMMVSDQYTICTRDVPSHTRTDTKAPPLPP
FT                   RPFIKLNDDRMAAFHTLAMMSAKFCTETEDPKQLTTLLSYLNLITVLRKKWDQVLLREL
FT                   TVAVSNCIEPRKEDIPEIGFIKIANDGLKEFLGGNST"
FT   CDS_pept        632781..633350
FT                   /codon_start=1
FT                   /gene_family="HOG000234863" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762441"
FT                   /gene_name="ATG12"
FT                   /locus_tag="AAR160W"
FT                   /product="Ubiquitin-like protein ATG12 "
FT                   /biological_process="autophagic vacuole assembly "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50527.1"
FT                   /db_xref="GO:0000045"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG204208"
FT                   /db_xref="HOGENOM:HBG247064"
FT                   /db_xref="InterPro:IPR007242"
FT                   /db_xref="UniParc:UPI0000252516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EB4"
FT                   /transl_table=1
FT                   /translation="MVPLLESETENSISQSQFDSESASAEPTPPQHTQESLQNRLEEYH
FT                   ERLSRLQLPSSSDSECSDIEQESLELEQEVPLSTSVYLAGARSAGGLPSSSELSETPEP
FT                   PKVAIRFQPIGSVGQVMPQVCRISSAQSFGAVLVFLRRRLRLDTVHCYVSNSFAPTPQQ
FT                   NVGQLWEQFKVNDELVVSYCATVAFG"
FT   CDS_pept        633414..633998
FT                   /codon_start=1
FT                   /gene_family="HOG000112294" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762442"
FT                   /gene_name="DUO1"
FT                   /locus_tag="AAR161W"
FT                   /product="DASH complex subunit DUO1 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS50528.2"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124608"
FT                   /db_xref="InterPro:IPR013960"
FT                   /db_xref="UniParc:UPI0001DB281F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75ED7"
FT                   /transl_table=1
FT                   /translation="MNANGEANGGVDSAALDELIPQIFDQMRTNQLDGSGAAAWGTAAV
FT                   STATLLKEMEQLDQIIPVLQQLNESLRRSTGENLSRIRRTCEAVNRVLDTWIKIQSQAG
FT                   YVGELMDDSEYLSYMEKTRGDEGQQQAYMESLRKQVEELRRKVDERRAVEAAAAAPRAP
FT                   ERTRGASGIPRGGSRITKRGGTTVRGRRMFR"
FT   CDS_pept        complement(634041..637556)
FT                   /codon_start=1
FT                   /gene_family="HOG000282801" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762443"
FT                   /locus_tag="AGOS_AAR162C"
FT                   /product="AAR162Cp"
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="pyruvate carboxylase activity"
FT                   /biological_process="gluconeogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50529.2"
FT                   /db_xref="GO:0004736"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG185226"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001DB2820"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED6"
FT                   /transl_table=1
FT                   /translation="MGSQLAGFRRHSNLLGEKNKVLVANRGEIPIRIFRTAHELSMATV
FT                   AVYSYEDRLSMHRQKADEAYMIGREGQYTPVGAYLAIDEILRIARDHDVDFIHPGYGFL
FT                   SENAEFAAKVEGAGITWIGPPASVIEAVGDKVSARNLAAVADVPTVPGTEGPISSVEEA
FT                   EEFVQKYGYPVIIKAAFGGGGRGMRVVREGDDIRDAFQRARSEAETAFGNGTCFVERFL
FT                   DQPKHIEVQLLADNYGNVVHLFERDCSVQRRHQKVVEVAPAKTLSKEVRDAILTDAVKL
FT                   AKASGYRNAGTAEFLVDKQNRHYFIEINPRIQVEHTITEEITGVDIVAAQIQIAAGASL
FT                   EQLGLMQDRITTRGFAIQCRITTEDPSKNFQPDTGRLDVYRSAGGNGVRLDGGNAFAGA
FT                   VISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFISGD
FT                   YWTTFIDDTPQLFEMVASQNRAQKLLQYLSDLAVNGSSIKGQMGVPKLLAQPSIPQLHN
FT                   AKGEVIDVQSQPPAGWRQVLLEHGPEVFAKKVREFDGTLLTDTTWRDAHQSLLATRVRT
FT                   YDLAAIAPTTAHALAGAFALECWGGATFDVAMRFLHEDPWERLRTLRKLVPNIPFQMLL
FT                   RGANGVAYSSLPDNAIDHFVKQAKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGLVEA
FT                   TICYSGDMLQPGKKYNLDYYLELTEKIVAMGTHILGIKDMAGTMKPGAAKLLIGSIRAK
FT                   YPDLPIHVHTHDSAGTGVASMVQCAISGADVVDVATNSMSGLTSQPSITALQASLGGDI
FT                   ATGVDPDHAIELDAYWAEMRLLYSCFEADLKGPDPEVYKHEIPGGQLTNLLFQAQQLGL
FT                   GEQWAETKRAYAEANQLLGDLVKVTPTSKVVGDLAQFMVSNRLNSDDVRRLASSLDFPD
FT                   SVMDFFEGLIGQPYGGFPEPLRSDVLRNKRRKLKVRPGLELAPFDLDKIREELRSRFDN
FT                   IDECDVASYNMYPKVYEDFRKIRETYGDLSVLPTHNFLSPPKIGEEIIVTIEQGKVLII
FT                   KLQAIGDLNKETGKREVYFELNGELRKVSVADKSQKLETVSKLKADAHDQFQVGAPMAG
FT                   VIIEVKVHKGSAVTKGQPVAVLSAMKMEMVISSPSDGQVKDVFVSDGETVEASDLLVQL
FT                   EVSQP"
FT   CDS_pept        complement(637934..638224)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625543"
FT                   /locus_tag="AAR163C"
FT                   /orf_name="AGOS_AAR163C"
FT                   /product="AAR163Cp"
FT                   /function="mating pheromone activity"
FT                   /biological_process="mating"
FT                   /biological_process="pheromone-dependent signal
FT                   transduction involved in conjugation with cellular fusion "
FT                   /cellular_component="extracellular region"
FT                   /protein_id="AAS50530.1"
FT                   /db_xref="GO:0000750"
FT                   /db_xref="GO:0000772"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0007618"
FT                   /db_xref="HOGENOM:HBG058060"
FT                   /db_xref="InterPro:IPR008675"
FT                   /db_xref="InterPro:IPR016326"
FT                   /db_xref="UniParc:UPI0000252519"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED2"
FT                   /transl_table=1
FT                   /translation="MKTTHILSLATLAACAPVQPAPVQPTDLAAAANVPEKAVLGFFQL
FT                   YNVGDVELLPVDDGAHSGILFVNRTLADVDYSSEHVVQKWFRLSLHHGQSM"
FT   CDS_pept        complement(638719..639102)
FT                   /codon_start=1
FT                   /gene_family="HOG000242147" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762444"
FT                   /gene_name="SOH1"
FT                   /gene_synonym="MED31"
FT                   /locus_tag="AAR164C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 31"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS50531.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG022258"
FT                   /db_xref="HOGENOM:HBG628910"
FT                   /db_xref="InterPro:IPR008831"
FT                   /db_xref="UniParc:UPI000025251A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EB3"
FT                   /transl_table=1
FT                   /translation="MSAKSSEPPFEPSSEGEQLPSRFEVELEFVQSLANIPYVTFLLTQ
FT                   HQIWQDPRFKAYLKYLEYWCEPPYTQFIVYPNCLFVLKLLNSFLDKAVENEDGILEGAE
FT                   DLPKVIQMQGGEWMNQMVERWRG"
FT   CDS_pept        639305..640393
FT                   /codon_start=1
FT                   /gene_family="HOG000112596" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625544"
FT                   /locus_tag="AAR165W"
FT                   /orf_name="AGOS_AAR165W"
FT                   /product="AAR165Wp"
FT                   /protein_id="AAS50532.1"
FT                   /db_xref="HOGENOM:HBG058061"
FT                   /db_xref="HOGENOM:HBG204281"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI000025251B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EB2"
FT                   /transl_table=1
FT                   /translation="MSTVRRERSRFLWVQLSLCPVIIVVGTVMRIFSEPNSWNADKDST
FT                   VNIWFIKQGWAWTSAVCWWCVVRYKGLGGRSLRQTALRYVALTAWWYAFTQAIWFGIAP
FT                   IMDQVFTSTGGHCSFDVFDTGMGLNSGFHDSEGRRTRSLQKLLQWFTAHGAQGDELRER
FT                   TMYWIRCMLTGGQCENTGLDPTELNSYIQDSVTASAIRSSHACSRLGGHWMGGHDPSGH
FT                   VFLITLMCMFMLGELQVFGRRAIGKLSADCQQLQGAPGKIVARILQASPIRELINSEAP
FT                   QHILRRLFVQLPLESLAILVSAVVFGFRFIVLENPILLLVGLILTWTWSLLVTILSFHS
FT                   FAEHLTGLLFAYLLVLALYWYI"
FT   CDS_pept        complement(640431..642188)
FT                   /codon_start=1
FT                   /gene_family="HOG000194770" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931068"
FT                   /locus_tag="AGOS_AAR166C"
FT                   /product="AAR166Cp"
FT                   /protein_id="AAS50533.2"
FT                   /db_xref="HOGENOM:HBG012531"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001DB2836"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EB1"
FT                   /transl_table=1
FT                   /translation="MCRVRDPQIFCRTSQNLHLSLKSSQALWMTPGGNMEVHKASSQLA
FT                   AHDVPQFYLLVALYFLQGIPVGLAFGTVPFLLKSIAKDTSFTKLGLFGIATYPYSLKIL
FT                   WSPLVDSVFSKKIGRRRSWIIPVQLASGVMLWCVGHAVAQGWVFEGVDASYGAPSLGDG
FT                   AKINITSLTVCFLVLVFFCATQDIAVDGWALTILSRQSLSYASTAQTVGLNTGYFLSFS
FT                   IFLAFNSGDFVNRYFRALPLDHGIISFSSYLKLSGWMYLILTAYVVFFTQEYPYAHSGL
FT                   PVVSTKPKDDDEKGHIVTSTTKNSAHIEYNEDSSISKTSLGAVYRSFVKVLRLPAVRSL
FT                   IILHFVSKFPFQCSEGATNLKLLEKGLKKEDLAITVLVDFPFEIIFGYYVAKWSSESHH
FT                   SHQRKLPAFLTLLIGQPGILTPWIIGYIGRLIASMLGSFILSQFPENGNITKGYFLLVV
FT                   TQNLLGSFMSTVQFVGVSAFHTRIADPAIGGTYMTLLNTLSNLGGTWSRIVVMAMIDFF
FT                   TSKVCQNSAIGMFPPEAKCLESGGTLVILRDGYYMTNLLCIGFGLLIFPHIRRKAQHLQ
FT                   SLPISSWRV"
FT   CDS_pept        complement(642594..643673)
FT                   /codon_start=1
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762445"
FT                   /locus_tag="AAR167C"
FT                   /orf_name="AGOS_AAR167C"
FT                   /product="AAR167Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50534.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG450176"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI000025251D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EB0"
FT                   /transl_table=1
FT                   /translation="MSSRFSLVSNLTRSLSSVGRMQQMRFASSKSMTVRDALNSAMAEE
FT                   MDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFAGLAVGAALKGLK
FT                   PIVEFMSFNFSMQAIDHVVNSAAKTYYMSGGVQTCQIVFRGPNGAAVGVAAQHSQDYTA
FT                   WYGSIPGLKVLCPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVSEEVLSPDFTL
FT                   PYTSKVEREGTDISIITYSRNVQFSLAAAEILDKQYGVSAEVINMRSIRPLDIDAIIKT
FT                   VKKTNHLITVEATFPAFGVGSEIIAQIMESEAFDHLDAPVQRVTGADVPTPYAKELEDF
FT                   AFPDPDTIVRAAKQVLSIE"
FT   CDS_pept        complement(644094..645689)
FT                   /codon_start=1
FT                   /gene_family="HOG000229994" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778095"
FT                   /locus_tag="AAR168C"
FT                   /orf_name="AGOS_AAR168C"
FT                   /product="AAR168Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50535.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG519036"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000025251E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA9"
FT                   /transl_table=1
FT                   /translation="MSTFNEAIRCTDSRAVIEPDSGLSLSYRELSHIVGHLQLMFLDPK
FT                   SPLAGIPRQAAIGISLPNGLEFVAAFLAVTMDAKVAAPLNPNYKAEELDFYLEDLQTSM
FT                   ILVPKGSTSAGNTEIQKAAQKWQTMLVELAFSPERNRVEFQVFSPKDNYKSPIYDSVKH
FT                   VARFFNVEPMFPGKPKAEDVALILHTSGTTSKPKTVPLLHRNIVTSMQNISRTYRLSPK
FT                   DNSYVVMPLFHVHGLIGVLLSSFYAQASVIVPPRFSAGRFWADFVKYKANWFSCVPTIS
FT                   QIMLNVEKPSPLPEIRFIRSCSSALAPSTLHQLEEVFRAPVVEAYAMTEASHQMTSNEL
FT                   PPGKRKPGTVGKPQGVEVVILNEKDEVMPQGQQGEVSIRGSNVTPGYRNNPKANQENFT
FT                   RAEHYFRTGDQGFFDEDGFLVLTGRLKELINRGGEKISPLELDAVMLSHPAVNEAIAYG
FT                   VANTKYGQVVHAAVVLRAGQKLDYEGLAAYMKEKVASFKVPERVFFVDKLPKTATGKVQ
FT                   RRMLAEVFSSKSKL"
FT   CDS_pept        complement(645854..647476)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082447"
FT                   /locus_tag="AAR169C"
FT                   /orf_name="AGOS_AAR169C"
FT                   /product="AAR169Cp"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50536.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG058062"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="UniParc:UPI000025251F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA8"
FT                   /transl_table=1
FT                   /translation="MGQSAREAVRARWARVGYTSLGTADKSSVQTKSEAVEVVVLDSEE
FT                   EASTAEDTGTEEAERHNLWPMWLVHSALYDGETAGTAGGNGICGLEVVLGDTDLERVYL
FT                   FSFQYEMNWLLDLIPEHVQVVVTAQKGTVQEADGGRAARVRYRMVWMPPFSSHHSKMVI
FT                   AFYQDQRCRVVLPSANFTALETSLPQQMMWMTPQLAHSRAAEQQPSRFRSGLQDYLQMY
FT                   PEPDRELLQRLRKIDFAPVDATGAAFVYSAPGARTRAKTGLAQLAAQLDEGPAAGGRHS
FT                   HYFCQSSSIGGPLNSRSAENPRNLFVHLMVPLLSGHTQGLPKSVKDCLGEKEAYALLQR
FT                   ERLHPYILYPTVEDFNECFTGWLASGWFHFHHSRTAATRNHYSSLRDNGCFVKQREYEL
FT                   RPGGRTALPIIRRDRVPCHTKFYIKFASASATSWNSLTDCEWFLFTSANLSTHAWGAPP
FT                   SYQPKNYECGVLYTKSENVALRVHCAKDVVYASDSAWSDPEYFDAREGEHITVNLMTPF
FT                   WLPAENYGPTDVAFCASDKPDDM"
FT   CDS_pept        647750..649561
FT                   /codon_start=1
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931069"
FT                   /locus_tag="AGOS_AAR170W"
FT                   /product="AAR170Wp"
FT                   /function="methylenetetrahydrofolate reductase (NADPH)
FT                   activity"
FT                   /biological_process="methionine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50537.2"
FT                   /db_xref="GO:0004489"
FT                   /db_xref="GO:0006555"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068938"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniParc:UPI0001DB2837"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA7"
FT                   /transl_table=1
FT                   /translation="MRISQKLKQRAGAADEEQPKASFSFEFFVPKTLQGVQNLYDRMDR
FT                   MYQTQPEFIDITWNAGGRLSQRTSELVATSQGVLGLETCMHLTCTNMSTALVDEALERA
FT                   YEAGCENILALRGDPPLQGTWEPCAGGFRYAKDLVAHIRARYGDHFDVGVAGYPEGHEE
FT                   ASGAELIGYLKEKVDAGADFIITQMFYDADLFLKWCDAVRAAGISVPIIPGIMPITSYA
FT                   ALLRRAKWCQVRLPPEFLERLEPVKDDDQAVREIGTVLVADMCRKILASGHVTHLHLYT
FT                   MNLERASLMILERLQLIDTGGAGVRRRPSTNETLPWRKSLNPTRRKEGVRPIFWQRRPY
FT                   SYVARTSQWSADEFPNGRFGDSSSPAYGDLDLCGHTVLRQTYQRSLELWSTPRTLLDLA
FT                   ALVISYLKGDLKCLPWSDVPLHQEADALLDSLIRLNEHLVLTINSQPKVNGAPSADPIV
FT                   GWGPANGYVYQKQYLEFLLPKHHLPAFHAALTADFPTLTYFAVDADDNLASNHPDDTQA
FT                   NAVTWGIFPGREVLQPTIVEKASFLAWKDEFYRILDDWRLSFDENGAADSAALLAHLTS
FT                   DYALVNIVDNDFVATADNIYCLLARFF"
FT   CDS_pept        650194..652317
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778096"
FT                   /locus_tag="AAR171W"
FT                   /orf_name="AGOS_AAR171W"
FT                   /product="AAR171Wp"
FT                   /protein_id="AAS50538.1"
FT                   /db_xref="HOGENOM:HBG058063"
FT                   /db_xref="UniParc:UPI0000252521"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA6"
FT                   /transl_table=1
FT                   /translation="MREKAVLAIGDAYEVPWDTVPLAALEARKRASSSQSRKGAGSALK
FT                   RQYGSQSSSASLTSPQRTKYTRRHSASGSSTEPGVRSPLAPVPPAPQEYTGPTRDWNVL
FT                   PQCCGGEHARGPGSTGQDVYSELDNFLLFNLETSTKDALLRARERLSAYIRFLELDYGT
FT                   AGTERLCAACLEATRELVQLWFHQANRLTVRTGTYFIMSEKNMYSFNQNSSRKHDLLVL
FT                   HFRGLCSLGWQVAFDEPNLRVLECNLKPPKEVLEVSDIKTPKSTVTEGVDEPPARELSP
FT                   APIQPVRTRGQEDVESTGHRPSLRDYIERDLEKRGHKSATALLGEQGASPQYEAGNFSS
FT                   NDEYPDSDDYSMMSFESADGNKDIQQKYKLTSAVHAMTTGIAGLFKKRGPHGEVYSRSG
FT                   SSSREQRNSVDRDNTPASVRPSSLPQTWDMIPLGGGPRPAAQAYSADLASHSDPQERKN
FT                   LYIINQWLEECYSKTLYNYDRLEVDLSESRLPYPEASSTEDGKGSAAGSRRQSLAESST
FT                   TTIRLPFESNTFPAIFCPGILYMLTFPQWLPFLNEIKRCMVPGAPVTAVLYDFNDSNMD
FT                   DDGSKVMFPTTLELKKVFQAIRFEAIKRGLQVFPIRNIAPIFRQVGFKNVKYTVLTFKR
FT                   GDFVNEMGFVNELLATFHYDFLVRTFLTDRSKYPVGTDPQTLPRRYIDEHMGQIDDNAG
FT                   CLRLIAITAEKPE"
FT   CDS_pept        652596..653501
FT                   /codon_start=1
FT                   /gene_family="HOG000248775" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931070"
FT                   /gene_name="SLX1"
FT                   /locus_tag="AAR172W"
FT                   /product="Structure-specific endonuclease subunit SLX1 "
FT                   /EC_number="3.6.1.-"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50539.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058065"
FT                   /db_xref="HOGENOM:HBG397296"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniParc:UPI0000252522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EA5"
FT                   /transl_table=1
FT                   /translation="MGDDIGTAGVPAFYCCYLLRSIPKRLSYYIGSTPNPVRRLRQHNG
FT                   LLTKGGAYRTKRQGTRPWELAASVSGFPSKIAALQFEHAWQHPYQTRFIKSEDRIVKKK
FT                   GGGRSIHQRLAVLKLLLHHPFFKVMSLVVHLFSEDIQRVWFLDKYKLEAPFIHVEVDED
FT                   ALSEPTGEDEESVIEHAKKNLRLVELFYGRSLKEDSECLEEYRRRLQNGAMRCAICEKI
FT                   VDYVKDSDSFSSEKELVAFCYNSVCDYFSCLSCLYNVFASDEELRTGEIPLIPTSGQCP
FT                   NCNIELSWARIVRYSMFLSA"
FT   CDS_pept        complement(653624..656362)
FT                   /codon_start=1
FT                   /gene_family="HOG000115864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625545"
FT                   /locus_tag="AAR173C"
FT                   /orf_name="AGOS_AAR173C"
FT                   /product="AAR173Cp"
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50540.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG020925"
FT                   /db_xref="HOGENOM:HBG315035"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0000252523"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA4"
FT                   /transl_table=1
FT                   /translation="MHWNRILFWGCALLLQQLADAFDEGVLRKCNESGVCHRNRHYGEK
FT                   IASSGAVYYTVDWDSLELFTSGHTVQGKITKRLPRGKDKGSIALPFTLDVLENSLVRLR
FT                   IDEDRDVTGLPEILSPRRYNGTSDWMFEDGVVLRASACNQSTAIVGDGKKMVIENSDDE
FT                   VKVELFQNPFKLDVYHHDKLLVTINDRSFLNLEHWRLPRTNYQNSLPEESDYDSFYDNF
FT                   HGAGNDTLPFGPESVALDVTLHGFKNVYGIPEHADSLKLRDTSGGEPYRLFNADCFEYP
FT                   VKSTSPMYGSIPLMVSHAPHSSVGLFWVNSADTWIDVNYSENNVKTHWMSEAGVLDIII
FT                   LLQESPAKVTESYTNITGKPAFPPISALGYHQCRWNYNDEQDLMTVNNEMDKAEMPLDF
FT                   LWLDIEYTDEKKYFTWKKDAFPDPLGLFQKLANITRNLVTIIDPHLKLNYNLTDIMVAN
FT                   DGAIKNSTGQPFIGECWPGTSIWIDTFSPVAKNLWASFYHNFVEGAKNLFIWNDMNEMA
FT                   VFDGIESTAPRDAIVHGGFEHRAVHNLYGMTVHQASYQGLRERYAEDNKRPFLLTRSYS
FT                   AGSQRTAAGWSGDAVGTWDYLKITIPIILANNIVGMPFFGGDVPGFTGDPDPVLTVRWY
FT                   QAGMWFPLFRGHGHKDTKRREPYLLEEPYKSIVRDVLRARYALLPTLYTAFHESNATGV
FT                   PIINPMFYEKPDLEEAFDIDDQFYLGRSGLLVKPVVNNSTTTTVFFPPGRYYDYFTLET
FT                   FAITDAKRLTIDTPLSKIPAYLESGKLIVTRDRYRRTTKLMERDPYTLVVAPDDENKAY
FT                   GVQYIDDGATFAYQDGRYVKVEYSYFESGMSAKILKTTDELKDLMIEKIVIAKHPSFKL
FT                   PGICVFKQEQATWTARITEDENKYTIHNSGVKVGVEWSIKF"
FT   CDS_pept        657572..658954
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762446"
FT                   /locus_tag="AAR174W"
FT                   /orf_name="AGOS_AAR174W"
FT                   /product="AAR174Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS50541.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058066"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI0000252524"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA3"
FT                   /transl_table=1
FT                   /translation="MQNLILTPPNISSPALSNVCSINNLVGDGSSNPTASTSMRATPVL
FT                   PPVKGLLFHNNQLPPPGPFNYGSMANSALPHGLPAGAKYEQMTPPPLFHSRSVPPQMPS
FT                   AQPQAAQPQRFANPFDQLSQLLTHIESSSSSSLKVITGHLMADKIIRDNGDYSLQLKEI
FT                   FGSLREIHLSLLNWPMVQYSQDIPNGEIMRELVSFIEYRDLEKLDFLIDKFKRQLDLVK
FT                   YWKDKLGHLYVEKIDSGTWCSPGERLRQENGTPIPVIHSAAVGSSASRLASPSPSVSTG
FT                   PGVIQGGSTATSSRSVSFSIPAEERVGYIPEHVGEFRNDFFQDLIVPSWFIVIRDPKTM
FT                   NCLQCGSRDTSEWRSGPLGRKSMCNACGIWYMKLKQRFGEEDAAVIMEYRRLTNRHDDR
FT                   RVPKKFEVPLPEVEKVKRAIRARVVEYLNDVEIPVKTRRRALLHKGKPGSALKTEMKTP
FT                   AA"
FT   CDS_pept        complement(659159..660904)
FT                   /codon_start=1
FT                   /gene_family="HOG000113629" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762447"
FT                   /gene_name="MON1"
FT                   /locus_tag="AAR175C"
FT                   /product="Vacuolar fusion protein MON1 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="multivesicular body membrane "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS50542.2"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0032585"
FT                   /db_xref="HOGENOM:HBG124610"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniParc:UPI0001DB2838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75EA2"
FT                   /transl_table=1
FT                   /translation="MSTSGSRDSASTRESARETRAGPQALPLGSVVSLSSMRSASPTHA
FT                   PWVAKPTTSVDLTNHFMEVAARGGEEERSLASPGEEMQYELAHSMKAAPALPRELPSPF
FT                   RAAGGRGALPQEKQFFVLTAAGKPIYSMHGPEELVMGLMGIAHTLLNYFELDGPRERLR
FT                   TITTYDAHGVLQRFAFLRKKHVVLLAMTTRNEAEAELQQQLDLLYSYLVSSLSLRQMSR
FT                   LFERANFDLRSFLTESDFHNLDQLCRAMCDGTHLGWTLGALECITLKHSVRQRINSIML
FT                   RATRGLAVGTLLYGMIVAPDHRLVSVLRPKGHTLHTTDLQLLFSMVENQLQLLHSSQEV
FT                   WVPLCFPKFNGNGFLYCYIKFLPTDTDSASNETTLEGNMHIKPTLILISPQKSSFYDLH
FT                   TCASEILDNLAVAGIMPHITAPSRFTINDIPAPLVHHFIYKSKKYVQYVMPETSSTTDW
FT                   STLMKYYSHLRSNALDSHGNPLSENVVAFARWCASSGQVQVEYCDSSEELQVEDQPSSI
FT                   FSESFVEESLNMTGLSWITPSFELYLLCNNGEIPKAVVMKSARNVVGWCSRNGHKLFVS
FT                   EGAVF"
FT   CDS_pept        complement(660987..661448)
FT                   /codon_start=1
FT                   /gene_family="HOG000144427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931071"
FT                   /locus_tag="AAR176C"
FT                   /orf_name="AGOS_AAR176C"
FT                   /product="AAR176Cp"
FT                   /protein_id="AAS50543.1"
FT                   /db_xref="HOGENOM:HBG058067"
FT                   /db_xref="UniParc:UPI0000252526"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA1"
FT                   /transl_table=1
FT                   /translation="MSDNKIDESIDKARSGAKNLIDKASDGSKKLAKDAKKGLEKGESE
FT                   LQRAAERVGEWLSGAAAGTWDVAAKTAGAARDVASKVFVELQNPVVAVNAVLGGGALMA
FT                   WLHGYAEHQSRYLQGKTDRAILATVGGVAALVAADGLLSYKYYRQFDRK"
FT   CDS_pept        661912..662667
FT                   /codon_start=1
FT                   /gene_family="HOG000072596" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931072"
FT                   /locus_tag="AAR177W"
FT                   /orf_name="AGOS_AAR177W"
FT                   /product="AAR177Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS50544.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG299153"
FT                   /db_xref="HOGENOM:HBG386975"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005711"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0000252527"
FT                   /db_xref="UniProtKB/TrEMBL:Q75EA0"
FT                   /transl_table=1
FT                   /translation="MSAPEQRRGGFGARNKGRQGRKGRREVEEKGWVPVTKLGRLVKAG
FT                   KVTSVEEIFLHSLPVKEFQIVDTLLPGLKDEVMNIKPVQKQTRAGQRTRFKAVVVVGDS
FT                   NGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGSNLGQPHSLATKTSGKSGSVT
FT                   VRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTSSTGSTRTLENTLKAAFVAIGNTYGFL
FT                   TPDLWPENQLPASPLDVYADEAVAQKKRF"
FT   CDS_pept        complement(662992..664452)
FT                   /codon_start=1
FT                   /gene_family="HOG000246536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082448"
FT                   /locus_tag="AAR178C"
FT                   /orf_name="AGOS_AAR178C"
FT                   /product="AAR178Cp"
FT                   /protein_id="AAS50545.1"
FT                   /db_xref="HOGENOM:HBG058068"
FT                   /db_xref="HOGENOM:HBG204283"
FT                   /db_xref="InterPro:IPR021083"
FT                   /db_xref="UniParc:UPI0000252528"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E99"
FT                   /transl_table=1
FT                   /translation="MSAIQDDISGSLKTVVAEKLKTLQNFSEDVNYVAEYIVLLLSNGG
FT                   THDSVLQELVGLFDSVPQQALADVVQTSFQALQLLRSGDNIETVYQKLTNPGMMAPEPP
FT                   AEAMSVSAPSEPSVSTEATSMPRSAFEGMVDLSASKYATKNPTSSRGGLKRGGKQGGIN
FT                   KSASGPRKGNQQTGGKHRMNALARALGMEGEDAANNAQVNIIPKKEGRCQLFPRCPLGK
FT                   FCPHAHPTKVCRDYPNCPNAPGTCEYLHPNEDVELMKEIEKTREEFREKRIALAQSRAK
FT                   PIQTGIVLCKFGIMCSNPMCPFGHPTPANEDAKVIQFIWCPQNLTCDKKDCDKAHSSLS
FT                   KIRDVQPIAAAPRPSKPAAFAPAERSLEQCKFGVKCTNKRCKYRHARSHIMCREGAACT
FT                   RIDCFFGHPINEPCKFGAECRNAHCLFQHPPGRSLPDKSQAATGAPSWPAHAAGGNQSA
FT                   NERPYAVAESAGIEQAPIQESDGDATMA"
FT   CDS_pept        complement(664695..665456)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778097"
FT                   /locus_tag="AAR179C"
FT                   /orf_name="AGOS_AAR179C"
FT                   /product="AAR179Cp"
FT                   /protein_id="AAS50546.1"
FT                   /db_xref="HOGENOM:HBG058069"
FT                   /db_xref="UniParc:UPI0000252529"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E98"
FT                   /transl_table=1
FT                   /translation="MFEKDEILPLDEARSQKIKEFLSLSLGLITESIEKKEYDSIARSV
FT                   SVLNMQLGLTELEEILEDRIVDFYTEHRLLQDAMAIYEPAMIHALVDRVSKLREKYYDP
FT                   DTQAVDPSSPDFDLINLLNMQSLIMMRRSRRLYEKIAGSYNRLIAVDLTLDDFETIVHR
FT                   YRDGLMLLKSINLEMVYFVPYCKHFENITIFVKEFGTGLTNINEKYKSAYRFLVQARNY
FT                   QRKIRRVSLDSLIDGMRKKCESMGNKRQGLA"
FT   CDS_pept        complement(665685..667985)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762448"
FT                   /locus_tag="AAR180C"
FT                   /orf_name="AGOS_AAR180C"
FT                   /product="AAR180Cp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS50547.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000025252A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E97"
FT                   /transl_table=1
FT                   /translation="MAKRRLSSEGHADPVKTSVPEHAAEVAEELSATHRQTPVEPMVHH
FT                   DAGEFTDMERHKTTASQARQLEDGENNPFTGKPFSENYVKILKVRRDLPVHAQRDEFLK
FT                   MYQENQVMVFVGETGSGKTTQIPQFVLFDEMPHLRNTQVACTQPRRVAAMSVAQRVAEE
FT                   MDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLKRYSCIILDEAHERTL
FT                   ATDILMGLIKQVVLRRPDLKIIVMSATLDAEKFQRYFNNSPLLAVPGRTHPVEIYYTPE
FT                   FQRDYLDSAIRTVLQIHATEGEGDILLFLTGEEEIEDAVRKISLEGDQLIREQGCGPIK
FT                   VYPLYGSLPPHHQQRIFEPAPASHNGRPGRKVVVSTNIAETSLTIDGIVYVIDLGFSKQ
FT                   KVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKELIEQSYPEIL
FT                   RSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLA
FT                   SQFPLDPMLAVMLIGSNEFHCSEEILTIVAMLSVPNVFVRPSKDRKRADDAKSVFAHPD
FT                   GDHITLLNVYHGFKSDEAYNYGIHQWCRDNFLNYRSLAAADNIRSQLERLMKRYSLELN
FT                   TTEYDDPRYFDNIRKALAAGFFMQVAKKRSGGKGYITIKDNQDVLIHPSTVIGHDAEWV
FT                   IYNEFVLTTQNYIRTITSVRPEWLIELAPAYYDLDNFQKGDIKLSLERIKQKMDRIEEL
FT                   SKEQSKKHRQSRA"
FT   CDS_pept        join(668342..668626,668680..670026)
FT                   /codon_start=1
FT                   /gene_family="HOG000201140" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762449"
FT                   /locus_tag="AAR181W"
FT                   /orf_name="AGOS_AAR181W"
FT                   /product="AAR181Wp"
FT                   /protein_id="AAS50548.1"
FT                   /db_xref="HOGENOM:HBG310934"
FT                   /db_xref="HOGENOM:HBG381628"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000025252B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED5"
FT                   /transl_table=1
FT                   /translation="MGTRESLYHAYRVLISSKDVFCGSVDIARESFYIWASTSSLTRPL
FT                   LSKSRWFHDPEWNRARQLSDKTRQEAAGQLRRNASAPRGTRQYSTSSKRNEDDAEVRHM
FT                   ESSSVPSSRISRLFHYGSLAAGVGISAASQGLSQMSRGQSPTLKSLLLSDTNIARITKK
FT                   FSQMRGAALKIGQMMSFQDSKVLPAELYQILSRVQNSAHYMPQRQLDRLMARELGVEWR
FT                   NKFASFENVPIAAASIGQVHKAVLPNGDDCVVKVQYPGVKDSIDSDLNNILVLLTASSL
FT                   LPKGLFLEKTVANAKTELGWECDYIREATALKHFEKLLADDSVFVVPHVYDSLTTPNII
FT                   VMSRMRGTEIMKLPADVASQEVRDFICENIMRLCLKEIAEFKYMQTDPNWANFLYNPTT
FT                   RKIELLDFGASRGFPDEFIRNYRKLLTYATQGDREGVHQMSEQLGYLTGLESRAMINAH
FT                   VDSVMTLGEPFSGEVDKTFDFSDQDVTDRIRGNIGLMLNERMCPPPEETYSLHRKFSGV
FT                   FLLCARMGARVHCAKLFDEIFALNEK"
FT   CDS_pept        complement(670194..670997)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931073"
FT                   /locus_tag="AAR182C"
FT                   /orf_name="AGOS_AAR182C"
FT                   /product="AAR182Cp"
FT                   /protein_id="AAS50549.1"
FT                   /db_xref="HOGENOM:HBG058070"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000025252C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED4"
FT                   /transl_table=1
FT                   /translation="MLSTSYGSLQRHNKECFAPASSSKGTLRSCVEFTDPFSPMSARSP
FT                   DWSVRNGSVSGVELPDSPELANSDYHAYSQSTLPTPVNSSPVAPISKGFGMQPSLYPYL
FT                   APMTVVAPQEGEPITSTIGPFTVSMPLPESVGTCNPSMSPVRCLITPLGENKIISYYEL
FT                   SPMARVIKQIEDINKQLLYYFSEENLPRDPFLRDRMDPEGFVDIDTFLQFPRIVSMTRD
FT                   LPNRLQKLVVLVNAFKCSEPDVFEIRHNSKVRLRVSWDRWVQKYS"
FT   tRNA            671647..671718
FT                   /gene_name="tRNA-His"
FT   CDS_pept        complement(672065..674011)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762450"
FT                   /locus_tag="AAR183C"
FT                   /orf_name="AGOS_AAR183C"
FT                   /product="AAR183Cp"
FT                   /protein_id="AAS50550.1"
FT                   /db_xref="HOGENOM:HBG058071"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI000025252D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ED3"
FT                   /transl_table=1
FT                   /translation="MVQSPSIAILVAWGLQCKGLPDAILRTVIALLLATDRSGMVSYGL
FT                   MGNFSKKMVHRGMGRWRFRGHRWSLRYIRICVRTVMVFSMLALVLQYSGKILVASILHN
FT                   SVRPSSKTPLHTVHAVEQLQFGRWPLEKKCQWYFAKEKRQQWLNEIIERSRGRMKDASV
FT                   TAAMLERLRVFDTCFMQGDIGLREVFGEDINLYSLHHELFPFLKKVRDWSELLPQVLDL
FT                   NDGSRYLLGNKLPEQAFKVDNDLPFWENLRRSSSGRGIVATVADIHLDQLKRLLHVLDE
FT                   LGNKLPIELVYKGNDFSRLPIKRLKRYVRQHTKQRVRLVDCSRVLRSTHIPKIKRFMNK
FT                   WLATIFNSFEEIILLDVDVVPLVPIDSYFKLPGYTKTGALFFKDRTLPEYLPVSCTKAI
FT                   LLLPPSSEENKLWGHSMRYRTPMTKAGALDRTNSAETEVMYNYFIERYRHQVETGLVVL
FT                   NRKQRLFSLVTSFMIHLNLRFSECFHGDKEVFWLGQLLTGNEYSIHPMPAAIIGELQQG
FT                   ERKLAATEYRICSTQIAHPDTDGTVLWINGGMWNCKDNKAAEEDFSDYNRYFTRKFGSQ
FT                   QKLADWYKQTLKVTGVFSPELKNSKWIPAKECKQSAFCSSVFVHDDEELQSLKDADISV
FT                   CNHLASVWGSLPE"
FT   tRNA            complement(674092..674163)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        674621..677131
FT                   /codon_start=1
FT                   /gene_family="HOG000001029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778098"
FT                   /locus_tag="AAR184W"
FT                   /orf_name="AGOS_AAR184W"
FT                   /product="AAR184Wp"
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="AAS50551.1"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG124420"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI000025252E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E96"
FT                   /transl_table=1
FT                   /translation="MEAARGVTATEAGQSTGEARAGPCREPVAPGLTGAAHVIHGRKAS
FT                   TYLGIFDSPPPPDGSGKSGKAGKTGKKVLTGASGDEGVTAAEDPWKKKKKKKREERESE
FT                   WGGAKLAALASEAQHDLELYTQRSSAIVSSHESLGKPISSATYFPHKYKEDASGGVAGQ
FT                   GRKVLSVELDSEVSSLSASDEEAIEDSEEDEEDEKSDGNRTQEDEFEDDDERDVISSSE
FT                   TREFPLKVELQPFTDNVGGHTAIFRFSERAVCKALVNQENSWYETIELKHPDLLQFMPR
FT                   YFGVLNVRQHFTSKGEFLNSIQAKDRKVADIGNPPPSPDNVEAPATPRLEPLHHTTSLP
FT                   LVEENPLPEVCLNDNKHIIPDSLWSKYSHSPSSLPSQESWAAKSECLVNSNTQGRTGND
FT                   TAGHSSYPTGSTLINTRLKELIIEEVFGQSSNRTQQPIFHDNHAHQHRNFRNSSIPIDK
FT                   NSGDTMRIQSSDCLTNFPKSKQSRSSSTSSSTANKFISKKKRHDSHNSLVDLREMHRGL
FT                   YCGPENELFKLEDDLSLTASVPNSPQSKSQHESVSYEEHSHTVVSKFILLEDLTRKLNK
FT                   PCVLDLKMGTRQYGVDAKRSKQLSQREKCRNTTSRKLGVRICGLKIWNKDYYITRDKYF
FT                   GRRVRIGWQFVRVLARFLYDGVSRRSILKQLPCLVRQLETLYSEAIKLKSYRMYGSSLL
FT                   LMYDGNNPSSKRCKVKLNLIDFARCVTKKDIDTSIGTFRIPPKNPELEDRGFLRGLRSL
FT                   KFYLLVIWNHLTGDHPLVYDEESLQEFLDSDDSFQKPWDWIEEFDKEDEARVHDPNDEL
FT                   RKKWRKYELIFDVEPRCADDDVSE"
FT   ncRNA           complement(677462..677544)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR161"
FT                   /product="AgSNR161"
FT   CDS_pept        677746..678090
FT                   /codon_start=1
FT                   /gene_family="HOG000001028" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762451"
FT                   /gene_name="DAD1"
FT                   /locus_tag="AAR185W"
FT                   /product="DASH complex subunit DAD1 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS50552.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG192133"
FT                   /db_xref="InterPro:IPR013958"
FT                   /db_xref="UniParc:UPI000025252F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E95"
FT                   /transl_table=1
FT                   /translation="MIMSKDIATTPELSEPDKYFVEQRDLLLQEITSTLDSILNNLNGL
FT                   NISLENSIAVGKEFESVSELWKVFYDGLANGAAPGVAAANPSSQDLPTEPVAAHQNAAA
FT                   GNSDAPAPSQ"
FT   CDS_pept        679183..679851
FT                   /codon_start=1
FT                   /gene_family="HOG000242755" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778099"
FT                   /locus_tag="AAR186W"
FT                   /orf_name="AGOS_AAR186W"
FT                   /product="AAR186Wp"
FT                   /function="FMN binding"
FT                   /function="pyridoxamine-phosphate oxidase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="pyridoxine biosynthetic process "
FT                   /protein_id="AAS50553.1"
FT                   /db_xref="GO:0004733"
FT                   /db_xref="GO:0008615"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG050207"
FT                   /db_xref="HOGENOM:HBG327559"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniParc:UPI0000252530"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E94"
FT                   /transl_table=1
FT                   /translation="MEEQPIIFAPETFQYDKSSLSVEDVVADPIDQFTMWFEDARKDPT
FT                   EDIPEAITFSTAELPSGRVSSRVLLFKELDHRGFTVYSNWGTSKKAADVRSNPQAAIVF
FT                   FWRNLQRQVRVEGIVEHVSRATSERYFKTRTRGSKVGAWSSLQSQTLADRKELEDRYKA
FT                   NEARFAEEEDVPCPEHWGGVRVVPLEIEFWQGRPSRLHDRVVYRRKTEHDDWEISRLAP
FT                   "
FT   CDS_pept        complement(679901..681586)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931074"
FT                   /locus_tag="AAR187C"
FT                   /orf_name="AGOS_AAR187C"
FT                   /product="AAR187Cp"
FT                   /protein_id="AAS50554.1"
FT                   /db_xref="HOGENOM:HBG058072"
FT                   /db_xref="UniParc:UPI0000252531"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E93"
FT                   /transl_table=1
FT                   /translation="MPMKVYGRHGRYNRLVTTFGKTHGEEDSWFSSDDENHGRPVSDDT
FT                   TKLSLSQDRCSELPEETIGANRKRPAERTQTDPVWEFLERPASGQKRRRRATCDSTEYR
FT                   ESASQEFLNAVNVVQGIVSSLKPAKEVVEHWAELEDVPEDRGNNGQAVYGKTRTMLAKA
FT                   EEDSDTEAAAHESDERAAQGDEALSRHFNELRTMGETLKYSEDLDFILSDNSMTTPEHR
FT                   RNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLR
FT                   HDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYALYIWAT
FT                   YLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAG
FT                   LSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKT
FT                   NLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSA
FT                   GAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL"
FT   CDS_pept        681721..682332
FT                   /codon_start=1
FT                   /gene_family="HOG000192102" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625546"
FT                   /gene_name="PSF1"
FT                   /locus_tag="AAR188W"
FT                   /product="DNA replication complex GINS protein PSF1 "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50555.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG359786"
FT                   /db_xref="HOGENOM:HBG597497"
FT                   /db_xref="InterPro:IPR005339"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="UniParc:UPI0000252532"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E92"
FT                   /transl_table=1
FT                   /translation="MYGDVANKLVLEAKRTDHLANGSATLQLPMFQDEMVRVILKEVSQ
FT                   LQRNAEYLKLQEDSGKLSKCQYFVTMLCMERNKRCLLAYQKTRSEILDAIAWENNGLDT
FT                   MDLLSNKGHDSGNLSPYEQEYLREYSQLISDLTAGELMDIDLAGSLTPPSDVFIDVRVL
FT                   KDAGEIQTEYGVFNLIKDSQFFVRQADVERLIQQGYLQKL"
FT   CDS_pept        complement(682327..683511)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762452"
FT                   /locus_tag="AAR189C"
FT                   /orf_name="AGOS_AAR189C"
FT                   /product="AAR189Cp"
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAS50556.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058073"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="UniParc:UPI0000252533"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E91"
FT                   /transl_table=1
FT                   /translation="MRVDYEQLVSQFPRLKQYWDDGRYHIANNESLVLLNQAILKQYFG
FT                   LEILDKRVKDENLFPRVPGRALYCEYVATSLVWPLLWLSGATSYSCIDVGTGAYAIYAM
FT                   LLVKMLPHTVQVFATDISTSSLENAAAVVRDNGLESQIRLLRKGREDNMFDVGLAGGAP
FT                   LLVMCNPPFYATRDEIEARRHSKTLTKALVPLRGTDEELVTEGGEVGFGKRMITDSSLR
FT                   TSETPAWFTTLVAKYESLAPLVAELIQSRATDYHVVELLCGDTRRWILCWNFNNMKALN
FT                   LCRQLPAFSKHTTVRKVRVRAELQLGWLGEQIVRECSGRLEYRDVGNGRLFIRAPNGAV
FT                   WTRRYRRNRTAREEPSAFVLVLDTSGMRVHWLEGSDPKTFQSFSCFVERVSAKL"
FT   CDS_pept        683689..684729
FT                   /codon_start=1
FT                   /gene_family="HOG000198521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778100"
FT                   /locus_tag="AAR190W"
FT                   /orf_name="AGOS_AAR190W"
FT                   /product="AAR190Wp"
FT                   /function="protein methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50557.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG146248"
FT                   /db_xref="HOGENOM:HBG715060"
FT                   /db_xref="InterPro:IPR010456"
FT                   /db_xref="UniParc:UPI0000252534"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E90"
FT                   /transl_table=1
FT                   /translation="MANITASATDKSSLNEYEQHYFNSYDHYGIHEEMLQDTVRTLSYR
FT                   NAIVQNRDLFKGKVVLDVGCGTGILSMFAARNGAKHVIGVDMSSIIEMAKKIVDINGLS
FT                   DKITLLRGKLEDVVLPYEKVDIIISEWMGYFLLYESMMDTVLYARDKYLVEGGLIFPDK
FT                   CSIHVAGLEDVEYKNEKLNYWQDVYGFDYSPFMPLVMREPLVDTVDNASVNTTRSKLIE
FT                   FDLNTVTIPDLAFKRKFSITAKRQDFINGLIAWFDIEFPAPEGMRPITFSTGSHAPYTH
FT                   WKQTVFYLSDDLEAENGDVLEGELTCTPNKLNSRDLDIKIAYNFKAQGPDGEERSRKNE
FT                   NTYLMH"
FT   CDS_pept        complement(685550..686722)
FT                   /codon_start=1
FT                   /gene_family="HOG000107331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625547"
FT                   /locus_tag="AAR191C"
FT                   /orf_name="AGOS_AAR191C"
FT                   /product="AAR191Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50558.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG055795"
FT                   /db_xref="HOGENOM:HBG316531"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="UniParc:UPI0000252535"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E89"
FT                   /transl_table=1
FT                   /translation="MPDRGHRLVDSSISSFGSFLHHHHEQVMSRPQVTVHALTGESSSA
FT                   ALPLPAVFSAPIRPDIVHSVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRV
FT                   GGGGTHRSGQAAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAASAVASLVL
FT                   ARGHRVEKIPEIPLVVSSDLESIKKTKEAVAALKAVGAHSDVVKVLKSKKLRAGKGKYR
FT                   NRRFTQRRGPLVVYAEDNGIVNAFRNIPGVETANVASLGLLQLAPGAHLGRFVIWTESA
FT                   FAKLDQIWGSESVASAKSGYSLPSNIISTSDVTRIINSSEIQSVVRPAGQATQKRSHVQ
FT                   KKNPLKNKQVLLRLNPYAKVFSAEKLGSKKAEEAKKIQPSQTFLETLKHD"
FT   CDS_pept        complement(686856..688358)
FT                   /codon_start=1
FT                   /gene_family="HOG000259757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931075"
FT                   /locus_tag="AAR192C"
FT                   /orf_name="AGOS_AAR192C"
FT                   /product="AAR192Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS50559.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG293363"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252536"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E88"
FT                   /transl_table=1
FT                   /translation="MGKVGYYLKTRVTELFPEKRPSWEEFKYTMNPANVLSNVKLKTWL
FT                   FIASAFLALTVEATDFFLVSLNVVKIAEDLHVREDKVTWGITVALMTRTIGAIVYGYVG
FT                   DRFGQRTSFLINIGMISVLQLVTGFATSFPYFLACRAYFGVELGGCFGTATTQCLDDLP
FT                   KSAHSWVTGGFQQAYAFGFLLATVLTRALADTTAPGWRSCFWFLSGVSFLSFVFRACLG
FT                   QTEAFKERQRIKEEGRKRNEKVSTLSQILRSLKKEWYIAIYMVCLMAGYNFFSHASQDL
FT                   FPTMLLKQLGYSSNQSTLTNIMANVGALLGGLLLSRFSSVSSRRFIILMCVFSAAILVY
FT                   PWGFVQGSGMTAYAFLLQFFVQGAWGLVPYHLHSLAPDSQTKAFFVGVAYQMGNLISSP
FT                   SSTMESSIARKFPIGHDANGKTIYDYGRVMAYFVWGSTALMFIFVFLGPEFNPNRAHEF
FT                   IDDIESVDEQVHEVVEDKVEASPSIQSQTSSLSVSKRIHHTV"
FT   CDS_pept        complement(688662..690179)
FT                   /codon_start=1
FT                   /gene_family="HOG000142026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778101"
FT                   /locus_tag="AAR193C"
FT                   /orf_name="AGOS_AAR193C"
FT                   /product="AAR193Cp"
FT                   /protein_id="AAS50560.1"
FT                   /db_xref="HOGENOM:HBG058075"
FT                   /db_xref="HOGENOM:HBG204125"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI0000252537"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E87"
FT                   /transl_table=1
FT                   /translation="MSATQQADVDDILSFVQESGGRFLRPQCSIQLSPEGGLGVFAAED
FT                   IAANTVLLRVPKSAVFSAPNSSIANLLLEEGLHGMLALVIAFIYETTGFRNASHWCKYL
FT                   HSIRYTDARGNLVLPPSFWPAKSKHPLRVTALNTLHHALDAEPEVVDGYERAVACAYKW
FT                   RTEADLPIPPLLRRPETDDQRTRGLRRFVAVTYALASRAFDIDDFHGNGLVPIADLFNH
FT                   HVTRPHVRFEAAADVCVICGESGPCGHSHTGLQAESQPLLPNAELCVREPVERPVSLTA
FT                   KIQEDHAADTSTGTPPEASWLSFPADDCVDIRAVADIRRDTEIYNTYGELSNPLLLARY
FT                   GFRVLHNPHDVAHFAPEVRRLCNQGGQGLVSRLRWWQQTGYALYCKVTGASDDGDSWQD
FT                   AVYADSSGEPSPALWALAELLSGAGNGWRMMRRSPVTAASVWSRRNANGGRNRRALTVL
FT                   RRLAALKRALLLAALPERHSMGTELLEDEISIVNRLLEKLGRSRKAL"
FT   tRNA            complement(690282..690354)
FT                   /gene_name="tRNA-Lys"
XX
SQ   Sequence 693414 BP; 167767 A; 179528 C; 180320 G; 165799 T; 0 other;
     catacaccac accgttgaga gacccataca ccacaccgtt gagagaccca tacaccacac        60
     cgctgagaga cccatacacc acaccgctga gagacccata caccacaccg ctgagagacc       120
     catacaccac accgctgaga gacccataca ccacaccgct gagagaccca tacaccacac       180
     cgctgagaga cccatacacc acaccgctga gagacccata caccacaccg ctgagagacc       240
     catacaccac accgctgaga gacccataca ccacaccgct gagagaccca tacaccacac       300
     cgctgagaga cccatacacc acaccgctga gagacccata caccacaccg ctgagagacc       360
     catacaccac accgctgaga gacccataca ccacaccgct gagagaccca tacaccacac       420
     cgctgagaga cccatacacc acaccgctga gagacccata caccacaccg ctgagagacc       480
     catacaccac accgctgaga gacccataca ccacaccgct gagagaccca tacaccacac       540
     cgctgagaga ccgcgcagcc ttgtgcgtct gcgtgccaat gccccggcgc ctagttgtcc       600
     ggagtgtgct gtcccagagt gtgcacgctg ttcccatcgc ctctccttct gcgcgcctct       660
     gtctgtcttc gtatctgtct ctgcctctgg cgcacgtcgc aagcccggtt tctaccccat       720
     tgaagtactc cacccgtgca ccctaggaca ccgggcgctc tgcccgcatg gcttcggcgg       780
     ctatttgtcc cgcactacgt gagaatctca gaaggcagac tgtgagtaaa tctctgtgga       840
     gacactaatc tgcagctggt ggcttggcgt gcattctgct gcggggtcac gcgacacctg       900
     agcccctgcg acctccttta atggtccaaa tgaactgtac actattccag cacgacagga       960
     cggctttttc atagccttgg cacggagagt cagtcttgaa cttagaacga cactttcgcc      1020
     tcgaaatttt gttgtgtaat aaggtatagt ttgtcataaa acctatgtat agacatcaga      1080
     tgctacataa ttggagtgca accgatttct ccgctgttca ccaataccaa cagcgttccc      1140
     ggatatattc ttcgctctcc ccttcacccc gcaattcctc aacacagtcc aaagacaatt      1200
     cgcgggccca gacggcactg actagcattc cagttaaagc tacaagctgg aattttctca      1260
     tagttatttg ctattagtta tcctgtttaa agccaagcgc cgccatttta ccgcgcaccg      1320
     gtccctttta tatcattagc gagccgttga ccagcatatc tttcttatat tcattgctcg      1380
     tcaatcgtag gcttatcact acaatgctta tcccaaaggt tggagtgata taagcctttt      1440
     atttgctgga ttatacgtaa aggtacgctc agattttcgg aattgcaacc gggctacacc      1500
     ggcgtgcagc tgcgtcccgc aagccatgtc agggtacggt aagatggggc gtgggcacat      1560
     gccaggcctg caacgtccat tccttgactg agcacgccac tcatcgaaaa gcagaaggtt      1620
     gatcaagtaa acgatactgc tctgacgcga tgccagtaca tacagaacat atgcttgtta      1680
     ttctgctacg tctgccatgt tgctttctgt aactgcgtta tggccacggc cttgcaacta      1740
     ccccaagatg aagattcggg gaagctcact tccgtcttcg aaccttatat attttgcggt      1800
     tgcatgtatt ttgggttaat ggcacagacc atagcgccgg ctgggcgcct gatgaatgga      1860
     tggaagctca cggctttggc actatgttca atatacctga taatatttga tccagagtta      1920
     ctatatgtta gtggttgctt attaaacttc tttccatcag ttaagtcttg gtctctggat      1980
     gctattgcaa aatattttat ttgggaggcc tgtgtattgt actcgattgt agcttgggtt      2040
     ccggtagctg caaacttcat actgatctgc aaatatgtgc tggctgaaga gagagcaatg      2100
     gaattgtctt tgggagctta tttcgatgag cccgacaatg atgctatgtt agagaacgag      2160
     tctttttccc tgaaacgcgc tagagtggtt cataacctaa aaatcatcaa gatggctgtt      2220
     gctggcatct tattcattca cttacttttg caagtattct tgtttatcat tgcatacccg      2280
     gcctcggttc taagtgaagt ttctggcaag tctggactgt acgcttacct acttgtggga      2340
     ctgctattcg ctactgtggt aagattgctt tccatactgt tctgcatttg ttacattttg      2400
     gttacatcaa actgcataag attcttatca agcatgatac tctttgtatc cgtagtacaa      2460
     agcgattttg ttatgggagt ctgttgcagc tttatacttt ccaccgtcag ccttgtgggc      2520
     tgacaaaata atgctatatc cactacacat gatctcaaac atggctctgg ccgtccacca      2580
     taggacgcgg ggctaagcgc ggcaagacgg tttattcgta gcctcggctg acagagtcag      2640
     tcttgaacct caacggcctt ttctgcctag aaaatctagc tctgtcatag gaaatagttt      2700
     tcatattaaa taaccctata taactgtttc agatgctaca gatttgaagt gccaccgact      2760
     cgtctgcagt tcaccagtac ctgcacattt cctgaataaa ctcttcgctc tctcctctag      2820
     cctgccaaaa tgcgatgcac tcctctggcc catcgctggc acagacgctg ctgactaaca      2880
     atccagtcga agctacaagt tgggagattc tcatatttct ttgctagtgg cttaccgtac      2940
     tacaaccagg agcagctatt accgcgcctg tcccttttat agtgttagcc aaccgttgag      3000
     cagcacatat cctttgtgtc cattgctcgc ccatcatagg cgtatccgtt acacttctct      3060
     ctccaagctt ttggagtgcg atgtgtctct tatcttcgag acgcatactc cggaaaagct      3120
     agccgccctg cctctgcccc ttgtccggcg agtcctaggt aaatgcaccc ggacaccata      3180
     ggacaccgtg cgcgtctgga ttcaggaacc ccactgcata agaatctggt aagcggcctg      3240
     tgcggagatc tctgtggaga caccactctg catctggacg cacccgcacc ccataggacg      3300
     cggggttagg cgcgacaaga tgtttttccg tagcctctgc acacgtagtc aatcttgaac      3360
     ttgaaacgac tccttctgcc ttgaaaatct catgtgacat cgggtgtact ttcatagtaa      3420
     ataacctata tacctatttc agacgcacgc acctaaagcg ccagcgcttc accacacttc      3480
     accaccactt gaagcaccgg tttttaataa actcttcgct ctcaccctga gctcgccagt      3540
     attcgataca gtcatcaggc caattgacgg cccggacgct gctgactagc attccagcta      3600
     tagctacaag gtgggatact ctcatagttc tttgctgcta gctttactct gttaaaccca      3660
     agtgtggcca ttatcgcgca caggcccctt atataccgtt ggctagccgt tggccagcat      3720
     atcttccttg tgtttattgt tcgtcgatcc taggcttatc cactacaatg cttatcccaa      3780
     agctgctcga tttgctacct ggatacactt tagtgcggcc gcgcaccgta agctacgtct      3840
     gtttctgact gactacacta cccatacgac tagtttttcg gagtgtgcgc gccagtctcg      3900
     tgcagctgcg agatatagta tatatatata ttagtatata gtattagtat atagtattaa      3960
     tatatactaa taataaaaaa taaatataaa gtatagtaag actaaatatt attaataagt      4020
     ttaaagaagt accgtaaggg aaaattattt aaatagttgt tctataagca cttatatata      4080
     ttatatataa ataatataaa taatgtacct tttgtataat gggtcagcga gtaattaata      4140
     ttagcataat attaaaataa aaaataatat taaaaataat ataaatattt aacaatgtta      4200
     aaattaattt aaataaatta aattcagcta atattaatta acccgaaagc agatgatctt      4260
     atatatgtgg tgcggttcct ggctcggctt gccatcaccc ctcgttcgcc ataaaaactg      4320
     ccagctgaat ctactattta cgctggcccg ctgccacgta gtcgctgaga tgctgcgcga      4380
     tacagagagc aagacctcca tcgaagagca taaggttgat aaagtaaacg atactgctct      4440
     gacgtgatgc cattacatac agaacatatg cttgttattc tgctaagtct gccatgttgc      4500
     tttctgtaac tgcgttttgg ccaggacctt gcaactaccc caagatgaag attcgaagaa      4560
     gttttatatc cgtcttcgag atatttgcat ggcaaactgc gttcactttt aaaccatgaa      4620
     gcattgcttt gatttatgtt tagtttaaat aaaaatggac ataattttaa atgttttata      4680
     ttctttgaga ggttcttgcg tgtgattgtc actgtattga catcaaagct gacttaacgc      4740
     ttttaatgcc agcggtcata atcaaaaaag tcgagcctac gcttaccgcc ggcgaactct      4800
     tggtcgccct gatacctacg ctgaccgccg ccctgatacc tacgctgacc gccgccatac      4860
     tcatgcttgc gacggcgcct accttggtca ccgccataat catggctgcg acggcgccta      4920
     ggccaacggc cgccactgcg tttccgttcc tggccccagc cgtgatcatc atcagagtca      4980
     tgcccatatt cctgtcccaa gttgggacca tcaccgaatt cgttcggata ttcctgaccc      5040
     aatcccgaat ctctaccatc gtaaggcgcc gccgtttctg caacgtctat tccatctttt      5100
     aaaatctgct caaaagcgaa gatagaggtt gcgcttgtta gcaaaaggac aacattggac      5160
     aatttcatct tgctgattgt atagggctat tcaatgtaga taattattgc ataagagaca      5220
     tctattgcgt ttatattcca tccattttaa agtgggcatc ttcctatttc atatccttac      5280
     ctgaccgtgg gatggcgcaa tggtgaatca tcacaaggat aggtcgaact gacggatccc      5340
     gcgcacaacc gatggtttaa ttccttggtt atgctcgctt agaagcaacg tatcctccaa      5400
     ccatttatat tactcgtgcc attagtactt tagaggagtt catgattcat tggtgaggtg      5460
     tgcctaaatg tctgcttacg ccagtaaaaa gtatctatgg cataaccata gtgcgatatc      5520
     ccaaaaaaag gtactgtccg agaagcatat cattgtgtgt tgacacaaca ctagttcgac      5580
     cgttattatg ggaccgaccg tgaaaaggag aagcttcccc atagtttatg taattgttcg      5640
     cttgctccaa tgtggaatcg gtattaagtc acagattaaa catcattctt atttatgacc      5700
     ggagttttaa tctatcttaa aggtgtgcta cgcagggcag ggacagcgct gatgccctct      5760
     tgggttctgc gcatgaacgg gtcacctagt aactcttttt gactgcgcga aacctcatgc      5820
     tcattgatca aaaacctagc acagaatcct ctgaaccgga tacctttatc tgcagcttca      5880
     ctcatacctc taattctgcc cctcccttat acaagttcat gcgcgtgtgt gttcctttta      5940
     tttacctaca tgaatacaaa gaaaagtccg taccaaccac agctaaggta acgcgcagca      6000
     agtggttcca gataatacac catctatggt gcgcgcgtcg gaagaatatt gcctaatgtg      6060
     atatgtccca tacggacttc tcctaatgaa tcggccaaaa atggaaggca caatttgccg      6120
     ttagtcagtt ttcagaaaat aaccaaactt ataatagttg tattccggaa aaactacacc      6180
     gctacgtatt gtaccctgtc cggaaatgct atgatgggaa taacagagct cgtaagatcg      6240
     tatcggcagc aattagagat aactctgctc ggagcaaagt agccgttgcc aaaaaaagca      6300
     agctattgtg gcgagtacag gaaagtatgc ggatgtacat gtcggatgtc tcggatacac      6360
     gacttagtgg cacaacacgg caaataagga gaaaagatgc accaacaaaa ggtacttcgt      6420
     attgatattt gcaaatacaa gtatatggaa cagaaggcag taaaataata tagcattata      6480
     tgattgcata ggataggaat ggtgcgctta tgtgcacctg tgaggagcaa cagccgacat      6540
     caaaaaaggc ggtagcaagc cacgtacaat aaattcagtt ttctagcctt tgagtgattc      6600
     aacatacatg aatggcacag gacaattctt ctagtcattc tatcatggtt tcaatatcaa      6660
     aatatcaacc tcaattgaat gtaggcacaa tcttcccccg aagtgtatag acgtagaaga      6720
     atgtctaata ggatgcatga accgcctgca acataaacac ctagtgaagt acaaataagc      6780
     aaaaacggcc atgcgtgcgc attctcgcta gccaactttt atggacatga atgaagtaga      6840
     cagcagtcct tgtttgaaat tgaatacgct attttggcct atactcgaaa aaccggtgtc      6900
     agcttgatga agtaccgcca aagaaagtat atatgggttc atgtgggtct caaactgtag      6960
     gcgcaaacat tcgtgtgcct gtcccttaat gagctaccac cacacactac aaaagataag      7020
     gcacttctca aacatatata cgcacaagcc gactgcgtag cacgtacgtt ctcgactggc      7080
     aggtattcgc acgatgtatc atggtgatat ttgaactgac tgcgagtaat ctgaatgata      7140
     tgacactaac gctacgagtg ctgcagtata cgaatagcaa atgagtaagt catccgagcg      7200
     accgatgata acattcttgt tcatcaaggt ctttattctg actataggac atttaccagc      7260
     tggcttttct gtagtccttt aaagggctgc ataagaactg aactgaacgg gaagctatgg      7320
     cctccatgct tgatgcagct cgcctttcca tatttatgcg acgccgcaat gcgtctcgga      7380
     gggaagcact cttgccggtt ttttgtgcac atgcagggta tgtggcagac agctggtatg      7440
     tgggatttat tttgtgtagg agaccgcgat gcagctattc tgaggcgtca gcgtaataaa      7500
     aaagcttgca ttacctcggc gtttgcctca gcgcggttta cgcagaggta tccaagagag      7560
     tgaggttaaa ctagctattc tgaataaata agtattatca cgctcgctat actatactac      7620
     aatgttaggc tatcactctc ttttgttgtt tttaataagg ctgactttta ttgcctcttc      7680
     cccaatccca caaacggcat taaacccgat aatcaacatc accaacccct ctactaacag      7740
     cctgccacct ctatcttacg tttcccctga tatggtggaa gattgggaga ccatcgagga      7800
     cttcagacag tcattgaggc tgacggcatt gaaaaacaat cccaaaggag cagacgtgtt      7860
     acgaagcttt gtgtcgcagc agaactccac ctgcgacgag gtgaattggt ataatgtggt      7920
     tcaccatagc atttttggaa agaaaagatt ctgcgatgtg tagatattta tatatttccc      7980
     tgtatcgtcg tttaatctgt tcgttagatt ttgtactaca atttttcctt gacggacagt      8040
     ccgtggggcg ctgacatttc gattgttgca ggtcactacc tgcgatggtg tacggagacc      8100
     acacggtatg ttcccctcca gcgccacgct cctttccttc tacgccgcca catcatatgt      8160
     tgctgccttg tatgtgttcc caggcaggcg tatctacggc catgctagcc ggaacgatcc      8220
     aaaagcgatc tggtatggga tgaaagccgt gggatgtgga gtcttggcaa acctcctgat      8280
     cattccatgg ctacagagca ggctggccag tgatggcttc agctttgtcg attgcttttt      8340
     ccgcctcggg cttgtgccgg gcgcgtatgc ccactttcgc gggctgcatt gggacacact      8400
     ggcatacgcc accgatattc tacgcgcact cagcatctta ggctctctgt acgccgcgga      8460
     cctcctcgat agcgctgcat actacctgct tgtgcctgac acgtcgccgg tggtggatct      8520
     ggtcgaccgc ctctcgtgca cgaccgggct ccggaactac gttttcggcc cgattaccga      8580
     ggagctagtc tacacctcca tggtactgca aaactaccgc ctgctgcagc ccaccatctc      8640
     gcgcgccatg ctcctgctgg cgactcctat gttcttcggc gtggcacacg tacaccacgc      8700
     gcgccagctg ctcgccacgg gccaccgccc cgcgcaggtc gcactcacgt ccagtttcca      8760
     gattctctac acgaccctgt tcggtacctt caccaactac atttattatc acacagctgg      8820
     gaacctttgg gcctgtatac tgctccacgc cgtgtgcaac tacctgtcat tccctagtct      8880
     gagctctgac gttttcgccg actattgcgc gaaagtcccc ccagcattac gtgctctgtg      8940
     gaaaatgcgc ctcctgcatg catggggcta cacatatcgc ttgtgtctgc tctgcggcct      9000
     cttagccttc ctcgacggca tacggacctt ttcgtcctcc gccggcgact tgtttcttga      9060
     cgcctaacat tgtcacattg gcgcagccgc gcgctcaccc atcgccttgt gtaaagcaca      9120
     cttggtgcca tacactgtac ctaggcgtat ccagcggcta ctaccggcgc agggagccgt      9180
     gctgggggcc aataatggcc tgttatcatg ccatcgcggc gatgccaatg tttatatcac      9240
     ttaggacgtt atgccttatg aagcctattg ctgtgtctcc accacttgaa caagttgtct      9300
     caatgaaaac tcgtccaagc accggctaga cggagcagga taagcgccaa gcgttgtcca      9360
     gttagaagct agctgctcga gaagttctac cgaaccgttc acaaggcaga aaccagctcg      9420
     aagacgcgca agcagggtta cttggctgtt cttctgcagg tacattagtg cattggagct      9480
     cagcgtggca ggtagagcgg ggccagagag tgcgagcgag gctgaaaagc aggaaaatga      9540
     aggcggacta cactgcgcgg gcgtcgaaga cgcgcggtgg gcagaaggtg ggcggggtga      9600
     ggcgcgaaag cgcggggcag ggcatgtcaa tgagcgagga tgagttccag gcagcacaag      9660
     tgcggcaacg gaggagcaag agctgtgcag gaccgctgga aggggtgcag gagcgcgtgt      9720
     tgcgcgcaca tacgaggcaa gcgaaggaaa agcgaaagtc cgaggtgctg attgcggcac      9780
     aatcgctgga ttacgagtta cagaatgtca agaatctgaa gcggatttcc ataggctcga      9840
     tggatcttct gatggacccc gagatggaat ttcggatgaa cggtgctgcg gtctccccct      9900
     cggcctcgcc gcgcaacagt ttgacggagg agtcgctgga gtggtttcag ctcagtgctg      9960
     aacaggagca gggtggagag ctgccactac atgcggaatc catcgatgca cactcatcag     10020
     caggcggtag ttcagacact gcacgtgatg agctgctcac ctccgccagc agtgtagtcc     10080
     cgtctgaaga attaagttgc agccatcctt tatcgcctcc tgcagccgcg aaaaagagca     10140
     cgcttatgtc aagtagatct aaattggggc ggcagcatac cgataccacg catacaaagc     10200
     aagcgaccgg cgagccgttt tcaagcaatc tactgtgggt gcgtgcagac cagcatccca     10260
     acgtgaagcc ggaaaactac cttgaacttg tgcacgacac cttgaataat ctacgtatcg     10320
     gcgcgaggca cggtagaggc gatagtccgg tgcagcagag caatacgccc gtggccaatg     10380
     gtgaaagtag caccgcctct gccaggtctc tggtgcgtaa acagtcgaga cttcggaagt     10440
     cattcacaga agtggaagct atagaagagt cacagttcac agattctatc ggtagtgaaa     10500
     ttccagttgg taaacgcatg cgagtgtcgt cattgaagga aataaccgaa gagctgacac     10560
     gaatttctaa caatgcaggg ttgacagata gcgacgcgat tactctcgca cggacgttag     10620
     gtattggatc gcaatctgct gatgagcatg caaccttttc tgagtgcgtg ccaagtgcag     10680
     aagcagaaga aaatgagtat gcgtccagca tattagccaa aaatgggctt gcgattccgg     10740
     ctcggtcctc cctcaggcgt agcaagttca ccacataccg cattcggtct gcgggaagcg     10800
     atagctcgcc cccagaaaac aaatcgacgt catcttcatc attagcagca gcatacgaaa     10860
     ggaatagtag gagtccaaag atgcaaaagg cagcgtttaa aggttcgcat ccacgtctgt     10920
     cgggtgagaa taccagtctt gctccacagt ctcccaattc aatcaatgat atttatgatc     10980
     actacaatac atcagatacc gatgatgggt cgccggaact tcaaggctca ccagtgaccc     11040
     acacttcaga tgcaagtttc acttcttcgc caaacatagc atctggtgaa cactgcgcca     11100
     gaaatgctca taagatatca cctatatctg tgtcccaatt atctgccaca tcttcgtctt     11160
     caacttctcc tggaagctca aaaagtgctg agagtacgaa gtcttggacc tttgatcaaa     11220
     aatcacctct tcggagtatc actctaaact cttctacaaa aggacataag atatccgctg     11280
     aaaaaaagaa gggttggagt tggtttggaa atagtaggag gccttcctcg gagtcggtgc     11340
     ttctgccggg taccgattcg gagggttgtc ccatggacga atcccaacca atacagtccg     11400
     aagaatatcc tttaaagcat ccaatttcac cggtctctga tgaaacgcct aggagaggga     11460
     accactcgag gaaccgtcac cagacttcat cacccgagga gttagagatt ggatggactg     11520
     aaacatcttt gactacacta gatggtgaca ctgaacaaga tgggaagcca caacatccga     11580
     agacaaagga gaagttagag aagaagttca tgaagatatt taaaaaaaga tcgggtacag     11640
     ggctctcaca agatacccca aatcaaggag aagaaagctc gttaaaggcc acctcgagga     11700
     ttcgaagaag ccgtgaatcc aagcgacaaa ccgatgaacc ttccgccagc ttgacaacat     11760
     ctgtttctct gaacaatcat aataatggca gaaagtcggt ttcaatttcc aggccaacct     11820
     ggcagcgaac tgagagttcc tataatggcg ataaaggtaa aggctctata actagcctcc     11880
     agcccgctgt tagtgtgacg agttcaaggg attcgcatga acagacgcgc caagatcccc     11940
     aaccacaaag cctagtaact aagatggatg gttcttcatc gaatggggtt acggtatctt     12000
     cgcagcgagc aggcttttca aagaagggtc gcagtaaaac tagccattca aggtctaaat     12060
     tgtccacttc acatgacatc gcaccagtgg acaatcggcc ctcagatgtg gatcagaaaa     12120
     gtacggaggc taataacaca ttgtcttccc gcgccgaaga tagccatcca tccttagatc     12180
     caggcaagtc agcgctcgga cctggggaga tagcccatag cttgcctcct cgtaaacttc     12240
     gattcgacga tgtgcttcgg cctgagaaac cgaattcgcc catgaaattt actcctagcg     12300
     ctttcggatt tccgcttcct cctttgactg tttctactgt gattatgttt gaccaccgac     12360
     tgcctatcta tgttgagcgt gccatataca ggctgagtca cttgaagctg agcgatccaa     12420
     agcgggaact acggcaacaa gttctactca gtaatttcat gtattcttac ttgaatctgg     12480
     taaatcatag cctatatctg caacagatag aggaggataa aaaccaaggc attcaatttg     12540
     agagcacaga caacatggca tcttccagtg gtgtggttcc cgagaagtgg tgaatttttt     12600
     tgtacttcgg tgaaatggtt gcatttcata tcatgataca gcagacacag gtaaatttta     12660
     gttcaggata tgatctttga cccttggttg ttacgagagt ctaccttctc ctgtttttag     12720
     ttgcacttaa atatttcacg ttccatttga cactatagtc gtcatagccg tgggtctctg     12780
     gtatcgcatt gtggtgtgtg ggtggccgtc gtagagccaa attttttagt tggccatctc     12840
     tgctcatctc cgtctagtcc gtccccgccg accttcccgc agactcgacc acatatcccc     12900
     tcatcatggc taccgataac ttctatcgca tgatgatcct cctagaggag ccacacaagc     12960
     aacacagtac cgacggacgc aagattgaaa acgcgagcca tgactttgtc gatgagctgc     13020
     tgctacctat acaagttgac gaccttgaag tcctgaacac ctggtttgac aagttcgacg     13080
     aagaaatctg catccccaac gaagggcata tcaagtacga gattagcagt gatggtctca     13140
     tcgttctcat cctcgacaag gaaataagtg aggttatcgg cttggtccgc gacttcgttg     13200
     ctgccaacca gctcgacgaa gacagctcca gcgatgccaa atgactgctt gagcgctcct     13260
     atctgccacc tcctgtacac tatataggca atactctccg cactgacttt tgttagctat     13320
     aaggaatcac gtgatcatcg tagcgtagct tctggtgccg catgcgcttg ctggtctgag     13380
     gacattggcc cagccgcgcg ttcacactgc gagctcgtca tagcgactgc gcgagaaaag     13440
     gtattgctga ccggaaggcg tgaattccgc cgcatccgat aggcagagcc gttgccatct     13500
     catccgacat caggagatga gcttacgaca aacatttatt tatatcgtat gttatgatac     13560
     gccgcaacca ctcgtaggta ggaattgcgt tctgtcgtat ggcctagcaa caagcagagt     13620
     gcggttacct cttttgtcga gcagtagtaa tatatatacc ctatagcgat cgtttcatag     13680
     ggcctggacg ctcttagagt acagcatcca agatggtatc caaaacgcta cctctttatt     13740
     ccaaggcgac tcttcaaaaa cacactgacc gcaccagctg ttgggtcagt gtcggcaacc     13800
     gtaagatcta cgatgtgtca cagttcctgg atgagcatcc tgggggggac cagtatattc     13860
     tagattatgc aggaaaggat attacagcag ttctaaaaga caagttgatc catgaacaca     13920
     ccgaggcagc ctacgaaata ctggacgaat cttacctggt aggctacttg gctacagaag     13980
     aggaagaaat aaagttactt acgaatgaga agcatgttat ggaggtcacg cccgagaatt     14040
     tggacactac gacgtttgtc aaggagctac ccgcggagga agtgttgtct gttgcaacag     14100
     acttcggtac cgattacacg aagcaccact tcctggacct gaacaagcca ctattgatgc     14160
     aggtgttgcg tggaaatttt acgcgcgact tctatattga tcaaattcac cggccgcgcc     14220
     actacggtaa aggctctgcg cctctatttg gaaactttct ggagccacta tcgaagaccg     14280
     tgtggtgggt cgtccctatg gtatggtatc cagttgtctt gtactacctg acccgggcac     14340
     tacagaacat gccagcccat ctggcactga cctgctttgc ggctggggtg ttcgtttgga     14400
     cactgatcga gtacagctta caccgctttc tatttcactt cgatgataat atgccggaat     14460
     ccaatatagc ctttactgtg cacttcttgc tacatggagt ccaccactat ctgcccatgg     14520
     acaagtatcg attagttatg ccacctgcgc tatttgtagt tctgtgtgcg ccattctacc     14580
     gcttggtgtt ctcgatcttc cctgagtatt gcgcatgcgg ctgttttgcg ggcggacttt     14640
     ttggctatgt ctgctatgat gttacccact atttcctgca ccatcataag ctccctccat     14700
     tcatgcgcaa gctcaagaag taccacctcg aacaccatta caagaactac gagctaggtt     14760
     tcggtgtaac atcatggtac tgggacaagg tattcgggac atacttggct tcaaattctc     14820
     ctgtaagtcg accaaagtgc gagtgaagtc acttcgacgt ctaacctact aatccttccg     14880
     tgttccgtac ttttactttt tttattattt aatggatgaa acatgtaagt aattgtggcg     14940
     gattaggcct gcctcgcgta gttgtagaga gctagcgtta tggctgaggg cgcggcccga     15000
     cgataccgta ataagagcat ttcctatgga acctggtttt cctacgctcg tagaaattat     15060
     tgcaagtgtt atgtatcccg taataaaaaa gtttctacta agcgcactat aacgtgcgct     15120
     ctgcaattta acacgctgat gtgaatccct tccagaatat tgtctgtaag gtcactttat     15180
     tattgtgcag gcatgacggc gatatgctgg caccatttta acgacctata aaacatattt     15240
     cttctataga atctcgagac gaatataatt acataattaa agatgaggac tttaaacggt     15300
     tatttagccg ccgaggcaaa cagaaccgca gtatagagga gctcgtgaag aaattgcgaa     15360
     ttgcaagtaa aacaatctta tttccccgca ttttctttct gcttcctctt cgctttttgt     15420
     gttgatttta tttgttttga atgcatctgg gttttacttg ctgtaaaaga catagagtaa     15480
     catctacctg gaatctcact ttaaaatctg aaataataat aaagctcatt ttaagaatac     15540
     gataaaaaca ggcatttcat agaactagtc gaagagatat agccatctac aactacataa     15600
     gctaaactac aaggcaacat ggtccacgtg atgaccaatc attaaaatcc tcgctcgtta     15660
     caaggacaat catagtcgag catttatctg cctcttccat tcaagcggtg attttccggt     15720
     cggccctact caagcaagat gaaaattgtt attaccatgt gttttacata cagggttttg     15780
     tattagtacc agtatcattg tgcataagta atagctagtt ccgtactggc gatcagatgc     15840
     aacatcattg ctcatcgata taccatgtga cttatgttta attattaacc cacatgaaaa     15900
     ccctttaaac atcgattggt tgtgtggccg agcggtctaa ggcgcctgat tcaagtgtat     15960
     gcttacaact gttacagttg gatactcagg tatcgtaaga tgcaggagtt cgaatctcct     16020
     cgcaaccatt attttttgca tggatcacgt gcgcagtgat agacgcgtca gatcacttaa     16080
     tatttgctgg catagcaagc tctagttacg cgcctcatgg acacagctgt taggtctgtg     16140
     aaggagttga ggccatgtac ataaagaagg tgattatacg gggctttaag acctacaaga     16200
     acaagactga gattgataac ttctctcctc atcataatgt tgtagttggt tttaacggtt     16260
     ctggtaagtc taacttcttc gccgccattc gctttgtttt aagcgacgat tacaccaatt     16320
     tgaaacggga ggaacgacgg tcgcttatct atcagggaac ttcatcagtt atgtcaggct     16380
     atgtggaaat tgtatttcac ggtgcggaga accggacgct acttggtgct caggatggcg     16440
     gcgtgattca cattcgacgg acagttggcc taaagaaaga cgaatacatg attaataaca     16500
     aaaacgccag ccgcagcgat gtacagcggc tgttggaatc cgctggtttc tctacgtcga     16560
     atccctataa cattgtccca cagggcagga ttgtatctct caccaacgcg cagaaccgcg     16620
     aacgcttaca gctccttgaa gaagtcatcg gtgcgaagtc ctttgagcgg aagcttaagg     16680
     aatccttgca aaagatggag acaactgaga aaaatcgcga gaagatacgt atagaacttg     16740
     aggaggtcga ggcgaagctt aacgaactag atgaggaaag aaaggagtta gagaaataca     16800
     actcgcttga caggaagagg aagatgtgcc agtttgctct ctatgaccgt gagctgaatg     16860
     aggtaacaag tatggtagag aagttggatg gcgagtatac taatacgttg gtactttctg     16920
     aacagtatat acaagaattg gaaaagaggg aaagcctgat cgagacttta accaaaagtt     16980
     tgaaccagct gggctcagaa ttgaaaatga aggagtctac agatttacag caagctaaag     17040
     attctgaatt ggaactcgcg aaacacctgg ccgacctcaa cgtgaaatac gaagagctaa     17100
     tatcccagaa caacgcccta aaggaacagt ctgcgtcaaa ctctgaaagt ttactagcta     17160
     ttcgctcgca aatcgctgtg aaggaacagc agctagcaag gctatctcct cgttttgaac     17220
     aactaactat agaagaagct gctatgaagg ccgaatttaa ggcccttcaa cagcgccaaa     17280
     gagatttgtt agctaagcgt ggcaaatatt cgcaatttag aaacaaagct gaaagagatg     17340
     cttggataga tcaggagctc tctattctga aagaggaact acagtgctct agcattgcac     17400
     ttacttccat ttcggaagag cgggacagtt taagaattaa gctcactacc ttagatgacc     17460
     aaataatgga gctaaacgac tctgcgcacg gccctggtat aaatgccgag ttagaagatg     17520
     ttcaacagga actaaccgtt ttaaaaaaag cacatttgtt caagatcgat gaacggaaac     17580
     agctatggag gtcagaacaa aagatccagt cggtacttga atctctggtg gatgacgtta     17640
     aaagagcaga aggtactcta agtgaaacaa tggatcgcag cttagccact ggcctaaaga     17700
     atgtaagtga aatagctcag agactaaatt taccagaggg ctctgttttt ggtcctcttg     17760
     gtgaacttat caagataagt gaaaagtaca aagcatgtgc ggaagttgtt ggaggtacat     17820
     cgcttttcca tgtcgtggtc gatacagaga atacagcggc acttcttatg caagaactct     17880
     acaattcaaa gggcggtaga gttacattca tacccttaaa ccgggtccac gtggactcaa     17940
     atattgtata cccttccaac gatgagcacc attgcacccc tctgataaag aagattaaat     18000
     atgacccgaa gtttgaaaga gccataaagc acgtttttgg caagactatc gtggtgaagg     18060
     acttgaacca gggtacaaag ttggcgaagc agtttagact gaatgccatc acattagatg     18120
     gcgataaagc ggacagcaga ggtgtcttga cgggtggctt tcatgatcat cataagcaga     18180
     agcgactaga ctcaatgaga gatctaaaat ctctcaagaa agagcaacag ggaaataaat     18240
     cccaactgga agaagttaaa gagaaacttc atagcataga tcaagaaatt gatgaattga     18300
     atgataagat taagaaatca atgagtagaa gggaaatgat tttgactcaa gtcgaagcag     18360
     taaacatcaa attggaaaag gctaagaggg aaagattctt actcgaagag acaatggtgc     18420
     agctcatttc aaaagaagaa aaggcaaaaa ttaatcaaaa gttgctacag gataaattag     18480
     atatgtatac agaggatttg tccagagatt ttgacactga attaactctt acagaaaggg     18540
     aagaactaga cgaaattgcc aagaaattgc ctgatttaga aaatctgctg aatacaacta     18600
     ctgacgcgtt aagctctgtt gttgtaaaga tagactcttt gaaagccgaa ttggattcca     18660
     agctcaagcc acaggcgaaa gaattggagg accagccgaa tgaaatcatg tcaacgactg     18720
     ctattcaaaa tttacaagaa catattgatg ctgtagagga tgaacgaaaa acattactgg     18780
     agcggaaatc tactgttgat aatgaagtgc agaagatatc agagattatt gataccctca     18840
     agagccgtca ggaagaagag gagaaatcac tggaaaaagc taactcccag caacgtgctt     18900
     tattaaagaa actagacaac tatcagaaag aagcggaaaa gtcaatgctc agaaaaatga     18960
     cgctgtctac caggcgtgac gaactgcaac agaaaataag ggatatcggc ttgcttccag     19020
     atgactcagc agataaatac cataacatgt ctagcagtga gctgctgaaa gaattgagtt     19080
     ccataaatga taaaatatcc aagatgacaa atgtgaacaa gagggccttg gagaacttta     19140
     agaaatttga cgacaaacaa aaagatgtta tgaagcgcgc taaggagctt gatgaatcaa     19200
     aagaatccat tgaaaagctg atcgacaaat taaaaaaaca aaaggtagag gctgttgaaa     19260
     ataccttcaa aaaggtatct gagaacttta cacagctttt cgaaaagatg gtccccagag     19320
     gtactggtaa gttggtgatt caccgcaggg agaatgagcc aagcaaacca tctaaacgcc     19380
     aacagaaaaa gagaaaacgc caggagactg aagatgtaca tttcaatgac gatcaagatg     19440
     aaaattcaag tcaggattcc atttattcag gggtctcaat cgaggtttcc tttaactcaa     19500
     agaaagatga acaggtccac gtcgaacaac tttcgggcgg tcagaagact gtttgtgcga     19560
     ttgctttaat tttggcgata caaatggtag atcctgctcc attttacctt tttgatgaaa     19620
     tagatgctgc cttagacaag cagtaccgta cagcagtggc agcaacagtc aaacaattat     19680
     catcccaagc acaattcatt tgtaccacat tcagaggtga tatgattgct gtagccgacc     19740
     ggttctaccg tgtcaacttc gagaacaaaa tatcaactgt tgttgaggtg acgaaagcag     19800
     aagcattgaa ttttgttact ggtagagaga agaatgagaa tgtaatttaa cgatcccttg     19860
     atggagcttt gctaaatagt ggtggatcgt ctgtatacct aattacaaga taagggttag     19920
     cgaacgacct gagaaagcac taactacaat tacatatatg ttgaacaact aggttcccat     19980
     ttggtctata taatacacag taggaccatg atcaactatg taaatacaag gactaaaata     20040
     tgctagaatt tcttttcatt tcttctgaga atctctgatc aaggaggcaa atccactact     20100
     tgccttattt ttacgaaggg ctttcgaggc ggattttgcg ctaataaagt tgttaccatc     20160
     atctgatgaa tcgctggagt cgctgtcact attatcagag tcactagaat cgctaccatc     20220
     atttgtctct tgttcgcttt cgtcagaact agagttatta acaacatttg gtgcagtttt     20280
     cttataattc actccctttt cccttacgtc cggcactccg cgggatgcca aatccgaaag     20340
     agagctcaaa gagcgattgc ttgtaccttt agattctgtt actcctcgtg aagtaatcgt     20400
     ttttgctgtc gatggaggag atatatggtc caataactta gttagcgggg ccgtatttgt     20460
     cgcttcattc ggaatttggg tggattgtgg caccccttcc aattcagaag ataaagattg     20520
     aggcacatgc ttcactgggg cacttactga gcctttgggg ggctgcacta tacctctccg     20580
     tggtttcttc atgcttatcc cttcgtcttc tgtcgaggaa tccatagaat catcgtcatc     20640
     atcgtcagca ctatcatcag atgaggctcc ggatgttgaa tccataggtt taaatttatc     20700
     actaactgta ggtacgattg actttgacga agtcttaggc gtgtttttct gttgctgaat     20760
     ttgtttctgg gaactccctt gcggaaatct gccctttgta aacttcgacc ttagttcatc     20820
     gagctttgaa accttgccgg aaggagatag attagtagac cctgcatcag cagtcatagg     20880
     cttttcgttg actttatgtg gtgcgttcgc aacaacttta tccttttcaa tcgctgtttt     20940
     ctttagaatt ataccagaga atgaatcttg tttctcttga ccattttcat gtttcgacgg     21000
     agacccactc tttgggcggt cagatgaatg cttttctaga ggagttttag catccgcccg     21060
     ctcatcatcc gagctttcaa caaattctgg agtttggtaa actttttcct tttccttctc     21120
     cttctccttc tccttctcct tctccttctc ctttatcctt tccttgccct tttcggtgtc     21180
     tttttccttc ccctttgaat tactagatct cttaagtgtc accgctttct tgtcagcatt     21240
     agccgtcctc ttcacaggtg ttttccgttt agacgtcttt tgctgcaatg atttgtcttg     21300
     tgtagagcta ttattgtcaa cttctgattt atcagctact gcttcttctg agttcaaaac     21360
     cgaagattgg gactcagcca ctggcgactg ggaactcgtc gcagtctgct taatttgcgc     21420
     atctatttga gctgccctag cgcgaaccgt tttttgggac gagggaaccg ctgtgtcagc     21480
     gggcaagcct gtcttctttg aatttgttct agatggctga tttgtatcgg atttcttccc     21540
     tgcttgcttt ttctgtgtgg attcaacttt cctggcggga gcgagttggg gctttaatgc     21600
     tgttgaggcg gggggatccc cctgtttcga tagaatggct tctggcttcc ctggcactgc     21660
     agacgacatc aaagtaggag taacaattgg ggccaccctg tattcagggt tactcgacaa     21720
     agtacctgaa gcagctgcgg taacggcatg ctcagaaata gaaggatgta ctgtcctgct     21780
     tgatacaggg ttgttgatat cttgagcccc cgtcagagta tcctgcacaa ccgattcttt     21840
     caacggatgt acattcagct tctttaatgc gttcgattcg tggacatata caccttcatt     21900
     atcatctgat gcaatattat caccctggtt ttcttcgcta tatttatttt tttcttcccc     21960
     agagaacaca ttagacctcg acgtgcctga agaaatagac tgagcagcct tttgagcggc     22020
     gtgtctctga gtacgccgag gaattatatt cctaggatcg ggtgacgagt tatctatgtc     22080
     tttgttcagc acagtaacat agggtttctt cttacgggat tgattacttg aggtcggttc     22140
     atcttcgctt gcagagttct taaacctagg tggtaaatca aagcgcttgc tattaaaaat     22200
     cttcagtagc tctgattttt ggaagctctt ttcccgttgg gtttctggcc gattcactac     22260
     cacactgcca ttctgagaag cctctgattc ttcgtcgcta aagtgatcct ttctagtaat     22320
     gccgcctgta gaatcctcat gacccttgtc tgaagccaaa cccttgttca gcttacttac     22380
     tttcttttcc agagagctct tcctaggaga aggcagttcc accagtccaa tattgttctt     22440
     ttcaaatcgg gactttttcg taggagaacc ctggtcatct gcaatggtgg aagaagattg     22500
     gcgcgtagcc atagtcggcc cactacgctc tagctcgttc tcgtatggca cagcgggaac     22560
     attatcctct gtggaagagg aagaagaact cagatcctcg tcttgttgca tacttgggtt     22620
     ataaggtttc ttcatcggga ttctagacgg tctcgcggga aggtcaacag cagggcttgc     22680
     agggccttcc ttgagttcct tctccacttc cgaaagccta ggctcgggga tccgcagcat     22740
     gcctgaggtt attcgaatat tcgtaattat aggcgtagct gtacttttct gtgaaaccgt     22800
     cgattcagac agaacagtgg gacctgtcaa gctaaccctg ttcggcgttt ctaccatgct     22860
     aaccggcctc ataggagttc ccgaaggtaa ccgctgctgc ctcgatttgt ttgggtccac     22920
     ggtttccgat ttcgatacag cgttgtcgtt catgtttata cgtttctgat ccataccgga     22980
     actaatgcgg attggaggtg actgcggcgg tggcggcggg aggatggatt tatctgccac     23040
     atcatcgtcc tcaaagtccg aattcacctg cttcttcgtg ggaggtgggt agatttgatt     23100
     agctaatggt gttgagacac gcaatgccga tgtcttaatg cttgcacgct tcttcgcaac     23160
     gttaaggacg gccgcttgta cagagccccc tgctgcgggt acgcccgccg cacccgtgtt     23220
     cagtttgcgt ttcttcatgt atatagtacg gtcccccgcg gcttcatcta agtcattccg     23280
     tagcagcacg cgtaccgtgt tgtccatgtt aaacacatcc ttcaccacga agtctgggtc     23340
     cagatcacac tcgttcacat cttgtagcgt cacaatctcc ggctcttctg ccaaccctgg     23400
     atacatcttg gcacatttct ccacgatctc atctgctagt tcgtatagac tatttgtcgg     23460
     ctttgtgaag tgcaagaatt tacgtccgcg tgcacgccga atatgtgcac caactagtcc     23520
     cgatagataa accgcgttgg ccgacgtgtt gcctatcccg gatgaaaatt cgcccctgcc     23580
     ccctgctatg ctagaagtgg atattggttg agcgtggccc tgtgcgaacc cgctgttatc     23640
     gagcgatcct gcaggtagtc caactaccgg tagctccgtc tcaatgctcg gtggaacaag     23700
     caccacttga agcttataca ttgttgctct ttgaccgcct gcacaactct gctatacttg     23760
     ctggtgtgct taatgagagg taatttattg cttccaattt tgcaaaatgc tatgagatgg     23820
     gaaactctac gtcggtgatc acgtgctgaa atgctgagag atatatagtg tctctagtat     23880
     aatgtgggtc gttagaagcg cgatatacgt aaggtatgtc atcagtaggt ataggtaaca     23940
     tgcatagccg caactcgctc gcggctgcgg cgcacgctat gcctggacag gcctatggcc     24000
     gtgccgaccg gctgctttct tccggggttt ggccacgcgg ccacgaaggg ctaaagcggg     24060
     ctcctcgaac agctcgaagt tctctgccat agagcgaaag tatgttttaa agttggcgtc     24120
     taactgagtg gctggcaggc cgtaagtgta gtggacgctt gatacagagg attctcgcga     24180
     gtcggcgggc aacaggcttt ccggggagga cgtgcgcgtg gaggctggcg tggaggcggc     24240
     acggacgcgg cggtcatatg ctcgtagttg gctacgcacg gcgcgcttac tggtctgcac     24300
     ggtggcctgg agggcagcca acgcgaccac accacgcaag gttacacaat catcgtctgc     24360
     cacacgctta gccgccaaca tgctctccaa cagctcgcgg aactcggccc agtctatctg     24420
     ctcgagcggg aggttgagcc gccgtaaaca atcccagaca tactccatgt caagcccctc     24480
     ccgcagcccc tgcaattccc gcggcagccc cccgcgctcg cgcgcgggcc cgcccgcgcc     24540
     cgtgtacatc gtcgccacga tgctgtccag ccgccagtcc gcatctgcgg ccttccacaa     24600
     cgaatattcg gtcgtcacct cgttgtattc caagatatag aacgggcacg cctcgcagtc     24660
     cgcgtgcgtg tcgcacccga tcttaaggtt ccccgtgatt gtctccacgg tcccgagccg     24720
     cagtgtataa cggtcctgca cccgccccac gtacgcctca acttcttcca cgcacgagta     24780
     acgccggagg aggcacaacc ggacccgtgg catgttctcg cctgaataaa catatagttc     24840
     ttccatttcg cgcgcctgga gcgaccccat tagctgccag cgcttactct tcgagtgatc     24900
     tttgtgtcca ggtaaataaa cactccgctt tgccaccccg cttgttgctc aagccgccca     24960
     tatctgaaac aacgtgactc taaatagcaa tgactataca gtcgcgattt acggcggcag     25020
     ccaccgatgt gctgtcccga gcatcgcttg ctgtcgcgag ccaggcaccg atgcagcgat     25080
     agcatggctc gtatgccaca ggaatgcagt atcacgtggg aaggctgcac gcgcagctcg     25140
     aggtcagcat tccaggcgcg atctagcgtg cgcataaatg ttctttatct acgggctatc     25200
     ggttcggata cggaagcgga catttttcaa ggcgcaccga aaacggcagc gaggccttct     25260
     cgaattagag tgcagggcgg ggcatgctct gtcaagaaga tgagaatggg tgcctgcata     25320
     acggcagaag tgtagcaagt tgtcaagact gggctcaggt gggcgtggca gccaggagga     25380
     atgtggcacg tcatcacact gggcagggta tataagtgct cgcggcggca gatttgaaga     25440
     tcggtgtcgc agaccagcac cccacccctg tcactccttc gcaatccaac tattgtcttt     25500
     cctttaacat gcaaatctct gcagtcgcac tctcgggcgc ggccttgctg gcctgtgcca     25560
     gcgcgcacca gcacgatcgc aagaagccgc atctggtggt agtgtacggt gatgtctacg     25620
     tgagcgggac agatacattc acgaagtact attcgaagat gacagacaag cttcccgcga     25680
     gcgggagcga tggctggagc tactcgtggt cgacggccac gtcgtggact tcagacagcg     25740
     tgtctaccga gccctctgcc gagcccacgt ccactgagcc caccaacttg cccgaggtta     25800
     ccagctcacc cgcgacgcct gtccagccaa ctagcgcgcc cgaagagaca tttgaggaac     25860
     ccaccgagtc gacgtctgcc gagcccacca gctctcccga gcctgtgaag tctgccgagc     25920
     ccaccagctc tcccgagcct gtgaagtctg tcgagcccac cagctctccc gagcctgtga     25980
     agtctgtcga gcctgtgaag tctgccgagc ctgtgaagtc tcccgagcct gtgaagtctc     26040
     ccgagcctgt gaagtcaccc gagcctgtga agtcacccga gcctgtgaag tctgccgagc     26100
     ccaccagttc ccccgaacct accggatccc cacagcgcag cagacctgct ggaggccaga     26160
     atggcgcgtc attcgaggaa gagattctac gcgcacacaa ctctcgcaga caattacaca     26220
     aggacaccaa acctctaact tggtctgagg agctagccaa gtttgctcgt gactttgcca     26280
     accagtacga ctgtagtggt cgtctcgtcc actctgatag cccttacggc gaaaacttag     26340
     ctgtgggata ccctacccca gagaaagcgg tcaaggcttg gtatgacgag atcagcgact     26400
     actcgtactc ccacccttcc ttcagcttca gcacgggcca tttctcccag cttgtctgga     26460
     aagacactaa gcatcttggc tgtgcggtca agaagtgcgg cggctccgtc ggtgactacc     26520
     tcatctgctc atatgacccc gcgggtaact tcctgcgcag atttggtgag aatgttgcac     26580
     ctattgcttg agtaaatatg atacatacca agagctagtc gcttggcgag cgctgacgcc     26640
     cgccccgcgt cagcgaaccc aactgacgcg ccctgaaaca catacactac gcctttgaac     26700
     cacattgcgc cctgaaccgg cgctgcgcct gcgtcacatt cctgaactga caggagcggg     26760
     tcccttaata gtcgcccact ctgaaaccgc cctctgacgc gcttcctgcc ggatccagta     26820
     taagagcggc cgcccaaaaa tgccaagcta ctggtggggc acgtggcggc cccaccgccc     26880
     atgcgtgcct gcctcctcat accgctgctg ctcgtggcgg ctaccgcccg caccgtaacc     26940
     gtttccgtca ccgcgacacg gaccgtcacg gtgatctccg cagccgccgt taccacattg     27000
     cgcaccaccg tgtttacaac tgcgtaccgc acccagacca ccccgcttac tgagacgccc     27060
     ctatcacgac ccacggctgt caacaacact ttcgcgtccg cagtgctcga cctgcacaat     27120
     gactaccgcc gccgtcacca cgcggtcccg ctgcgctgga acagcaccct gtacactcac     27180
     gcacaacatt acgcaaacag gatactttgc aatggctcac tggtccactc aggcctgccg     27240
     catggcgaga acctggcgct cggctacagt ccggcagctg ccgtcacggc ttggtacgac     27300
     gagatcgccg agtacgactt ttcgaccccc ggcttctcac atgccacagg gcactttact     27360
     cagttggtct ggcgctcgac cacctccgta ggctgtgctt atgtaatgtg tgggccatgc     27420
     tacggtctct atatcatctg ccagtacgac ccaccgggca atgtggccga ccagtacgtg     27480
     gccaacgtgc tgccatagat agcctcgaga tcctggcgat gtgctgagta gattacgtgg     27540
     gacggggagc ggcaaatttt ttcggatttc gcagcgcggg gtgctcaaat cggtgaaaaa     27600
     attgtgtggg agcgcaccgc ccactgaagt ttcgtggcgg tcagcgcatt acacactcga     27660
     gatccttcac gactcctacc gtcctgcttc tggtgctagt ggtttacctc tgtgtgttcg     27720
     cgggtgcttt cgtatattga aatttttggt taaggtatca ggatatagct gacatggaat     27780
     cgcaagccgc cgttgaagag ccacaacact ctgtggtgat tgagacgccg cccacgacgg     27840
     cggagagctc ggaaaccccg gtagcagaca cagcgaccgg cgcagagcct gagggtgccg     27900
     gcggggccgc ggtcgtggca cctaagcgga tgccaacgcg tgcagatttc ccgccattga     27960
     gctcggtgat cttcgagacg cagaaagttc agtgggggcc gaacatgaaa aagccggaat     28020
     cgcaaagcgc gtcgccctcg ccctcgccgg ggcctgtggg ctctggagcg aaaccgatgc     28080
     gctcgaagac gatgcaggag gcgttctcgt tggaccttca gacgcaggtg accatcagca     28140
     aagcggagtt ttccaagttt gtggtgtcgg ttaagcagtc gcactcggta tcgatcgagt     28200
     cgacattgtc gaagctgtcg cggacgttcc tcatcaccgg ctcccccacg aacgtgtaca     28260
     atgcgaagcg cgagctggta aagaagttga cgcgccccgt cacggttgtg atccaggtgc     28320
     cgtccaagac ggtctcgtcc atcatcggac cgggtgggcg catgatccgc gagatcacga     28380
     acgcggctgg cggcataaag atcgacatcg cgaagacggc ggaggcggat gcctacgatg     28440
     ctgaccttga cgatcagctg atcaacatct cattgcatgg tgatgtcgct tcagtcaact     28500
     ttgcgaagga caagatcttg tcgattgtga aggaggagac gaaaaacgct accatcagtg     28560
     ttgccgtcga gaacaagcag ctcatcccat tcatttcgct ggcggacgtg gagatttccg     28620
     aggacgtgac tgtgaaggcc ttccctaacg gctctgagaa gatcgttctt atggggccac     28680
     gcgatgaagc gaaggaagca aaggtgaatg ttcagaatta cttgaacact ttagcaagca     28740
     aggtatctga gaaaaagatt tcgattcctc gcaagttcca gcctctgatc gatgcagagg     28800
     atgtcaggga gaaatacaag gtctccgtta tcttcccaac cgcccttggt gatgatactg     28860
     tgtcgttcta cggactgtcc gctaatcttg atgacgcgat cgcatatgct cgccagtcgt     28920
     ctaagcagta cattgtagaa tctttggagg tatccaaggc tcacggaaag aatgtcgctc     28980
     atgcaaagaa tttaatgttc tacttcgcca agtacgacat cctcaaggat attaaggagt     29040
     cgttcaagga agtgaagtta gtcttaccaa ctccggagga gttgccaggt ttagacaatg     29100
     tgtcgatcaa cattatttcg aaggcggata ttgcggagca gacgaaaact gttcgcaagc     29160
     aaatcattaa tatagtaaac cgactcactc cttcgcatgt tctagctgtt gatgacctag     29220
     attatgagct tttccacaag gatatcaagc aggcgctatc caaggcggaa atcccatttg     29280
     ttcagctcgg cgatcactac gaaggcgaca ataccgtgct gctatttgcc aaggttgacg     29340
     aagaagactt ccaaccctcg cccgaggagg tgaaggagca tctggagaag gttgctgccg     29400
     tgttggatga agtacgcacc aaacaatcca aactattcac taaaatagtg aactttgatg     29460
     ccgaattcca agttctacac ttttcagatg actccgtcac gtggaatctt gtgctagaga     29520
     acattacttc tgctggcggc catgcgcaga tcaaactcca cacaccttcg gaggacgaga     29580
     taaccatcag gggtgatgag aaagctgtaa aagcggctgt gaaggcattt gaaagcattg     29640
     ctgaaaatcc aagtaagaag agcaagctga ctgtttccgt accagccaat actgtttcaa     29700
     gattgatcgg ccctaaggga acaaacttgg ctcagattcg ccagaagttc gatgttcaga     29760
     ttgatgtacc ttccgaatct aacgatacga atactgaaat cacgctaact gggctggagt     29820
     ataaccttca acatgcaaag actcatatcg catctgaggc taagaagtgg gctgatatca     29880
     ctactaaaga gctaattgta ccaaccaagt accatggctc cttgatcggc tcccagggta     29940
     cttaccgcat tagattggag aataagtaca gcgttcgtat ccagttccca aaggagggtg     30000
     aggttgttac cattaaggga ccttctcgtg gtgttaataa agctcacgct gaactaaagg     30060
     cattgttgga ttttgaaatc gagaacggtc acaaatctgt gatcaacgtt ccagttgaac     30120
     acgttcctcg cgtcattggt aaaaatggtg atgttatcaa cggcattaga gctgaacttg     30180
     gagtcgagct aaaacttctc caaaatacca aaactgctaa ggaacagaac ttagataccg     30240
     ttcagctaga aatcaccggc tccagacagg cgattaaaga agcttcaaaa gctgttgatg     30300
     ctattatcgc ggaagcttct gatttcacca caaaacaatt ggaaatcgat gccaagtatc     30360
     acaaactaat tgttggtcct ggtggaagta ctttgaaaga tttcatctct aaagctggtg     30420
     gcgatgacat cagaaacaag accgttgacg ttccaaatgc ggagtctaca aacaaggtga     30480
     ttacgatctc tggtccaaaa acatttgttg agaagatgtc caaggcgttg aaccagattg     30540
     tacaggatat caaagccagt gtcgccaagg aactgaatat tccagccgac agacagggtg     30600
     ctttgatagg tccaggagga tccgttagaa gacagctaga gtctcagttc aacgtcagaa     30660
     tagaagtacc agacaagggg aaggagggca aggttacaat tcatggtcga ccagaagccg     30720
     ttgaaaagtg tgaaaaggag attttctcta ccattatcag agatagctac gatcaggaaa     30780
     ttatggttcc tgctgtttac catgcctttg tttcagagcg gggtcagttg atcaataagc     30840
     tacggatgac ttacttcatt aacgttaagc atggtaactc ttccaaaaag gcgaataaac     30900
     tatcgcgctc tgagcaaccc attcctattg agcgggtgcg cggctcggaa ggcgaaggca     30960
     ctaagttgac gattgaagaa gtatctgctc ctgaggcatc tgccaacgat aatatcccat     31020
     ggagactaac atacgaacat gtggacctat ctgatattct tggagaggag ggcaagcatg     31080
     ccatgaccaa ggaacaagcc ttggaagcgg cggctgatca aatcaaagag agaatcgaac     31140
     tagcaccaaa ggcaaattgc atcggctacc tctggtgcga aaatgttaag aagtttaaca     31200
     aggttgtggg tccaggcggc tcgaacatca agcagatcag agaaaccaca aacaccctga     31260
     tcaacgttcc aaagaaatcc gacaaggtta gcgacatcat ttacgtgagg ggtacgaagg     31320
     agagtgtcga gaaagcctgt aagatgattt gcgacgcatt gaacaagtaa tatcgtcagt     31380
     cttgcgatta acttggcttg acgttaattg catctcccct tcttacatct gtgagttgaa     31440
     ctgaataagt ttataataga taactattgc gtatatcagt cgattaataa cgacgatttt     31500
     ccatacttaa agaaggaagg aatgactata taacgatgca gaagaagtac cccaggtgcg     31560
     aaacagcgag ctacagggaa agtggagcta cacgcagcaa gaggttgcat cattcgtggt     31620
     tggcctctga agctgaatac tggaggaatg ctgaggctgc gccgccaggg actcgcgccg     31680
     ctgctcgtag agtttccccc caatcccctg gaacacatcc aggatacccg tgccggtctt     31740
     ggcgctaacc tcgtggaaca tcaagccatg cgcttctgcg tatgcctgtg cttcctcgct     31800
     gtcaatcacc ctcggcttgc agtcctcatc caccaaatcc aatttattgc caacaaggaa     31860
     gattaccaga tcctcgtcac caaccttgct ctttaattcg ttcacccagc tctgtgcctt     31920
     tgctagagaa tcctcctgtg tcacgtcata caccaccaac gcggcgttcg cattcctgta     31980
     atacatcgga gccagcgatt tgtaccgctc ctgtcccgcg gtgtcccaga tctcaaactt     32040
     gatcattgcg tcgtcgtggt ccgccagctt gatggtacgg gacagaaatg cggcgccgat     32100
     tgtgctttcc cggaactcat cgaacgaatc cttcacgaag cgatgaacaa ttgacgactt     32160
     accgaccgac gagtctccca acagaactag cttgaactgc aacatcaagg gcccttaagg     32220
     aacaatatga aacttcacga gttcgagaaa cgtttacagc tgtgcttctg ttgtaaatgc     32280
     tcatgaaatg tggcaattta agggtgaagt ggacttccgg ccggctcttc cttgtaccag     32340
     acgttcgtat gtaactatat acacgtgata acctggttag tcaagaagcg tcgtaatgtc     32400
     gtaatgcggt gtacgggtgc actaatgtac ccggacattt agcacgtgat cgtaattaaa     32460
     atgaggaata ccgactatta ataccagttt agctggaata gtcgtgcggt tgcaacagtg     32520
     gccggcgagt cgtaacacta atcatatcta gtgacagttt tatcgcgcgt agcgatgggg     32580
     cgcagtattg cgacggtatc gtgcagatta agctagtaac cgagtattat atcaagagct     32640
     actggtttat aaacccatca actactatca atatgtctgt agcggcatat atagaagacc     32700
     catacatcta gaataacaat gtcacgtgat ataaattagc tagccgtgag ccggcccgct     32760
     cgctgtttcc tctcgaggac gaagaattat agatcacttg ctatctcaga gatgaggaac     32820
     gcagactgct gttagctgaa aatctcacat agggctagca agagcgaccg tggatgatca     32880
     aggacgagaa ggacacggcg agtgcgcgtt gcacgccggc ggccaggaat gatgaggcgt     32940
     tgcagaagaa ggaaggcagc ggtacggcgg taagacgacc aagagcaaag acattcacag     33000
     ggtgctggac gtgccggctg aggaaagtta aatgcgatct gggtaaacca agctgtcaac     33060
     gatgcgagaa gtcaggctta gattgcgggg ggtacgatat caagctgcga tggtccaatc     33120
     cgatacggtt tgataagttt gggaaccaaa tggcagggga ggaccgggat ggcgacggcg     33180
     agcagcctgc gcagccgttc cagcggcgta acattatgtt tgtgcggtat gatgaggagt     33240
     acgagtacta cgaggatatg gatgacgagt tgtccgctct gcactccccg ccgcttgaga     33300
     tgatcgccga tcataagacg tggatcatta agcgctttgg cgtgttcaag ggcacggacc     33360
     gggtgaagcg caaatacgtg ccgcgtaagc gtcgtaaggt gaacccggtg tttgcagacg     33420
     cgatggcgcg agagcaccgg cggaagctag aggaacggga aaaacaggct cggcggaaga     33480
     gaaaaggaga gcttcaaggc tcgttgggct ccggtaacgc gactggtgcg gggttcgcga     33540
     aggccgggcc acctgcagcg gagtctgctg gagctatgtc gcccgtgagc gcgacacctc     33600
     tgttcgactt cgacttctct actccggggt tagtaagcag tgagtggatg gccggcgagc     33660
     tcaaggatga cacgacacta tcctccgcga tgctgcggaa tacgttgtct ttcccaacgg     33720
     gcttaagcgt cgcacaacat ggcgacggaa ttactgcgga tacggcgcct cccaagtctc     33780
     aaagctcgat attcccagag caaacattgc cgctgcagtc cgcagggact atggttccac     33840
     cctcggttga cgaggtctcg aaggtgtatc gtctactctt gaacaaccaa ggcacagatt     33900
     gcaattcctc tacgggatac aaaggcttat ctggcgtaca tacaccttat actgttgaca     33960
     atgtggcgat ccatggtccc gaatctcgga tgcctgcaag cgcaattgag tccgttccat     34020
     ctatagtccc agaccccact atttttacac tggccgagca tactaacagt ctgattcgtt     34080
     taccaaggat gggaatgcag atccatgggt tgacgcgatt cctactgagc tattatcagc     34140
     agaatgtggc ggacctaatg tctgtggtcg ctcttcctaa gaacccgtgg aaaactatat     34200
     actttcctcg agcagtgaag gcgcttggag aattaggtgc cttaggatac acgtctcact     34260
     ctcggaatgc gttgctgaat gcccttcttg ctgtttcatg ctttcacctg cagagcaagt     34320
     tcccaaagaa ttcgaaagag atgaaatact ttgtgtcttt gggaatggac tttcggaacc     34380
     aggcttctgg tttcttgaac gcatgcctaa gttcgacctc tcgacaggag cattataaag     34440
     atgttctcac cgctatctta tccatgaact cgatcgacgt tgtgtgggga actatgtcag     34500
     attgtcaata tcatctaact atttgtgaag aatttattga atcccgtatg aagagtaggc     34560
     ctcttttgtc tgagaaggcc cgatgcttac atcgcatctt ctcatttctc aaattgatcc     34620
     aggatagtac ggctttagac aaggtacaag agaaagagat catcatgaaa gacgctggag     34680
     acaaggagtt tcagaaaaat ggtagttcga caccgccttt gtcgacagat tcatcctcat     34740
     ttactggtag atatgttgag caattaaaca aagataatgg aagagtatgc attgagttca     34800
     ttgagaaaga tggtcagtat tttgatacta ggggcagtgt tcctctattt aacacgattg     34860
     ttaccaagtc ataccctcat gaaattaacg aaaccagaat cgatacgctg agtatggatg     34920
     ttttatatgg gctaccaaac tcattgatcc tgttattttc tgactgtgtt agcctcgtac     34980
     ggcatcgttt ctatttcaaa aggcataata ctgcacaacc gacttcattt ggattatttt     35040
     gcgtcaagat tgaacagagg cttctgagtt ggaaaccgga atggatattc tggaaggatg     35100
     attccaaggc agagttcatt aacgatactg ttgagggcgt ttaccatcat actatgagct     35160
     tttattacgg tctgctaata tattacttta ctatggctcg ttccttggag gatcatacct     35220
     tgcaaaacta tgtccaaaaa gtattaagtc atctgcgtga actagggaac atcattgaac     35280
     acaaggacgt aaaaatagtc cccctaatgt ggcaaggatt tatggcgggc tgttcctgta     35340
     cagacagtag tatgcagttg gaatttaaga aatggacagc tcaattagtg aattttggta     35400
     taggctctta ttggggagcc agacagatta tgcttgaagt ttggaggcgg cgaatgaccg     35460
     acggcaagtg tgacaattgg tattcagttt actgtgactg ggaaatgaat ttaatgttag     35520
     cttgaagcat gtaattaatt atctatactt gtagtcatta gaaatggaaa ggattgtggt     35580
     aatttagggt agaaccaaag cgtttacaga tattgtatgc attgtaaaaa gatgatataa     35640
     aggctttcca agattatcta cgactacaga agtggatact agagtgtgaa aggttctgag     35700
     gcattgtcat aaatgaatta caaaatatca ccaataatga cggaagcctg cttgtaaccc     35760
     tcgagaagtt taatacattt ggccctgtcc tgagctaagg tttcgtcttc catcaatagt     35820
     tcctcaaaca gagattcctt gtaaagtttg gatactaatc tgttttggac ctcctccttg     35880
     caaaagttca caaggaagca catgacggct tttggaattt ggtcttcaac catttctctg     35940
     acgataccaa aatacgatat gatgagcctt cttatcaatt cacactcgag ctcttccctc     36000
     tcggtcaatt ctggatgctc agcctcaaca ggagctgcaa cggtatcttg tattttaagt     36060
     gtctccattg ccataaaatc agcctcttgt tggaaaaagc tatccattgt cctctcctgt     36120
     ttgtcgctga aagatggtgc gatgtcatct ccatccttac gctgctgatc tttaccaaag     36180
     aagtagttca aaaacgagtc cttattttgt ttaggatctc tttcatcctc tccttcgcta     36240
     tcgctagatg ttatcgtaga atcagaatca acctttggag atgggttgcc attagttggc     36300
     tctcctacag cagcagcctt ctccaactcc tgctggcgtt tcttctttaa atctgccgat     36360
     ctcttagcgt tttgctgttt ctgccgcctg gcttcagcta tatctgccat agcctccgta     36420
     gcacttagga agttcggatg attagtgttg ataaaagctc tgtgtatgtc gattaagctc     36480
     tcaacgtagg atctagttgg acctagcctt tcacgaagta gatcgctgac cacttcaatc     36540
     aactttgcct gcaatctggg gtaccttgcc aaagcaggac ttccgcaatt gtggcaaatc     36600
     ttcatcagct cctcataaac cagctcgaca cagcgttgag aagggtccaa aagaagctta     36660
     atttggggct tcaccagtag atcaaaagca agctccggaa caaaaagaga aggcctgggc     36720
     ccagtcgaat ttctgattgc tgttcttata tcagtgatgg agagattggc cgtggggttg     36780
     attgacttca aagagttacc aaaaatgttg ttgtatatgt aatagatccg ggcaccgcca     36840
     catagctctt ttgtgctgat atcagaagaa gtaccttcaa ttgacgaaac gaagtttgta     36900
     gcaaacttgt tcatcatttg caacacaagg ccagccctac tctctggaga aattatgtta     36960
     gagccgccgt aagacgccaa ctcctgctct gtctggccga ttaaggtgtt aaggcgcgct     37020
     tttatgtcag gcagcttctc tctgatgtgg ttgagcaata tctggttcag ctttttggcg     37080
     aggaagcgcg tcccacattt agaagagatc gtccggtaag ccgggtgctt gctgaaaaac     37140
     tcctcctcgc gggccagcgc atcctccaca ctcttgttct cctgaatatc ctgctgcgaa     37200
     cggttgacaa cacccacaaa gcctagtctc agcggataaa gcttgcccgc caaaatatcc     37260
     catgcattcg tgcccgagtc catcaggtcc aacttcgtga caacgccaat agtccgcttc     37320
     ccatgcgggt ccacgtcgcg cgcaagcttc agtgactccg agttcaccaa gtccacgttg     37380
     gcaggagaca ccgcaaggat aatgcagttc ggcttcgcca cgtactctag aatcagattg     37440
     cggatttgcc gctcgatgtc tggcggctgc tctccaattg gaaccttcgt gatacccggc     37500
     aggtcaatca gcgtgaggtt cagcacatgt ggcgagtata tcttcaggtt gatcggaata     37560
     cggctgatgc ccttgttctt gcccgcaatg cgcgcggtct cgttctctat ctctccccgg     37620
     atctccgtaa aatcatagaa ccgccgccca ggcaggtgca gaaactcccc ccacgtgtca     37680
     cgcgctccgc tctgcccccg cagccggttc tccagcgtcg gctccgcctc ctcggccgtg     37740
     tacgccgtaa tcagtggcga gtccgcctta atgttattta actgcagcac cagcggccgc     37800
     cgcgtcacaa tcccggtccc ccgtggcaga aagtcccggc ccaccagagt ctccagaatt     37860
     gaggacttgc ccgacgactg cgatccgatc acagccagca ctggtaagtc caggctgtca     37920
     attcccgcat cgtacatcac atcctgcagc ttgttcacag taggaatcag gtcctccaag     37980
     ctcgccattg tgtccaactt taccaatctt ccgcgcgtgc tcctccaaac ctctcgtagt     38040
     tcccaaacct attgacacag gtggaaagcc cttaacagca cacccaattg caactaacag     38100
     cctctttttc cggccctctt cgatgcctgg ctatataaac ggggagccca cgcggaaaaa     38160
     agaaaacctg ctgtttgcgt tttcgttgtc caatcataac ggttacgtag aacgtgaggt     38220
     gatctggagc aatctggctt tgtagggttg gccgatgacc agagctagca gcgcggcttc     38280
     ttgcggacgc agcgggcggt taggtcgttg actgcgggcc tctttgtggc atcttgtgtt     38340
     ggcgcggggc gcggagtggt gctgtgtgcg ccacggacac gcggcatcgc cacaccgtag     38400
     cgcagaagaa gacagtctac gaggttgcga tgggcctcgg aggcgccggc cgcagtagcg     38460
     tattcttcgg cggttacgta gtgcttgacg tggacgtagt cggctggcga ggccggacag     38520
     agcaggtctt cgggggctgg gcgcgcgcag ggccccgtgt agaggccggc ggcgccgacg     38580
     acgccgacga cgacgccgag gcggaactcc tgtctggcga ccagctcagt ccagaaggcg     38640
     cgcagggacg ggttgcggcc ctcgtgggcc aggtcgtcga ggaagcggcc cttggggtcg     38700
     tcggggaaac gcgggatgcg cgtaagggcg gggtcttcgg cggagccgcc gaagacgtgg     38760
     cccacgcgcc agcgcgggaa gcggacggga cgcaggtagt gggcggtgac ggcggagtcc     38820
     tcaccaggga tgagcagggc ggcgtccgtc gctgggtcaa atagggtgac cagtaggtcg     38880
     tcgacagagg ccagccacca acgcagcaag cggtccccag ggagcacgtg cttggccggg     38940
     ttctgcgcgg actctgagaa gaggtagtgc ggctcggcgc gggtgaagag ggcgagccgg     39000
     gtggtatatt gtggggggca cgggaagctt gtgtagcgtg cgcggtctgc ggcggctcgc     39060
     acgtcgaggt tgcccgtgcg gtagcgctgc gcgagtatgc gcagcgcgtc gacagcattg     39120
     gtggccggcg ttatgaggcc cttgcaggca gcgggatcga tgcgcatccg gcggacgcgc     39180
     tgcaggtagt ggctagggtc gatgctcaac aggaactgca gcagcgcgcg cgtagcgcgg     39240
     cgcacatcga cccggacgtc gcagtagccg ttggtatctg ccttcgacac gaagagcatg     39300
     cggtcccccg aggtaccttc aatgcagatg taaacgacca cttgcagcgc gtagaacact     39360
     ttggagttgt tgctgagtgt gaagaaatgc tgtgcggcga tggtggtcgg tgagcagccg     39420
     cttgcctcgg tcagcggggg gcgctcagtg gctgggctct gcagatgcag tacatcgaag     39480
     tcgtgccctg ccggcagtgc ttctgcgagc agctctttga gtcccatctg tgcggtgcaa     39540
     tgagccgggc gtgcgtgacc tggtcaaagt ttccttggcg cgccagcagc gcgcgatata     39600
     ttacgcattg ggattgcggg ctactgacgt atagctacat actagtctac aaattctcat     39660
     agtcttcggg gtaaaagatc agacgctccg cgccagcctc ggtcagcacc accatacgga     39720
     tcacaccgcc ggaggagccg tcccacttga tggcttgcga cagcgagtgc ttcatgaagt     39780
     ctatagtctc ctccttgctc atgtcctcgc ggaagtgctt atcgcagtac ccgtatatga     39840
     acgtggatcc ggagcccgca atggcatatg gagccttgtg cacggagcct cccagcggta     39900
     tgctgtacac ctcgccctta tttttgtcgt cgtagcccgc aacaatgatg ccggccgtca     39960
     ggtggtcctt gttttcgtag cagatcgtgc tgaacagcga tgccgctgtg ctggcgctcg     40020
     gctcaccgta ctgcatcgtg tacagctcca gatagtgctg caccatgtcg gccaccgcct     40080
     gtgtgtccgc cgcagatccc gaccgacaac accagatgcg gtcgtgcacc cgcgttagct     40140
     tgtctgtgac tctgttcgca atgtaagttc ctgtggttgt gcgcgagtct gcaccgagga     40200
     tcacaccgtc ccggaacttc accgccatgc tgcatgtctg ttagtattct ccccgtttgc     40260
     caacatagcc gcccgtcaaa catacataga ggttcccaag ctcacctcgc ctttcttcag     40320
     ccggtttata tccacttgaa tgccgtccat tgctaattct gccgctgctc caaggtctcc     40380
     cagttttcgc agagaacagc ccttgatgat gttgatagcc caggtcgctt ttgccaccca     40440
     gaagaagagg aggactatgt tcaaatatcg tcctttacgg aatctttgga cgtatacata     40500
     aaacgacgtt aaaatatggc gtgcatggcg cttggcagtc tggacacaac tactggagcg     40560
     gtagtgtcat attggcacta tctcaaaggg gtttatagtg gcaggcaggc atggatgatt     40620
     cagcaccgtc tgcaagcagt gatgggacaa tgcttcccga catttcgtat gctggaacga     40680
     tggaggagct gggctactcg acgaatgatc tgatagccag cgacgcgcat tactctacag     40740
     ggtcgctggt gcataagagc atccaggagc taatgcagaa cttgaagatc tcgcgaaatc     40800
     ggcggtactt tgagccttcg ctgactggac aggaaccgga gtacatctac tgggacaaca     40860
     actttctaca gcgcagctcg gggctgtcga accaggcggt gctgtcgcca ctctttgagg     40920
     agccgtacga ggatcacagc ggcggtggcg gcggcggcgg cgacggcgga ggggtagagg     40980
     atgagcagga taccgtgctg caacggctgt acaatatggt acaggtgttt ctggtgcggc     41040
     atggcttgtc gctggatttc gccaaagtgc tgaagaaata cgtggctcta ctgcatgagg     41100
     gaggttcaga gccactgcag gaccagtaca ttttggcgct gcagaatgag ctgcaacaga     41160
     gctacgagct gtcgccaatc atggattcga ttctcaccgc tttcctactg cgcccagaaa     41220
     acatccctat gaagttagcg ctcgtggaat acagacacca gttgcaacta gtgcgaaagt     41280
     ggtttttgag ctggcgcctg aagtggaaca taactaccaa cctgggcgtt tgtgagtcca     41340
     tatggggcaa ttatctgctt aagaaatatc tctaccgttg gacggagaag tacaaactgg     41400
     tagccgaata ttgggaagaa gacgcttcca acgcggacga acttcgtttg acagcctcca     41460
     tgttcgacac ctgggcgaag caatacagta tccggaagac aaaggagaag atggctgata     41520
     actttcatgt ggtcgactat gtggaacggt ttcggagtcg ctatatgcgc atgactgagt     41580
     gcaatgataa agcggaagtg tttcacgcgc ataatctgaa gacaaaattc cttgctcgat     41640
     ggcgccttgc cgggagaaca aagtctgtcg cgccagtatt tactgtactg acgcagcgga     41700
     tgacgcttgc aaaagtatta cagcatttca actcgatgaa cgaactaaat tcatttgggt     41760
     gttttgcaga gaaggcgtta acgttgaggc cattgctcat aaaatgggtt tcaagactgc     41820
     agcggcaaga tatacagcaa aggcagttag acgcggcgga gctcacattc gttaagaaga     41880
     aggcatataa gatatggcgc aagcagtttc actacaggct aagcgaatta catttgcagg     41940
     ccacgcttga taataatttg ctagagttta ttttcaatcg tgtttggagc ataaggtata     42000
     cggagaggaa aatgctctac caagttctga gtgacaagaa caaattgctg atgaaaaaac     42060
     aattttctgc atggcggcta accacttcgc taaaagtcaa atcagagacc caacgaaata     42120
     gcaatgttgc caaaaaagca ttgagggcgc taatccttgg tgccaaatta caacaacaca     42180
     ataaacttac ggaagtgaaa ttgatttcaa gttacctatc tgtatggagg aaacggcaca     42240
     cggaggagca gaatgtgaga gttgtaggga aaatgctagt tcaacgttat tgggaacacg     42300
     aatttaaaag aaaatacctc gcatttgatg atttaaacta tatcacagat aaaagttacc     42360
     actctcatct tgtaaaacta atgttttcct gttggcagca ggcttatgca cggaaggcag     42420
     tattgtatga taaagcatcc ctcttccaac ggctaaaggc agctcagcgc ctaaagaaag     42480
     cggtggcaaa aatagacgct gtccgtttca gggaaacata ctacgatgac attgtgtcca     42540
     acatatatct caagagatat gtcgatgtct ggagacagaa tgcaagtatt cggaaggatg     42600
     ttagattgga aattatcttg gacaattatg aatgtaaaaa taatgttaaa ctgaagagac     42660
     gattcctccg taagatgaag gagagatgga gtttctactc caatgaatgt gttcgcgtcg     42720
     caaatcgcaa gaacaggcgg gatatgggta agttactgct ctctcgaatt atcggcaaaa     42780
     tggaacttcg aaaactgtgg ctgaagcagg ctgggcggct acggtcatcc atgctcttgt     42840
     taaacggctt catgtattgg ctggacagaa tggacaaaat acaacagctt tatgcagtcg     42900
     tacagctgaa ggttgaggaa aaggatgtga acctagtagt gaaatgcatc agcaagtgga     42960
     atatgaaaac actgaaattt aaacgtaatg aagaaacagg acagatgttt cgcagtcgtt     43020
     ggaaccgcgc gcttctacgg tacgtggtta ctttgtggaa agataagaca aagaagctcg     43080
     ccaatcagcg acctcttgac gtctttaggc cttaccgcaa cagcatctca cacgacttca     43140
     tgactccact gaaggcagac aaggtaacaa tcccaggttc tgagcgtgtt aagaagaaca     43200
     agatggagcg catcaagaat cgttaccgag gtgctcgccg cgcaataccc agccccatca     43260
     agtcctctga catcttggat tccacgacca aacggaagct ctctaagatc ggcaaaattc     43320
     agacgcccct ccagaatgca tatgtcgatg accctaatac cacacctatt ccgaagttaa     43380
     aactggaaca agaaggtcgg cgttacagtc tgcgtgtccg taatatagac ttcaatcgta     43440
     ttcccgagct tgatccattc tcaaggcccg actcccgtga ccgtgcttcc actttcataa     43500
     tcgacaggcc cattctacct gatgatacct ttatagttga tgagtcgccg acaaagatga     43560
     aagctccaag atccccattg agctgaaaac tttgctaggc attgcatatg ggagctgatc     43620
     gtgaagatga tcatctcctc aggtcctttt tgtactatat caatcatctg gagcatcacg     43680
     gcgccattgt gtgtagtgtc gtacataaag acagttgaaa tctcgataca tcaggccctt     43740
     gattgagctt ttgaacacgc tacttactgc ctggaagcga gcagacattt tagcgctaaa     43800
     acagtatagg gctctagggg tctaacatga tgatattaag ttatccaatt gctttagtgc     43860
     tatctgtttt atgtcgcttc gccgttggtg aggttgacgc aagctttacg ccgaggccag     43920
     tttgggagaa catagattat gcccggaagg ttaatttagt gaagtcttat cctcacgagg     43980
     cggtacattt gacgataaag aatactggat cccagccgga gagcatttac tattttggaa     44040
     ttcgcgacga tgtatatgag aagctgtcca tgtttgcagc tttcttcaag gacatgaaag     44100
     tatatgtgga caatgtgccg ctacctaaaa gctcagaaat tgatggccaa cctgtgaggt     44160
     acattatgat taaactacct gctccagtag agcccggcga aaaggtgcag ctagaggttg     44220
     attacgcgca caacgcaggt cgggtgccct tgcaagaacg tatcacgctt ggatcaggcc     44280
     attatatgcg cttaactacg aacaagctgc ctttcacatc ttatccgacc gcgaaatact     44340
     ctttggagtt cataggtgcg agagagttaa gagagcttgg tgcaacaagt tcaacgccgg     44400
     ctggtgacga ggaaaagcag tccttaaaat tatcaccatc tcttaacact gccgataccg     44460
     cttcagcaaa cgttactgta acatatcgga gagacttgcc attcccccgc gtcgtgaact     44520
     tgcgtaggga tatctgggta tcgcattggg ctggtacgct tcaatttgaa gaatactatg     44580
     agctaactaa tgatgctgca aaattgaaag gaggtttctc gagagcagag tttattaaag     44640
     gacggcatgc tttaaaaact ggtccttatt tagtggggtt tgagatgtat ctacctacgg     44700
     gtgccacaga gcattactat actgatttgg ttggaatggt gtccactcat aaagtggtgg     44760
     atgaccggtt tttcttaaaa cctcggtttc caatctttgg tggctggttc tacaacttta     44820
     ctgtcggttg gactaatgaa ttgtcgcaat tcttacacag cgatgcttca aatgaggagc     44880
     atgtgctccg tgtacctatt ctaaatgggc caccagatag tttttatgac aatgttgaat     44940
     tatccgtata cctcccagaa ggcgcccaag tcttggatgt gcagttacca ctggctttac     45000
     aagagaaggg tgtcaccact gagtattcct acttcgacct aacaagtggc catgtaaaga     45060
     tgacagtcaa gtgcaagaac ataattgaca cagtacagaa gggaactatg ttcgtgaagt     45120
     ataggtattc caagcaattg atgtactgga aacctgttcc tattgcattg tacgtctttg     45180
     tattcctggt atcttacttc ctattaaaac gggtggattt tagtatcggt aagtaaggtt     45240
     atggaagtgt agaggataat atatacgcaa gaaagaaatt gtcattttta gacctttata     45300
     tccccctcca tattatcttt tcaatagcct catacgattt atattggtgc gttctgaaga     45360
     tacctatgta ttgacactca gaaaccgact gcacaaacca taccaaagct aatttatcga     45420
     atatttcatc gtcattagat ccagaaaaga atttcaccag agtatcccgc tgatcaggtt     45480
     gtaattttag ttcatcctgc tcgacagcct tcctgagtag ctcgagtatc tccttcgaag     45540
     gcagtgtctc tttgaatgcc gtgaagaagt cataaacatt aatgaccgcg ttggcctccc     45600
     tgtatagctt gaaaagtctg caaatgggtg gatccagtaa ctgattgagt tccatttcta     45660
     atttattctc agcagtctgt aacctcgttg gagctgggaa aattctctca cagttcaaaa     45720
     ggttgtcttc catgttagaa cgaagaaagg gaaacaatgc ctgagtcaaa agtccattgt     45780
     tgttgtcaag ggtgaagagc tcttgaaaga ctatctccag gggttcaaag ctcaactgtt     45840
     ccatatgccc attgcattgt ggccatgcct tcagaaaatc atcaagggtc cctaataaca     45900
     tatgatggta cagctcgatg acgttaaaat ccgttacgcc caatttctgc tccagaaagt     45960
     ccacgacgtg gttgagatgt ccatttattg gattctccct aacgagaaac tccgcaaaga     46020
     actcctccag ggccttgtca cgattctcca gtaaggataa tatgtcgtct gatggtgcct     46080
     gttcctttat cataatctca atgaatgaca taaatgtatt acatttcacg agtccctgaa     46140
     tatacttgtc atcaaaatgg tttatattgg tcaaatcgat gaacattgag tatggatttt     46200
     gaaagaaata tgccatcagc gaataatcca ggattttaat cagtaatgga agattctggt     46260
     tagacttgtt gttcatttta tccaggataa acttaacgaa cctgggcgaa agattaagtt     46320
     ttccatccac agtattcagg aagcttttaa aaacgctgtt gacatattta tgtcccttgt     46380
     tatgagacaa atccagtttt gtaaagttct tctttagcag tcggacacag ttctgtttca     46440
     agttcttctc gaaattggat atgttagtat tgatgttaaa gacaaagcat attcttacct     46500
     gatcattctc caaagtggct tgtaatagcc atataaagtc ctctagcacc tggaagtaga     46560
     aagagtctac atccttgaag ttgaagataa ggttaagccg cttcggaaat ttcttactga     46620
     atcgttctat catagaaagg tcgtacagaa ctccatcaat ttcctcttcg gcctcagtga     46680
     atggagtagc ggaccctgtt tgctgctcat cagattcctc aacgtcaagc acctcttcgc     46740
     cgtcagcttc gtcctgattc ccatgtaatt ttgtatctag agcagaatgc aatttgaaca     46800
     ttgaccgccg taggatcatc cgaagattcg gggattcctt aggggtaaga tccaccacga     46860
     cgtttatctg cttattatca tcttccggag cctccacctg agtcgatccg tctgcaccca     46920
     gcagaaacag agtactaaaa tattttccat tacactgtga aagccctttt gcaatcgccc     46980
     gtggaatgct cccatataca tcgcgctgga tttcgtgcag aatatcgtct acctgagagt     47040
     gaaattcgta atacaactgg tggtacagtt cccatctttg cagcaccatg ctttctggct     47100
     cctcgccatc gaaaagtctc acaaaaggca cattattcgt gtcatagcta tctagttttc     47160
     tgcgcttggc gctgggcaca atggtatagt gagtcttctg actgtcggcg aagtcccgca     47220
     cgttcatggc cacttatcag tgatgcgcat gcagtgaatg ccatcgcgta acatttgaaa     47280
     aatgaacttt ataagtgaaa ctcgatagcg cttactacgt caagcatagc cggtcaccaa     47340
     gaggccagac tcatactccc ataacaaaag aagacatgtc ttagttacat ctaaatatcg     47400
     tatatctcat ctccagtctg gcagggtttc tctatagtca gttcgaaata tgccgttaca     47460
     ggaatgctca cgtatggatc gttaagacat aaagggttac tctacatccc atacattctc     47520
     agactcgcca ggtagtcggg gcacccgtac gggctcccaa tcttggtcgg cgagaccttg     47580
     taggcgataa aactcctcct tcaagtcgac tgtgcgacgg ttggctctta atttaaccag     47640
     ttcatcctcc tgcacggatc ggaccttttt atcttcacgc tcgtacttta cagcggtgaa     47700
     gtcggaaaga cagtaggagc ctacagccat cagcgtgcag aagggcactc cgtagaacaa     47760
     aaatgggtta cgccgcagta gcttcaggta gcgcccctgc aaactcttct caaaggcagc     47820
     catctggcgc ttggatctga acgtcctgga tcccaacgac atggtgcgga ggcttaattt     47880
     ggacctgatg gggaagatat gtgaagttca tatgtatgta agatgctaag cgagaagatc     47940
     gtttagttgt accagggcta tcacgtgaca gtgcctcaca cgacgtcaca aaatcataaa     48000
     tgtcagcggt tccgcttatt gatattttaa gagattgaat actgtttcat gaggcatagg     48060
     gccaagcgta taatgaatag atcggcggca ttagagaacg aatactttca ctatttttcg     48120
     aggttcattt acagctatgt ggatctcagc gataacaccg ctttgctcat gttgaagttt     48180
     tatccggacg gtgtacacaa tccataccgg acaccctata attatacggc acaaatatac     48240
     tcgaacttcc tcaatagtac gcgcacagga tctgctcagc gagactatgg tatcaatttt     48300
     gaaacctttc tctcgggtgt gcttatatct gtgatatact gcttgtgcca gacactcctg     48360
     ttctcgtatc tccgcacccg gctcccgcga atctaccagc ccaacgtgtt tctaacggag     48420
     catccagtgg caccagtggt attatttcgg aatttcaaga ccaaactctt cagttgggtc     48480
     catccgactt ggaacacgcc gttagaatcg tataaaaaat atgggctcga ttcctttttc     48540
     tttctcaggt atttgaaggt cctttgcctg tacttcctta ttctctcggt catgacaatt     48600
     cctgtcttga ttccaattca ctatacttca gggtaccagg ttctggacgt gcccggcaat     48660
     tcccgcgaat ttggtattcg gcatcgccat acaaccgagg gtgacagact tcttactcaa     48720
     ttctcgttga agtcaacggg gttagatgaa atatccatgt caaatatttc gcctcggcat     48780
     tcatcacgtt tgatctttca cttcattctc ggcatatttg cagttgtttg gttccatgca     48840
     acgttgatca cggagcttga ctacttcgta acacagcgca acagcgcctt tttgggggaa     48900
     gatccggccg cccaaaagca gcagtgtgct atgtttctca ataacatacc agacatgttc     48960
     atgtccagtg agcgtggcct tttggacttt ttccactcaa tgattccgga ttctgtgcac     49020
     cagattgtgt ttataccaaa ggaatacaga gaacttaagg acaagcggaa attggaaggt     49080
     aagttattca atgagataga gcaagtatgc tacgatatta ttagaaagag attctacatg     49140
     tctcccaaat ctgagtccgt ttatctgccc tataaggaag aaagctccac gggaagcacc     49200
     atactggccc ccactgcatg ggcatccgtt gaaaacactt tgccagaggg cgtgcttccg     49260
     cattcaacct ttctcaatag ttatgatgaa atctttaaac ctaaaaacac tacacaaagt     49320
     gggttccgtt ttaaacttgc aagatggaaa tatactctga gaactatatt gacatttgat     49380
     ttcatctttg ggttacgaat gaaaatatgc actttaaaat acaacaaact aaagatatta     49440
     attccatgca tagtatatga tgttaaccgt catattgaga agaagttaga aagattagag     49500
     acaacgataa cgcaatataa ccgtcttaag caaagaggtt ataaggaaat caccgtatat     49560
     cactcagaac aagaacggcc accaactaga aatagtagtc caccactaaa gtctaagcaa     49620
     gctgtagtgg tctttaaaaa tgttattttg gcccactttt ttgatcaatt gcttctttcg     49680
     gcaagtacaa gttccatgaa ggagaagata ttaggcatca aaccagagga catacattgg     49740
     aaaaatataa ccctaactaa taggttggtc ttgatgtcgc gggttgcact ttcaaatttt     49800
     ctcagcgtga tggtaattgt tggatgggtg atacccgttg cctttgttgg tttgatatct     49860
     cagatacctt tcttggcgaa acttgttcca ctccccagtt ggagcgctaa ttcgacttct     49920
     attctcgaca aatcactttc aagtatcgtt ccagtgatga ctttgatatt tttgactgaa     49980
     ggtgtcccat ttttgttcag atggttcggg tggttaaaat gctgcaggtc aggatcttcg     50040
     acggagttgg atgttcagaa gtggttcttt gcctttttat ttgtacacat ttttctagtg     50100
     gtgacaattt cgtcagggat ttcagtgatc gtggagaagt tggtgaataa tccagttagt     50160
     attccagatc tacttggcac caatttgccc aaaagttcta attttttttg ctctttcatg     50220
     ctcatcagag gattgtcata ttttggaggg aattttatgc aggtaaagag tttgcttttt     50280
     gaattattct actatcgctg gaaagtatac accccgagag ctgtattcga gagaaacgta     50340
     aatgtccaac aatatcaatg gggatcggta tacccaatgt tttccgtgct tgcatgtatt     50400
     gggatcatct attgtgttat ctcgcctata atacttttgt tcgcgagctt ttcatttgca     50460
     ttggtcatgt tttcgtttaa atattccatc aagtatcaat acaatcccgt taacaactcc     50520
     gaaagctatg gcaaatatta tccaacagct ctaatgcaat tgtatgcggg aatatatttt     50580
     ttggaaatat gtttaattgg tttattcaca ctttcgaatt gttaccggct ttctattggc     50640
     atgatcatag tacttatatt tacaataagt gctcactttc agatttggag caattacaag     50700
     taccatcttg accacatgcc tgcccaactt tgcatggagg cgatacaaaa cacaccttac     50760
     aactttcgca tccctagtct tgagggccat gagcgccagg tgtggcttcc taatgacacc     50820
     gtcggagtgt cttcttcatt gaagatctta ttagaagaga aatatgagct accttgtcag     50880
     cagaatgatt gccatttgga tgaaaatgga aagctagtgc ttacaggtta ttcgtcatag     50940
     atagaatatg tacaagaaat gtatctacac ctttcagtta ctactcaggg gctcttgatg     51000
     gatcctcctc ctgcatgtct gatttttcct cccgggtgtt cttgctccta ggccacatac     51060
     ttggcagctt tacaaattgg aaccgcggtt ccacgcatct atccataaac cacttcttta     51120
     tttggtattc gaccagactg ctgatcttcg ggatattttc cagtttagag cgagcgccga     51180
     tcaacgactt aatgtcaaat tccatgcggt aatcgggcga aaacgagaat accaaatagt     51240
     gtccctcgct atcgcctgca tctgtgtcag ttgtcgccgc catcgtcggc acaaattcct     51300
     ccgcagtagt tagagaaaca gtgaggcacg cctggaaacg taacatggat acagtcagct     51360
     tcaccggcaa ggaagccgtc agatatttcg gatagttcat caacaacctt gtctcaattc     51420
     ccagcgtcaa tcgatcgctc aaatcaatat caattttagc ctccagacgc ttcttgttca     51480
     acggcggtga atacttaatt ctgcagttcg agaaaatcgg gaagtcatcg ccgatatcca     51540
     gctctgtaat cttcacggca tccaggtagt tcggtagctg gcttgatttc cggctaataa     51600
     agtcgttgag cgaatgcaca atattgtctt tctgcagcgc ctcctctctg aatttttgga     51660
     tcgtctgcgc tattagaacg ttgaaccagt ccaatgactc aggcgagtgg gtttccacat     51720
     cgtagtatgt cttctccagg atcgcattga tctggcgagt ccgttcgttt tctgagtcct     51780
     ctgcaaattc cgtaccctcc ttcccgccac gcttgatcag tgtggacaac agccggctgg     51840
     tggtcgacgt cagcggcgaa cctgtgaatc cggagctgcg gctttcagca gacgacccgc     51900
     cgccgccgcc cgtcttcgcc ggcccgtcgc tgaagataaa gaacttaata aagaagatca     51960
     gcacgacgat cacgctcagc tgaccaacta ccagtccctc ggcaaacgac ctcgacgaaa     52020
     acgtctgccc cggcagcatc ggcggcccca tcgccggata ttgcgccgca accccggtcg     52080
     gcgccgcaaa aacacttgta tgcgctgccc cagtctgttc agcctcgata attcgctcca     52140
     tcagcagctt ctgcagatgc atcggcagca tctcccttac atattcctca agagagatca     52200
     tctgctcgct gctgtgcgtg gcacgcgcac ttgtctcgct ctccatgccc atccacccat     52260
     tgtagcccct gttcacgctc tcagactgcg acaaggtatt ctccacgcct ttcatctcgc     52320
     cgcacccgtt cgcagcactc gcaagctcca gtgtgggcct cagttacgcg caagcatctt     52380
     ggccggcagc cacgcacgtg acaaatgtta cccggataaa aagtcagaca ccaagcacag     52440
     ttacccgacc aacacgacgt tgcaaaaaat cccgacaccc ggctattggt ctgacgatcc     52500
     tcccgctgcc aagcgactac ctagtttctg tgtcatgatc ttgcgcatcg cctggctgat     52560
     gccgtcacgc gcacgctgat acgatttcag aaatcaagca gccgcgggca ttggtaggcg     52620
     cccggcacta gcggtgtaac agaagcatac tctacgaaac ataaatttac aatccagatc     52680
     tgtcttgtct tgagccgcca gccccgaact ggagcagata cgaagctgta gttaattgac     52740
     gttgccgcag gcaggtcatt gcagggccgc tgcgcggacg taggagcaga gcggtgtcgt     52800
     tttgtgtagc gaaaagtgga agtggatgct ccgatatgca caatttgtga ttctatctat     52860
     ataaggacat gcggtatttc ctaaatggaa catggcgacg aacagagaag ctaaagcaca     52920
     cacgtgaagc atacgtgtaa gcagcgcgca tattcgtaag catcagcagg cagagcacac     52980
     gcgctgtata accagagggc ataacgcaga gcggtcgaaa tgtcgagatt ggatcccggc     53040
     aagcagaacc tcgaggtcaa gtcgctagac cccaatcact cgcggttgaa tcccgaagcg     53100
     tcccggcttc ggatcaacga catcatcaag gacttgagca tcaaccatgc gcatcccgtg     53160
     tcgccgcagg cgaacacttt gactgtgttg agctcagttt tcaaaaactg tgacgagcaa     53220
     gtgctccttc agtcgttggt gagtaactcc tatttttggt gccgcttctt cgcattggta     53280
     gccaagtatg cgtacagcaa cagcttgctc catgcatcgc tcgtggtgct acgagcgaca     53340
     gagcacatgc tcctcacgat gaagggtgta cccagcgaca cattgaagac gtactgcgat     53400
     agcttccacg gcaacctcaa catcatctcc atctttgcag gggagttgat gggttctggc     53460
     gaggcgtcca agatcaacat ggagatcatt cgtgtggtgg gcaactacat agcatgcttg     53520
     aacaagctcg cgaagaagtc tgttaccagc gctgcgctag cgatggggga ggtatatctc     53580
     accatgagaa ccacaggctt tttaacagcg atatcctatc tcatcgagga gtcctctgat     53640
     gacaagctat atgactcaat cgtcaaagtt tttgtgactc ctttgcgttc catgaaggtc     53700
     atcatgacaa gcaaccatgt ttctgaagcc accatgaagc tatcaaaaga actaaactct     53760
     gctgtggaaa gcgcattcta cctgaacaag gcggccaagg aacagttctt ggccatcaac     53820
     gaagattaca gtgatccaac tacgctaacg cttctacaaa tagtcgatgc aatcactgtt     53880
     ttaagggatg ataacctttc gttgaaaaag cgcatggcag aacagttgat gtttgacaaa     53940
     catccatttc cgttgcttgc aggctgtgtt ggtgtgacgg atatgttatt taaccatttt     54000
     agtgtgaact ctgagaacaa ggacattccg cgtcatatta cacagctaat gttaaacaag     54060
     gatgctgtta tgtttgcagt ggtgcataag ttgacgctct actggtcatc ttctaaggcc     54120
     aaaagtagtg aggatctagc ctgcctctta gtgttactca agcatctgat ggacaaggtc     54180
     gattcgacgg tgaactcgaa tgcgggcgtt gacgagacgc cgattatcga gaagacattg     54240
     gatataataa acaacatgtc atatgaaagt ctcagacaat tgcagctgaa acaggtcaag     54300
     gcaaagcatt accagaagtg gaatcagtat ggatcgaatt tcaacactat gctgtcgcac     54360
     caagttgagg attacgtacg ccaacagagg atataccagt tacagacggg tacctgggtc     54420
     tatgcagagg accctaccag cgaccgcagg tataaacatc ctaaggttta tttcttagtg     54480
     ttatcagaca atcacaacaa tctcttggcc agggaattta aatatcgtct cgaaaagacc     54540
     ccgacagtcg accaaaatga gatattgaca tctgatgtgg agggtatagt tggaaacacg     54600
     acgctcatga ttccattgag gcgtgtgaca gatttccaat caagagaact caaatggaac     54660
     aaggaattgc caaaacatcg tcgtctgatt aacatcatca gcaaagctgt tttcaccgaa     54720
     gtccagctaa tgggcaagac tgggaaaccg ttgatcacgt tttatcttga taaccgcgac     54780
     gcctcattca tctggctaga tggtcttcaa ctgttagcat cgagtcaaaa gaaacctaag     54840
     ctttcaaagt cgaccaaaaa ccaaattgac actctgattg atatcagaaa gaatattcag     54900
     ctgattgggt tgagtgatta taatttttcc ttgggataca accttgcggc ttctgaggaa     54960
     gaacagtact atgacataga cacactaagc actctcacgg aagacttctt ctacgattaa     55020
     gatactgctc attgtctttt catagatata atgtataaac atttatcaac tcgtgtatgt     55080
     acgctttatt ttattggttt gtttcgtttg tgcctataat tatacgtcaa tatctccgta     55140
     gttcaacgaa gagactagat ggacggcgcc gagctagcat accgtcaaat atacaaaatg     55200
     caaaaaaagt acacaggagg catcatttgc gtaccttctt cttcttattg ccgcccttct     55260
     tttgtttcct gaatgcaagc tcttgattag ttgtacgatc cttctgggtc ttcttgtatt     55320
     gccgcgaccc tacttcttgt tgggcttctt ctcttttgcg cttcttgcta ttggtgacct     55380
     ttttattctt tgatagggcc tgcaagatgg atgagttttt cttctctgat tctgattgga     55440
     accatgttct tcttggacga gcattgatct cttccttaaa cttaagcatg ttctcaccct     55500
     tgcggatctc catctctgcg cgtagaatct ccttctcttg cttttcctcc tccaagattt     55560
     cgccaatgac gtcctccttg gcttgaacaa gtttgtgaat ttcctccacc tgtttccaat     55620
     cgactacccg accacacgcc cggccagaac ccttacttcc gtctacagac ttgatagcat     55680
     cctttactat acttctttcc tgggttgatt ccccgacaag ggttacagac ttaccttctc     55740
     tcccagctct tgctgtacga ccaactctgt gaagatatat ctcgtatgtt ttaggcatat     55800
     cgtagtttat aaccacctcg atcttaggaa tatccagacc tctggaagcc aaatctgtac     55860
     agacaagtac tggcacatcc agagacttga agttattcac agactgcaga cgttgttctt     55920
     gcgtcaagga cccatgcagt tcgcctgctt tcataccgag tagtccaagg ataacacgga     55980
     gcctgtgggc gacttccttt ctcgctacaa acacaacaat cctcttttga ccagtgctgt     56040
     ccagtttccg cagtaagtgg taaaggagtg caggcttcag gtgttccctt ttccgtaacc     56100
     gcacaaactc ctgcgtcagc ttgtttgcgg cctgctttgg agggtcaatc atgatcctca     56160
     caggcttttt caacgacaat gagatgagct gcttaattct tgaattcatg gtagcagaga     56220
     acagtagtgt ctgccgcttg cttggaatga gtgacatgat ctcattcagc tcatcttgga     56280
     aaccatcctc cagcatccgg tctgcctcgt caataactaa cacttccaca gagtccacgc     56340
     tgaacgaagc ggaatttctg atgtggtcga ttattctacc tggcgtcgca atcacgatgt     56400
     ctggccgcag cttcaacgcc tgttcctgct ggcgtaggtt cagcccacca accgcaagcc     56460
     caaacgtcag cccgctaaca aactttccaa gtttcttccc cacatctgcc acttggatcg     56520
     ccagttcacg tgtgggggtt agtaccagca cacgcgtgga tgcgatcttg gctggcttat     56580
     acaaaagacg ttcaattatt gggatcatga atgcagctgt cttaccggaa cctgtgacgg     56640
     cacctgctat cacgtccttc cctaacagag cgatcggtat agtcgcgccc tggataggcg     56700
     aaggcttagt gtagcccaat gcagctagac ccttcaggac gggacgtgaa agggagagac     56760
     tgttgaaagt ggaatgtacc acgtttttgg cttcctcgcc ttcgttcgaa ggcgcataaa     56820
     actgggccat ctcctctgcg gtgtcctctt cccgcgcctc ctcctgctca tcgccaaact     56880
     cgactccgtc cagctcgacc gcctcctctg cactgttgtc gctgtcctta tcagactcgc     56940
     tgtcactctc atccgctgcg ccagccgcct cccgctgcgc taccgcgccc atcccgaatc     57000
     cgtccagcgc cagttcctca tcgtcgcttg cgccggcagc gctttcggcc tcctccacct     57060
     cttcttcaga ctcctccaca cctgcaagct gcaccagccc tcccttccgg cggatgatgc     57120
     catccaagtc cacgtccttc tgttctgcac gctcaccgtc ccccacgaag tcccacccgc     57180
     tgaagtctgt ggtgccctcc gcgccctcat cgttaaaatg gaactccggg tttaagtctg     57240
     catgtgcatc ctcatcatct gcaatcactg cgcccccctt gcgtcctttc ttcgtcttct     57300
     tgcgagactt caccttcccc gccgtctcat attcgtcgtc cgacgcatcg aggtccggaa     57360
     tgtcttcttc gctgtcgcta attgtcggaa caaagtcctt gaactggttt actttttttg     57420
     tacccataat aaccttcctg acacgcgcaa tatgtctcca aaaggtctat ccagccccac     57480
     gatttctctt gatctgtgct catcgctaac ctcatcgcat cggaagttca aaattttcac     57540
     ctactgaaat acgtataaaa cgatatttga taattttagt gtccacgtcc aaaacaaaaa     57600
     cactgcaaca gacaggatgc taggtggctg caactaagcc tcggggaaaa ataccctctg     57660
     tttcgtcgga ggaataggct tgagtgcagt gtaaggttag acgtatatta tagtggtcgg     57720
     tacttgcata ttggaagcaa agttagaaag gggcattttc agctgcacag ggcggattct     57780
     cgaggacgca aagatcgaac aatagggggt tgggcaacat ggcgtctatc aggcggtact     57840
     tgcggattcc gcaggagttg aagccgtcgg agatattcag gcaaagctcg ctttcgccga     57900
     gcaagatcgt gctgcagatc gtgctgctcc aggtgttcta ctacctgacg gcgtacgtgc     57960
     tgttctacgg ttgggcgaac ctctgcggct acgagttcga ggcaagcaag tggatattct     58020
     cgtgggagct tatcgatttt tcgaactctc tagggctctc gttgacgttg ttgtggttgc     58080
     tggacgcgtt ggtgtgtgta ttctttttga cggttatcgt cgggcgcagc aagcttgcat     58140
     gggactttgc ggtgacgatc catgcgataa atctcctagt ggtgtggttt cacacgaagc     58200
     agcttccgtc gttctcgtgg tttttcctgc agctctgttc gagcttgatt ttggtgtttt     58260
     tggggacgtg gaccacgagg tggcgcgagc ttcgcgacac gttttttgag ggtctcatag     58320
     atcaggaacc tattacgggt ggggctgagt ctccctatca tggcagttct cagaacagac     58380
     agcagtttga gatgaaggac ttggaggcac agaaatagcc tacattataa atacgcttga     58440
     gatcattcta gcgccacggt gagactgatc attcgtaaat agcattttaa taacgtaata     58500
     tatcatacgc tggttatttc ggatgcagga ctccgaaata gtctgacaat tatgtactgt     58560
     taagttattt attttcagac ggcgtatctc gcttgaaacc tgttccagtg cacagcagat     58620
     ccagcagctc gaatactgat tttttcgtat tgttacctgg tcgacagatc tccaagccac     58680
     cctccaatcg ctgccgcagc tgcagcattg ctaccgtaga ctccagccta gtgacaagat     58740
     gatccaacaa ggatatccaa tcgtattccg tgttctggct cagcgcttta tcaacctttt     58800
     tatcacgagt catatgtgtt ggtagttgta ggacactatt gtcgatttcg atcagaccgc     58860
     cgttaacagt tgaaagaata ttctccaaag ttgtggaaat tactttcaat tggagaacat     58920
     atttatcgtt gacaatgttg gtgcttttct cccctgtgga catggtatgt ctagctgcca     58980
     attgcttggg atacgcaata gttatgaatt cccgagtttc cagacccttt aacttctgct     59040
     cccccagttc ttccagaacc aatccaacgt tatctaacat ttggatctca cgctctaaaa     59100
     cttcgcccac gaattcttca ccatacacct ccttcagtgg ctttttatcc tgtacgacca     59160
     tgtggtggag tttcattatt ttgtttaatt ccgctaggaa gtcgctgctc agtgtaatct     59220
     ggccaccatc agcggttgct gacactctag ctgccttgtt gaccatagga ccaaggtaat     59280
     ccattctctg cgtcactata tccacctccg gcacaggaca tccccagtgg atgcccatac     59340
     gaacagagag accctggtat attgtatttc cgctgtcatc tgtaatcata cagccggatt     59400
     tgatggatgt gatctcctct ggccaatcaa gctccagtag tttaagttga atcgttaagc     59460
     accataccag agcactggta ggcgttggga aagcaaccat aaaagcatca ccttcggtct     59520
     tgacttcgta tccaccaaat attcgaagtg ttctacgcat aatgtcgtta tgagctttta     59580
     ttgccacacg cattgcgttg gggaatagtt cccaaaggaa tgttgagttt ttaatatctg     59640
     tgaatacgat tgccagatgt ccagttggtg gggcaatttc tgggcgcaat ctgcgcagtg     59700
     aaacatcttc aaagtttaga cgccgaccca gtagatcgct tttgttcaga gagaattgtt     59760
     tctgcttgcc aacattttta ttaaatgaaa cgcacagtat ggttatatta tccgtacatc     59820
     catatgcaat cgcataatcc ttcattcttt cggctgctag cattggttga gacttgtttt     59880
     ccctagcaat atcgcatatt ttttccagac tgacataaga tagtaaactc tgggtcgcta     59940
     ttaccaacat atcgtccgta tatgttaagg tggtctcact aatatcaggt gaggcgtgaa     60000
     tatgtggtaa gagatcaaaa aatcctattg ctctggatat ttcggatact ccattcaccc     60060
     tcttattgtc gacatatcct ccggataatc ggattctttc aaactcttca gtatcagtag     60120
     gaacgtgttt gcgtgttaga atacgataat cagcgttgcc cttagagaga atagccgttg     60180
     cgtttccgat gttggcagta tagatatttt tgcccttcat gaatacaact gtgaccgacg     60240
     cgccactcaa tgaatcggcg gcagttaaga cgacagattc accatttgaa ttagtattat     60300
     tatttccatt attattatta ttattagtgt tattattatt attagtgtta ccgttactat     60360
     tcttgttatt accagcagca agtatcgagg aattaatttc tttgtttagt tgcaggaaac     60420
     tgaagcgtag ggcatcgcga atttcggctg gcgttgagtc accatatttc tccaaagacc     60480
     gcactaatat gcgatcatat atatctctta tgacctgtga tattttatgg cctgtgtttg     60540
     tattatcgtt aattccatca tacaaacaaa tcagacactc atcttcattt cccctgaaac     60600
     gttcaaaagt gacgtctctg gttgaaacag aatctgtctg ccccaacgag tccgctacac     60660
     catactccat accattgatt gtagaaccca ttgttcttaa tctgaagttg accccatcat     60720
     cagggactcg cgaagtgttt agggtcacat ccattaagcc taaaactctg agctgtttca     60780
     agacagtaag gtcagataaa tgcatattgg ttccatactc catagcactt ttgatttcaa     60840
     atctagtgtt accggagaag tttaggtact ttagctcggt gttctgtctc caattccagt     60900
     cataatggta gttggatata ttgtacttga gctgattcga accgacatca atgacggaga     60960
     gttgcgagag ttgcgagatc tctgctggca gggactgcaa attattagca ttcagcatga     61020
     gaactctaag tgatttgagc tttaagaaag cttcaccaga gagcgttgtt aaatgattac     61080
     ccgataagta gagttcagtt aaattctcca tctcaagttc tggcagggcc ataaagttgt     61140
     tatatgacag gtttaaaact ttcaacgtct taaaagtatt gaatatctcc cagaatttat     61200
     cacccatctg gttgtctgca gcgcttaaaa acatcaatga ttttgcaata tttgaagttc     61260
     cttggaaggt gcgatacaat tcatgatgcc cagataacat atttgaagaa atgttcacaa     61320
     aagtcaaact gagtgttgat agagcagcag gcaatgtcat caaattatta caatgtaagt     61380
     caagcatctt aaggtttttt agagaagcga tttcgtctgg aagtgattcc agtttatttt     61440
     tggccactga gagatgaact aacttcttca ggtgcttgat atctggaggc agaacagtca     61500
     agctattttc acttaattcc agtttctcta aacgtggtag ccgccttagc aagctctcag     61560
     gtaaaaccgc taactttgct ttgcttatag ataaacttgt caaatgttcc aagtagtcgt     61620
     tcttcaaagt gagtatcgat aatggatttc tctgcaattc tagtgttcta agcatcagct     61680
     ggtcatcatc aaacattgtg agtctatttt cggtcaggaa aagattctgg aggtttggta     61740
     cccgacattt tatagactca attctattat atctcaagtc caaggtccgc agagaagtca     61800
     ttttcgaaag atcattgaca tgtgttatgc ggttgttcga taggttaatt ttggctagtt     61860
     tttgcagctg attcatacta tccggtaagg atctaatctt gttataggac aagtctagct     61920
     gcagcaagtt tgtacatgaa ttaataacct cggggtagat attaaactta ttagaagaaa     61980
     tatcgagtag ttgaagactt tttaagtctt taaaccccct tggtagcctg tccaattcat     62040
     tgcaccttag attcaaaatt gttaaatttg taagcttaga catctggtcc ggtacccttt     62100
     taataaagtt cctttccaaa tcaagggtga tcagctttgt tgcctcacag atatttgaag     62160
     gaaatcggga cgctctaata ttgaccattc gtaaactgga aagcttaatc acactctcga     62220
     tgaaatccaa aggcaggaat atattggcat tattggatac atcgagactc tcaatgtcag     62280
     acgtatgttg ataaaaaata atcggcggaa tcgtaaggtc catgttacgc aggtcaacat     62340
     gaacgaactc acctttactg agcctttgct cttgttcata tgttaactgt gatgtaataa     62400
     cggggtggaa gacaaaactg aagacaaaac tcaagtcttc tatgcccata atgtttaaac     62460
     gatctgtctt cttataacca ttgaataaca ggagtcgtat ttgaattaag attggcttcg     62520
     ctgttggcct caataccttt gacaacttac cgactttaag ggaaacctgg tagttacctg     62580
     ggggcacgtt aaatttccgc tttatctggg gtatcatttc ctttacagta gtctccggcc     62640
     tacatgatag cgttgtaaaa gtatcgtccg tattaaaaat acggatcgtg tattttttgt     62700
     gatagtcaat atcactaaag tgattgtagt acttctctaa atgatgctgc agtttatcat     62760
     cctcaatatc attattttca agttcttgtg catggatcga agaggtggaa gcattgtctg     62820
     gatgtgtgat gtcttttggc gtgtcttccg ggttactcac gacggaaaag ctacaggaat     62880
     ctgagttact ggatacaatg ctatcagaac tcatgatact aagcggagac atatccctgt     62940
     ggattggaga tcgagaaaag gctgctgtca aacggctatg attgggtgag tcctccagat     63000
     ttgaataccg gtttggatct gcggacaagc gattgttatc gccagacgtt ccggtcatat     63060
     ccgaacgagg actgtagtgg tgccgatggt gccgatgggc tggattgtgg cacttctgtt     63120
     tttgtttcga tggcttgata acggggtcat caacatccca tgactccgga gccgtccact     63180
     gcgcagctcc cttggtatgg cgaacttccc tcgcaggaag cttctgtggc cgcggcatgt     63240
     gcacaacagg cttgccggcg tttgccatat ttacctccag attggcattc gtagtggtct     63300
     cagtctgttg ctgataggca ctcgttatgt cagagaggtt gttcaggtcc atgtctaaat     63360
     taaagaatgt tgtgtttacg cccgactcgt gctcgttgga agcctccgca ttatcccacg     63420
     gcacatgcac aggagagcca gtgctcctgt caccgccttg ctgggcagca gcgctcgatg     63480
     cgctagaaag ggcagtggta gtgggcgaca caggcttgta ttcctgcaac gagagcctct     63540
     gtccgtcagg aagctgaatt atcgacgcac tcccgccgct ggccgtcgac ccacgcctac     63600
     tgtccgctga agacgtcgat attgtgccct tactgtctcg cctggcttca tttccatgga     63660
     tgaatgtgtt caccttacgc cgcagcgaag acggcgccgc cgcgacgtcc gcatcagccg     63720
     ccgcggaagt ctccgagcca ttgatggagc tcttgcggcc ggtcaggcgc ttaaaaaacg     63780
     agcctgcgcg cgatggtatg cgccgtattg gcggaggcgc gcctgtggcc cgcgcatcgt     63840
     cgtcctcagc ggcagactgc atggtcacgt tacgcacagg ccgcagctgc tttgccagcg     63900
     gcgagctcgg gtgctggctc acgcgcgcaa agctcgcgtg atgcaacccg cgactgtgct     63960
     tcatatgtgg cggcaagtcg ctgcccggct ccacaatccg tccgccgctc cgcacctcgt     64020
     gctccaatgg cgcctcctgc gagttgctcg ataggctcga ccagctgtca tcgacagagt     64080
     cgcgccgcga ccccgccgcc agcccgtccg cgccgcgttc ccaacctccg cgcccatctg     64140
     tcctgcctgc agcccggcgc tcgcccgctc tgtgcgcttt tctatccatc gaattattct     64200
     gctcagcaat ccgctccgct aagcttctgg aacgacttca gcgtgttctg tacgacccgc     64260
     gtgctcttct tttacctgct agaagagctc ttcgccccgt tgcggctgtg gttcacgaca     64320
     atccgtgtcc atgccgaagg ctccttatta aaacaagctt gccgtacgat atgatattaa     64380
     taatcccatg gccctacgct gaactacgct aatgccgaag cccaagatac tgccgactct     64440
     cgggtccagc tgctaccagc agccaataac cactaagcgg ttgctgcgcg ctgtatgtgt     64500
     attcgtcagc atttttgcgc gttgagctat ataagtgaaa aaagctcaag gaacggacgg     64560
     tggtggaaga tcgtccaaga actgtagcat taatcatgcc tgaatcctct tctgtgccag     64620
     gtgtttcaca aggtagtagt accgacaagc caaagccatg ctgtgtgtgc aagcccgaga     64680
     aggaagcgag agacagctgt ctgctgttca acggcgtgga tgcggtcaag tgccaggaac     64740
     tggtgcaaaa gtacaaggac tgcatgaaag gctacggctt tgaggtgtaa ggcggtgcgc     64800
     cgcacggagg cgaggccgcg atatagcgta catagtggaa tacatgcgtg gccggatccg     64860
     gtagccaagg attttttggg cgggcgcagc ggtgggagca ctgctgactg ccacgccggc     64920
     atgacgggca gcgagaatct ggagacatac gagggccgcg tggagctggg gattatcggt     64980
     gggaccgggc tgtaccagtt ggggtgtctg gagccggttg cgacgcttgc gacggtggag     65040
     acgccgtggg gacggacgtc gtcgcctgtc acagtggggc gggtgcgcac cgagggtgcg     65100
     gacgcgtttt acgttgcgtt tatagcgcgg cacggcgtgg accatgagat cccaccgtcg     65160
     cgggtgccta accgtgccaa tgtggcgtgt ttgaagcgac tcggatgccg ggcgattttg     65220
     tcgttcagtg ctgtcgggtc gttgcagcac cagataaagc ctcgcgattt cgtgttaccg     65280
     cagcagatca ttgaccgcac gaagggtatc cgagaatctt cattcttcaa tgacatagga     65340
     ctggtggcac acgttccttt cggagagccg ttttcggagg cgtttgccaa gtacatccac     65400
     cgcttccgcg acgtgcttga gaatccggac tccgaggagc cttgtgaact gcacttcgac     65460
     cgggacacca ctgtggtgtg catggaaggg ccgcagttct cgacgcgggc tgagtcgaag     65520
     ctgtaccggc agtttggggg cgatgttatc aacatgagcg tcctgccaga ggcaaagctg     65580
     gcccgggagt gcgagatcgc gtaccagatt gtatgtatgt cgacggacta tgacgcttgg     65640
     cgggacgagt tggagcccgt gacagtagag acggttgtcg gcaatttaac cgccaatgcg     65700
     cgcaatgcaa atgcgctggc gtcgaaagtg attgctgcca tggcggcaga gcggccacct     65760
     ttcctgaaga atgccgacgg tctgcatggt gtagtacaga tgtccatctc aaccaagcct     65820
     agtgccattt ccgaggaggg tcaacggcag ctagactacc tatttcccgg tgatgcgtaa     65880
     ggtattacct aggagtgaca acttgcaagt atctacgaaa tgtagcactg gtatctattt     65940
     ctgatcgtga ctcaactata tcacaatctt tttcttgcac ttggggaatc catcatgtat     66000
     gcatacttgc tgctgggaat gtaccccgag cctggccgat tggcgggctg tgcaggcgtg     66060
     gcaagcttct gtgagactag tgacgacgca gcggggaaga ggctctctcg tcctcccccc     66120
     gtatacggta gctcagactg cacagttggg ctggggtgcc ctttcaaaga gcggagcggc     66180
     gtttggaggg acttgaataa gaaaggctga ggttgcgcgg cgtcggaggg aaggatatgt     66240
     tccgacatgc tgcccttgga ggagacacgg tgcaataagg gccgcggatt cgtcacatct     66300
     tcaattatgg agttccgtgt gtcactgctg gcactgactc ctagaagttc tttttggcgc     66360
     tcatttagcc ctaaatcgcc cactgtgata tgctgtgcct tcaccagcag catatacaac     66420
     gagagcgcga tattgatgag cagcaacatg tgtattaggt ggctgatgtt ctcaagggtc     66480
     cagaagcgga accatcccga gtcgaggcgc gcgtgcgggt tcagtttgaa gacgacattc     66540
     gcgtagaaga agtgcgacaa agactgatag ataaaccgcc ctgtgcggct actctggagg     66600
     aaaagcccca ggaacttgta caccaggttc catatcagca gtgtccatac attggcgatt     66660
     atccgcttga tctcttgttc tttgttcacg acgcgtcgcg taaaggccgc tagtgccgga     66720
     ttctcgtaat tgccgagtgg cttcgcactg ctggcatcgc agccgctgcc tactgtttcc     66780
     gccctcattc ctgtcgccat tcttgtcgcc atcgctactt cttgctctgg cagtagatcg     66840
     tcgtcctgcg tcgttggagg taagaccggt acatgtacta cctgtgattt ggctgcctcg     66900
     atagggtcac tatctaccct ttcgaacaca ttggcagcta ctacgcccgg agcacgcaga     66960
     ggaaacttat ttaccgtagg atctgacaat attcttgtgc gataaagttc gggggacagc     67020
     ttcacaactt tctccctcat agattgaaac tgctccctag aaataggccg cataggcgtc     67080
     tcgaaaacct ttctggctga tccagatatc ccgctcatgt ctcctggatg tcgatggtag     67140
     catgactttc tatctgtcct atactaaact gtcgcttttg tcttctgaaa aattagcgcc     67200
     agggatcagt cacgtgatca aatacagacg ttaccgccaa agttttctgt tgccaaacgg     67260
     cgatgcatta cccggctacc acgcggccac agttacccgg ccacgttacc cggcctactt     67320
     ctaatggaca ccgaacacgc caaaacctcc ctcaaactcg taatcctctt gtaacacact     67380
     aagaggtcta cttggagact cgttagattt ggcgcactgc agaaagactt gacgcccgct     67440
     actgctcata gaggctacag agctgtgcta cccgcgagaa taagctcaag aagaactatc     67500
     catcagcacc ttcctctctg ttaagaaaag ttttcaaata gtgacgaaag ggaattacca     67560
     ccgttgaaaa gtggatagac tgtttcatcg aagttacgtg ttcgtgccag ggagctcttt     67620
     tttctaccgc ttatcgaaca agcgctggaa taggagcagt ttagaaattt cgtagctatc     67680
     aaccgatcgg agggagcggt cagtagctgg gagttgtcac tgtgatagag gtcgtcggga     67740
     tcatatccag acagcagtgc gcagcggggt gctaactcat attgggcggc atctgtgacg     67800
     tctcagattg acgatagctg ggccatcggt cagggcacca ggtaaagctg cttgcagttg     67860
     catacaaaga gaacataaca cggtcatagg tatggggttt atttcttctc ttctatgttg     67920
     ttccggttca aaacagtcat ataataagag aagttctagt cctgctccat cagttgctag     67980
     gaaacaggta gggaataaga catcaatcag aagaagccaa gcatcgtcga aggcgtctag     68040
     ttgcaacgct ctatccagct ccgcggattc tatggataaa gcggcagagc tatgcgtgtc     68100
     accagctccg gcaactgctc cagcaggttc cgctgttcat tctgacaata tcgcacgggt     68160
     agccgctgtt acttcgacag acgccccggg gggatctgat actcggagaa atcaggacga     68220
     aggccaatct gatgcacgcg tgcaagagga cattattagc acaccgaacg tttccgaggt     68280
     gccggctcaa gaagctggta agctcggcag accagagtgc tcagaggagc aatgtgtcgg     68340
     acaaaagaca gaagagggcc ttctcaaggc tccggataaa atagccactt atgggaattc     68400
     gttgggtgtg gtgcatagtg gggattgtga gaagcaggga gggaacttag acgattgtgg     68460
     ttccagcgac aaggagacgt tttttggtga taaacaacta gtgactgttt accacggtga     68520
     aactgataca agcactggga ctactgataa tgataaacaa gatgtgtcca acaatgttat     68580
     acacggagta accactactg tcaaagagcg gcaagattct agcagcacag aaggcatcac     68640
     aacagatgcg agcaataatg acgaggaacc tcgccaagag gaggcgagga gcgatccaga     68700
     actaggttat gaaggcgagg ttctgctaga tctttcttct ttgcaaccgg aacaagcgca     68760
     tgcacccggt tatgatacat tactaccacc gcaaagacca gagtttcgcg gtagaaagtg     68820
     cttggttctc gacttggatg aaaccttggt tcattcgtcg ttcaagtatc tacacaccgc     68880
     tgattttgtg attccggttg agattgataa ccaggttcac aacgtgtatg tcataaaaag     68940
     acccggcgtg gacgagtttt taaaacgtgt tggtgagctt tttgaggtgg ttgtatttac     69000
     agccagtgtt tctcgttatg gtgatccgtt acttgatata ttagaccaat ataaagcggt     69060
     ccaccatcga ttattcaggg actcttgcta caattatgag ggaaactata taaaaaattt     69120
     gtcgcaaatt ggaagaccac tatcggacct aataatattg gataattctc ctgcatcata     69180
     catatttcat ccacagcatg cggtgcccat ttcatcttgg ttttcggacg cccacgataa     69240
     cgaattattg gatatattgc cgttattgga agacctttca tccaggaagg ttcctgatgt     69300
     tgccaggatc ttagatgtga ccatatgatt cttccatcat gactgccatt ggtgccattg     69360
     ttgacactag ttggcggctc agtaagactt cctactacta atattcatag cctcatttac     69420
     taatccaaga ccatcatcat aataatatac taataataat aacacaataa ttcgaatgac     69480
     tgtgcgtttg tcttgtctcc cgtcggcgtc ttgacttaca accacatcga tatactcact     69540
     cctctattgt tcccacgatt cacgttgttg atagatcctt ctctcggact gccggcgaca     69600
     gtcaatcgaa ctttcattta ctaatatcgc ggttacttca agtaatggct taccccagtt     69660
     aaaatgatcc tataatatta agggtaagat ttctgttatt aacgttatac tatgtctcgt     69720
     cttatatttt ctcatccttg tactcctttc tttacccact tattttacta cctaactttt     69780
     ttatcatcat tttacttctc tgctgccagc cttatctctt cgtgtcatta aaaatcatct     69840
     gcaagcaaag ctcaaaaggt gtggcaatgc gctgcaataa tatattttac cttaagatgt     69900
     ctaatatcag tgcgccggtg gctggtcccc gaggctatgt atgctttatt aaactctact     69960
     cagtatatgt tgaaattgtg ctgggtctcc gtcatccatt ccacttgagg gaacaatgac     70020
     tggggtttaa tatactcgcc tattacaggt atcacatcta tatagaacat ggggacttac     70080
     tggtcatcat cttccttgtc cgctttgctt gacttttctt cgtatgaatg aacgctacca     70140
     acgatctgct tcttccgttc agaaacgaag ggcatgtctt ttctcgtacg tctctcattt     70200
     ccttccctgc gtttcaaaga agcaatctca atgttcttga tttcttgagc ctttttaatg     70260
     acctttggta catgtctgtg cttgctgatt cttctgattt caggcatgtg cttgaatctc     70320
     tcctttagtt tttcgtcgta ttccaactta ttcttttcct ttgtggtctt cacatgagat     70380
     ctttcccatg cctttgctct ccaaagtctt acattgccat catcagagcc gctgacgatg     70440
     tacttactgt ccatagtgaa cttgacttga aatacatgct gcatcctctt ggtatgatag     70500
     acttctcttg aatggccatg ctttaaattg aaaattctga ttgtcttatc gtaagagcct     70560
     gtaacaatct cttcacctgt aggagaaaag tcaacatcca ttacagcact gacgtgatcc     70620
     ttaaagacat ggagcgcacg agacatattg cgcatgtcgt agtaataagc attgtggtct     70680
     tcattggcaa ttgcaaagtt aaacggttcc attgggttcc agcacaaggc gttggtgcgc     70740
     attctctgca ccactttctg tgttggtgag ttggttcgca gatcataaag cacaatggag     70800
     ttgtcgctgc cagtgcttgc aagtatgtcc tcctcgtttt gattaaaccg cacaaaacta     70860
     acattgtcca cgccccaaga aaggttcgac aatggtttct tgcgatttac atcccataac     70920
     tgaatctgag caccaccggt aacaaaattt ggatttctac ggtggtggtc tatggactga     70980
     aatgcgtgtt cgccgtagaa cgttttcagc agcgccccat cgcctgtgtc actgactatc     71040
     ttagtatcgt cctttatact gttaaagtcg tcgctattta ccgaccacag ctttatagtc     71100
     ttatcatcac cacatgacag catgaagctg tccttcttgg tagggctcaa gtgagtaggc     71160
     gtgacgcaca gtccggtcac taggccataa tgggcccgga acgagcagag ttcttccctt     71220
     gtcgccatat tccaatactt cactacaccg tccgccgagc cactggcaag cttattgagt     71280
     acattatagt ttttcgctag aacatagcat ccgtccctgt ggccgtatcc tagttggcca     71340
     acaaacggct tggcaaacat ccgctccagt ttggtcgccg tcaatgcctt tgtatactcc     71400
     cgagccctct caaagggatg gagagcaggg tccaggttcc taggaagctg tgattcctgt     71460
     gtgctcttta cagggacata ttcgtctgca ttcctgctaa tggtctttat cttcatagcg     71520
     cgtagtatgc taattcaagc taactccttc aaagccacaa gtgacactat gcgttaaaaa     71580
     cttgagaaag aacgctggta gcccttcact ttaacagaag tttcgaggtt ttcttagtgc     71640
     tagatgctct gatatgcgat gagataggtt cgctaccgaa atttttcact gaaaaataaa     71700
     aagaaatgaa catgcgagaa ctgaaaggct gccgctgtac aagtggaagc ttcacaagcg     71760
     tcattctatg tagattatga actgcttcct tgtggagccc ggagttcctc caacatggat     71820
     ttacctattc tatcactgac atcacttgcc cataaaacat ctaaatggga ataatcatca     71880
     aagtaccata ttttgtagat gcgctcatct tcatgattgg tgaagtgatc gattagtcgc     71940
     ttgccatcta ccaatcgatc ctgcttgggg acaaacaaaa ggatacgagg gtactcggtg     72000
     ggagcgttcc tccgaacttg cccatccaaa agtgtatgcg agtcgctatt accatcgact     72060
     aaggggaacc acgccccctc ctcggggaat atgcaatgcg agtaatttct gaagctgcgg     72120
     cggccagggt ccttactcaa ccaccacttc attagattca cagatatgtg cacgggggag     72180
     aacataaaat gtctgtcccg aagcggcttg tcccacaata aatcattcca gtcgaacaag     72240
     taattaaaga agagatagca tacgactgag aaaaacctgt ttcccactac cagcgcgcgt     72300
     acttgcatca ttattggaag aaaggagcgt actccataga cccatggaac atcaattgtg     72360
     gacgccatga accgcatgaa cacattttca tagagaagtg gacccggata gaccgcgggc     72420
     gcgagcgcca caaagttgtc caatttatcc attagtcgga aactggtacc tccgtagagc     72480
     gcttctccat gaagcaaacc cataaatcct tgcgtcgtgc cctgcgagtg ggccaccaag     72540
     gtgagtttct tcctggcagt tttctgcaag acgtattcaa ccattgcctt tagatcgtac     72600
     ttcaccattt ccttcatgtc ccagtcccat ttctcgtgct catcaacttg cgagggcaca     72660
     gtcttggcgt tgaggccgca gcggttgttt cctagccaca catcatagcc ggactcatag     72720
     aaataatacg cgagagactt gcggccactt gatgcaaagg acccgcagct ctgcaagagc     72780
     ccatgcaaca acaacatcgg cggaccctgt gttacagagc cttggcccac aaagtgccag     72840
     aggaagagca caaaaccgtc gtccgtggtt acctcatact cctcaatttc gatcccgtat     72900
     tgccggtagt agtaggccaa gtccggaacg agcttaatgt cctccgcagc cattgcgtca     72960
     cggaacggat tgcctcctga tcccggcgca gcgccactct cggcgctccc aggctcttca     73020
     tcgctttcat gccgtttgcc atccgacccc aaaaacgggc tctccgatgt cgctgacact     73080
     gagcgtctca ccgtcactcg tatcctgtcc ttatcagaga caactgcctc ctgcactgtt     73140
     ggtatcactc gccgtctcaa cctgtgcttt cttttccacc gatctgtaat taacgtgttc     73200
     caagtggcag ccacaaatat agctgctaag agcagtgtcg taaccactga ggcagtgact     73260
     gtgtatagcc atattcgagt tttaccaagg acactcatat taaaagtact ggactggcgc     73320
     ccgctgattc tattcttaat cttccaggta gaacggccaa tatgaacaat atgctactgt     73380
     agcgtgccat taatgggtat gagttatctt aaatctagga atttttatat gcatgtcact     73440
     gcatgtcgca gagcctcgat tttgtatctg gcctcacgtg cctctatatc gacgataaat     73500
     cgcattacaa gtacttcgca gttattactg gcatagcaac ccaggatata gagtgcattg     73560
     gcgtcttata gaaggcgtta gtgggctata tagaataatg atataccgag agttgcaaaa     73620
     ggcaattcct cctgcgcttt gggggcttga tgagagcgca cagaatgagt tggaactgac     73680
     tgcagtgcac ttcaccaata agacgctctt gcacatccga ttcaatgggg agatggatgc     73740
     gacatatgag gtccagccgc ggggggctgg ggggctcgca gcggatgtcg gtgggctcca     73800
     cgggggcgcg gcaagcagtc tgcgtgctga aggaaatgat gaggacgagt ttgtcgaaga     73860
     ccacctgtcc aagtacaacg tcagcatgaa gatgggcaac tccaacgaca tgaagctgcc     73920
     tgtggtggta atgcagattg cagagctgta tgagcgggcg gtgtacccct ctgtccttgg     73980
     tgcagaggct cgtgctgggc cggacctggg actgttggtg accctctcga gtcgattctg     74040
     gagaagcgcg agcgcaggcg gccctggctc gggcagcgac ttcgataggc taatgttcgt     74100
     gctgcagagc attcgggaga tgtacggaat atgagtctac gtagatatat aggcatcact     74160
     gattcgcatc gtccagaacc gccatgtcca gcacctgcag cgttccgcac ttgccacaga     74220
     gcgtgaccag ttcgcggtag ttcattgggt cgatcaggcc tgtgcacatc cacgtggttg     74280
     cgctttcggg cgcggcctcg gtcgccgcaa tgagcgaggc ggcttgcgca atagcctcgg     74340
     cattgccttc gcgtggaagc accgccttga ctcgcatctt ggcccgagca atcggaatga     74400
     tttggcgctg cacgagcagc ttaatggcct caagtgcctg cagcttcgcg ggcttattcg     74460
     tcacgacgtt aaacttgagc tctgcaagcg ccttgtggat catcgttggt ggatagcgct     74520
     ttttggagtt tgggttgacg cacttggcgc taaccagagt cagcagctcg ttggtaatct     74580
     tcccgtgcat ctgctgtcgt tccttctcgg acaactggat ctctccgcgg cttaggatct     74640
     ccttgatgac gacttcctgc tcctttgtcc cgaaagcccc gttcaagtcc tcgttggacg     74700
     caacctggcc cttagacaca tttagaaaca cctggttgat ctgcagcacc tcatccaggt     74760
     cggtctccac gccgcgacgg tagtcctgta ccttgttctg gtagcaagca acttcgaacc     74820
     gcttcttccc cttcttaagc ctcaccagcg acacattagt aagcttgatc tgcccggatg     74880
     gctgattgat aactcccatt ggacggctcg acttgctgat ccactgtgtt tctgagccgc     74940
     tatcgttgaa gatggcttcg aggagagcta gcgccatgga aggacggtaa gaaaaagaaa     75000
     cgaacatctg aatatcaata tctaatggcg ggctgcttag agcgctccgc cgccaaagtc     75060
     actacatagt tatccccaga ggtggctaaa aggcgcgacc agcgtcgagc cacacaattc     75120
     ttgacatctg gagcactgca cggtagtggc cgacgacgcc aagcacgacg aagacatgcc     75180
     acagaaagtg cgagtggcag aagtagtcca cccaccacaa tgaccagaac tggcggtcct     75240
     tgcgcgcgac aggtggcaga tccctgaact ggcggcaagc agcctcgtgc accgggcccg     75300
     agcagcagtc gagcgttacg tcggaccgcc agcgctcggg cacaagcgtg gcgtagaaaa     75360
     ccacgccgat tccgtaccag accaggctct tgtacacgag cggcgccatg aggtgcgcgg     75420
     aggcccagcg tacttgcatc cagacatgca cgaatgacac gagccccagg gcggctagcc     75480
     cgacgtacac ggcgatccgc agcggacgtg cctccgggcg atcaaagtgc ggcgaccagt     75540
     tcatcacgcc agcggctgtg cctaggccaa tggaggccac catgtacgcg tacatcagcg     75600
     gccgcgacag cccgtacagc gtcacagcga ccgtcgtcac caccgatgcc gtcaccagca     75660
     gcgtgatccc cgtgtagtcc acgcacacaa agcgcgaccg cagcttcagg tggcacgtgc     75720
     cgttgaatgt gtgccaggcc acagaagagg ccatgcactt gaccccacac gccagaaacg     75780
     ctccgatcgc ccacttggcc agccgcggga cctgtgccgc gcggtacacg tccgagcgcg     75840
     gccagcccca gcacagcagg taggccaata ccgcagcgcc gaccaggtgc gaccagatgt     75900
     taatcgtctc attgtgccat ccgtacgcat tcagcaccga aagcagcgac ttgcggtgcg     75960
     agtggtagaa ccggtgcccg tagataatgt accggttctc ccgccacgca tatggcagtt     76020
     cccagtagtg cagatgccgc gccagcccgc gcgcccgcga ctctgcccag tgcagaggct     76080
     gctcctcggc tcccgagcac gtaactgcac cagcccattt gtgcgcgctg cctggctcgc     76140
     cgctcgcaca cagtacgctg cggcccccgc cagcctcacc cctgctgcgt agctgtgctt     76200
     gctccatcgc tgactccgcc aggctgctcc gggagtggcc ggactggtcg gttttctcca     76260
     cgcttgtccg gcaacctcgc cgttgcggcg cggcgcgccc gtgcacggca tgtgtgcggg     76320
     gcatatgggt gtttgggtgt gacatatgta atcctcagtg tcgcaggact gggcgttagt     76380
     gtgttgacaa atactgctaa agggtggagt aaccgcctcc ttatctgctt tagcatatat     76440
     cactatatag tttgcggcgt cgcatggctg tgaggcgaga aacgtgttaa ctcaaagttc     76500
     ttgtcatatt cacccattcc tttgctcgtg cgaaaaatct aaagaggtat tcttccccgc     76560
     caaattccat tggcggacgc acgttgcctg ggtggctagc atcgcctacc agcgtctccg     76620
     cgaaacctgc gtgccgtgtc agtagaccgt atgtcgtgga tgtcgctatc tttgaagtca     76680
     cgtcctcatc tggcaagccg ccgtcgccat agacgctctg catcccgagg cctgcggaca     76740
     cagcaggcgc gcggccaggg cgtagtctta ggtactaatg tgcgcctgct ggtgccatgg     76800
     tctcacgggg cttgaccgcg cgctgtatat attacagagt ctcaccgcgc tgtctgccgc     76860
     gcgatctgtg caagataata attacttgcg acacggtcca accaggtcgc tgaacatcgc     76920
     tgcttccaaa gctcaggcgc aaagcgcggt accaggagtc gagacgccat ggagcacatc     76980
     tggttgaggt gctttcgcag ccactatgca tgtaagcata ccagcgcgca aaaggaacga     77040
     tattgccccc tgcctacacg ggccccaacg cgcaacaacc caacaagccc aggcaataga     77100
     tagtaacagg actggttgcc ttcttccagg atgcgtcacc cacgggagtt gcagtcacgt     77160
     gacacaaata atgcctttct acggcgccct cgcacgtgat gagaccgtgc tgctgcatcg     77220
     cagcgacgga cggcgtccgg cggggcgtgc agcctccgcg agtgcgcgag agccgccttt     77280
     ttgttcctcc ctcccctacg tgacggaaca aagagtctcg actggcacaa gtctcgccac     77340
     aaccactctg gagtcgatag agcagcagtg caagcagaag gcgaagggtc tcggagctac     77400
     gggctacgga caggtgagat caggtttagg ccagtcttct gagatacgca gcacactggg     77460
     cgtggacgga aaaaaagcgc acgagcagtt ttttggagca gcagcgcatg gagacagcag     77520
     cgcaggcgga acggatacga ggccagatgt ctactacaga gcacacgaca gatccctggg     77580
     cgggcagcgt ggactatggg tctgcatctc ggcggaatag caacatggac cccgaactgg     77640
     cgtcgatcgt gtcttcgtta tcggcgttgt cgacaggccc gggcgcgggg gcgccacaac     77700
     agcttggtgg gttccggcgg gcgtcgatga actccaatag cagcgatgtg gagtctgagc     77760
     tcttgtttgc gggcatgtcg cctactgttc ggcgcacgac gctctctgtt gggggcgggg     77820
     ctggcggcgg agggcggctg gctatgctcg ggcactaccc ggcgagcatt gccgggacgt     77880
     tgccggcggg gggccagggc ggtacattct tcgagcggtt tggacggacg ttggcggagg     77940
     cgacgcgcga ggtcgagacg gggctcggga cgtactcggt ccggcaggcg ctgcgtgagt     78000
     ctgcggcgag cagcgcacaa gatctcttgg cgcgcccggg agtagcggcc gctaccagcg     78060
     atgagaacgc attacggaag atgtctgtgt cctcggagac tgtcgagtct gtgagtgaga     78120
     gcatgtcgat gcacaacgag agcaatccat cgcacaacat ctggaacgta gccaacgcac     78180
     cggtgtttcg gcccaaccac ggagactcgg gcggtgaccc ctattcctcg gtctacggtg     78240
     gctttccgta cggtatgttt gggcagtatc ccagtgggac aggcctaggt ggtggtgggg     78300
     cctttgctgc tggcggcacg gttgccaaag gcgaggaagc ctcccgagaa gaaccacagg     78360
     gagacgcagc cacggcaacg aacggccagt ttgcttttcc tgctggtgca ccctttctgt     78420
     actttccagt cggttccaat ggcggatctg gggcggcgat tccggcggtg ctgcctcccc     78480
     agccatcacg ccattcacct tctgagtccc agaaggggaa atcaaaaggg aatccatacc     78540
     tgcagcagca cccgagaggc tacaaggctc caggaatgcc attgcagaac tccaactcga     78600
     aggccgcccc acagacctcg atttcaggca agggtcatca tggccaccac tactcatctt     78660
     ccaaacaatc ttcgacccag aaccagcatc aggcaaacca acaacagagc cagtatcaac     78720
     atcagtcttc ttccggggcc accaagagaa atggtaaaaa ccagcagccc ataatgcggt     78780
     ctccgctttt ggaagagttt cgcacaaacc ctaccaacaa gacatacaag ctacatgaaa     78840
     tatatggctc tgcgttagaa ttttgtaagg accaacatgg ctccaggttc attcaacaag     78900
     agctagcgac tgcatctaat attgagaagg aggtaatatt caacgagata cgcgaccatg     78960
     ccattcaatt atcgcacgat gtttttggga actatgtcat ccagaagttt ttcgaatttg     79020
     ggaccaagac gcagaaagat atactagttg agcagtttag gggcaaactg gaggcattgt     79080
     cgttggaaat gtatgcttgt cgcgtcatac agagggcttt tgagttcata gatgaggatc     79140
     agaagattga ccttgtgatg gagctatctt ctagcgtgct taccatgata aaagatcaaa     79200
     atggcaatca tgtgatacaa aaaacaatcg aatgcatccc catgtcgaaa ctgccgttca     79260
     tcttagaaag tttgcgcggt cagatatacc atttgtcaac tcacttctat ggatgccgtg     79320
     ttgtccagcg gcttttggag tacggtagta aggcggatca ggaggagatt ttaaacgaac     79380
     ttgatcaatt tattccatat ttggttcaag atcagtacgg caactatgtc atccaacata     79440
     ttcttcagca tggtggtgac aatcctgcgg aaaaccatat cgataagtcg aagcaagata     79500
     ttgtcgacac tatcagcaaa accgtagttg agttctcgaa gcataagttt gcttccaatg     79560
     tagtggagaa gacgatattg tatggtagcg cgtcgcagaa aaggcaagtt ttggataaaa     79620
     tattgccgaa agatgaagag cacgcggcga cgttggagga tacctctcca ttaatattga     79680
     tgatgcgtga ccagtatgct aattatgttg tacaaaagct tgttggtgtt ggtacaggta     79740
     atgataagaa gctcattgtc atcgctatca gatcttattt ggagaggctg aacaagaata     79800
     acacgctagg gaaccgacat ttggcaagcg ttgaaaaatt ggctgcatta gtggaaaagg     79860
     ttaagctata aggatgaagc cataaatatt gtcctttcct actctctcgt tcctgttgat     79920
     attaccactg taaagtacct atgttaatca cgcgctgtat tagcatacat tatgttccta     79980
     atgccttcct actttacttc tcaacttaat tagctgtgaa tattatacta cattgatatc     80040
     ttatatacta ttaaatatgt gtatatacac tatacatttt gtacatacag ttgcctgttc     80100
     agtgcacatt gcattatcac gcattcgttt acttttaaac gaactgtaag ctaggtcgtt     80160
     gttatatgct acctaatcat tatatcgcat ccaagcccag ctgttcccgt gcttagctta     80220
     agagcgcgta agtgaacgtc cacgccatca caaaacctgc aagctcgcgg aacaacgacg     80280
     tcaatattat atcctggact gggttctgaa agtacttgct aggttcaaac ttgcagagcc     80340
     gcattgcgaa tatcgcggat atactgaggt agctcactgc aaacataata aaaccctgca     80400
     atgactcgag ctgcaagatc ccagccccac agccgaacac gagtgatgta atatcatgaa     80460
     catagagcag ccgcttctta ttgaaggaga ccgatctact ggacaaaatg tccgcggaaa     80520
     caggattcgc catattgatg tatctgggct cgccacgcaa caaaggttga ggttatgctg     80580
     ccttttcggt cgcaatctct atgcgttatt cttcagcaga tatgacgagg tgcaatgcca     80640
     aagaacagat gcaatccagt gcatctagta tctttgaagt aagttttcac acatgaaagc     80700
     tctccaacca cgcgaattgc agttgcagat attttacgtc acgtgtaagt ccatgttcta     80760
     cgaaaagcaa agccggtgta tactcttctc tcatctcatc gctgaaaatt attgtcgatt     80820
     atgagatttt gttctcttga cagtccaaat atagctagaa cgccgtctta atagatcatc     80880
     ggtggatttg acgatgccct cgcaattaga agaactagtt tcctttctgc actccccaca     80940
     acctgctgtg aaacagattg ccctggacaa tttggtaggc ttttcgactg ggcctcatgc     81000
     cggtatattc aaaaatgaga actacaggcc tattcaggat ttgaaggaac tagctaaaaa     81060
     taattcgaag acaattgttc agcagtccgt cacgattctg gccaatcttt gcgatgatcc     81120
     tgtcatgcgg atgaaaattg tcacggatat cgacttcttg agctatctgg catggaagat     81180
     atgcgacctg ggtaactcat ctgccgacat tatgtgcatt ttgctcagca acctagctaa     81240
     agatgagggg atcaccaata tcttcggtat taacggggtc cacgatagtg tcagcttaga     81300
     tgaaaaggtg ttcatgagta aaaatgtgat cgattgcctg atggactgtt ttgtcaaagg     81360
     gtatgacagg aagctgaacc agtatgcaaa ctttgactac ttgtctttct tctttgctga     81420
     tatctctcgt ttcaggaaag gaaggaacta ttttgtggaa gagcagcagt atgatggagt     81480
     tgttccaatt tcaaaattac ttgtatttac cgagaaatat gacaacaaaa ctagaagact     81540
     cggagttgcg tcaacgatca agaactccct attcgactct cttcatcacg aaaaaatgct     81600
     aaaggatgaa aagataaatc ttctaccata tattttgtta cctattgcca catcgcgcga     81660
     ctcggagctc gacgaggaag acctgtttaa tctgccggat gagcttcagt tcttgcccga     81720
     ggataaacaa agagaccccg ttcctgaaat catctgtgtg catctagaaa gcttgttatt     81780
     gctctgtact acagcgaacg gtagagagta cctcagatcg aaatcggtat accctctaat     81840
     tagagaacta cacaagaacg ttgagaacga agaaattggg gagctatgcc ataggattgt     81900
     taatatgtta atgagaggag aaccggagaa tgagaaggtg gaggagatcg tgtcaaagtc     81960
     tgcagaagat gagtcagaag aatctgatga cgaagccatt gttgaagtcc tctaacgagt     82020
     ccacaaatga tacttataaa tagcaaaacc catcagcact tatctgagaa gcaggtttaa     82080
     tcgtttagtt aagctcgttt atatcttaca catatatgca catgtatatg cactactagt     82140
     ctcagatact acaaaaactg tcgaacagag aattctggac atgatattct gaatcagcgt     82200
     gccagctcta agaaagtacc atttagctta acaagccgct taacaaagag tttcaatcta     82260
     tctttatttt ctggatgctt aaacttcgac cggagctcct tgataagctg cttaagcgtg     82320
     atctccttgc cttgtacagc atcgatgata tcttgttcgg tcaatagctc atgcggagca     82380
     ggtgcgccat cgcggctagc aaaatcagta cggtctttag caccgttatc atgattagcc     82440
     gaagatgggt tccactcacc tttcggaaag ttattcaaaa tagacttatc cgcactgatt     82500
     actatgatac agtttttgat actcttcaca tatatgtggc ccgcatgcgg gctcctagaa     82560
     gccttcttct ttggagaaga tttccgactt agtgaatcct catcctggtc ctctttcttt     82620
     atcttcttat cgtcatcgtc atcaaggtca gactcagaca agtacgggtt cgaatcatca     82680
     tcagactcgt acaatgcgcc taggtcagtc ttgagtaacg cttttttaac cttttcgccc     82740
     tcctcatcaa tctttttctc gccgaaaaga tcatcttcgt cttccacggc atcatcgtca     82800
     cgcaagccca ttgcgttggc ctgaagcatc tcctttttaa tacgctgttc agactcctta     82860
     ttctcttctt cgttcccatc gatgatcgga gcctcttcgt cgtcggcaaa ctcttcgtca     82920
     taatcaagct ctacctccga gttatctacc cggtcgtcct cctcttgccg gtcgttcccg     82980
     tccacaacct tcagccgcct tctagttcta tcatatcttg tggtcgtggt gccaatgttg     83040
     tccaagtgct tcatcaacca cctgggcgca cccgcgccat tcttttccat gcgcttctct     83100
     gcctcctcaa tagttaaagt cgcatactta ttcctagctg tgaaccggta caccttgtcg     83160
     gccgggatca ttgtgaagct cccgtcgttc tctgcgctca gaaagacata agagtcagag     83220
     tttccagctt cgtacgagcc cacccacgta ttcagcccgt caaagtcctc catcacccag     83280
     gggtagaatt cctcgaaccg cagcttgcgg gccttctcgt ccagcagctt cagctgccgc     83340
     gttttccgct tcgagttgcc gcgcttaaag cgcccgcctc cgtccggcgc gacgtctgca     83400
     aacggatcaa tggtcccgga ctggaagtca aagtccacct gctccttccc gtcatacttg     83460
     accagcccaa ccttcgtcgg gtcctccgcc agtcctgcct ccggcagctt ggtcgtgggc     83520
     cccggtttct ccgcagccag aggctgcaag gcgccgccac tgtctcccgg cgtgccctcc     83580
     gtgccctcag cgcccccgga ctcgcgcgaa gacgccgaca ccggcgtagc cccctgctcg     83640
     ccctccaacc gccgcttgta ctccgcgatt tccttctgcc gctgcacaat ctcagcccgc     83700
     gtcagctgaa actgcacgtt ccgcgtgtcc ttccggtgca gccggacagg caggtggaag     83760
     tccttcgtcg gctcgatctt cttcttcgac tgaaacttca gcaggtgcac cttcacgttc     83820
     ttaaggtctt gcgcgttcgc agcccgcagc ggaaactcct ggtagtcgtc atcctcccgc     83880
     ttcactcccc cacccccgcc ctgcagcatc tgcctcgtct gctcctccat cgaatctggg     83940
     tcctccttct tcacaccgcc cttgcctggt ccgttacgct tcacccgtgt ccgtaggaag     84000
     tcccgcctga gctggtccct cttgataaaa ggctgcgggc ccgcggcctt tctcccattc     84060
     gacatcgcag ctgtgccaaa ccctcgccct ctcaatagct cagcgttcta gcagcccatg     84120
     ctcttctgct ccgcgctcat ctccgcgaga cagtgatcgt gattgcgcca ccgctcgagg     84180
     acgcccgctc gtcaacgtac ataatgatat tcccagcgtg caccctgctg tcaagcaatt     84240
     agcaaggtgc gcgccggcaa cccttgtgat agcggtaggc agtcagcagc agagctggga     84300
     agcgggttcg caatcgctct gctgccgtga ctgtccgctt gtgtgccaga gccccaaggg     84360
     cgcgataagt catgtagtgg tgcacgggtg cctgaaaatt tgtcaggcga attttggtgg     84420
     cagtggtata ttataagaaa ctggtggttt gtaacaggag gtgcgtgtca ttggactcat     84480
     cggcgactct cggagtgtgt tcgtgtccag atagagcggt ataggcgatg tcagagacca     84540
     ttgtggaccc tacagaggct tacgagctga ttgtgaagaa cctgcaggag gtgctgaacc     84600
     cgcagatcat caaagaggtg ctagaggagc agaaacggcc gctgcggttg tactggggca     84660
     cagctcccac gggcaagccg cactgcgggt acttcgtacc gatgacgaag ctggcacact     84720
     ttttgcgggc aggatgcgag gtgacggtgc tgcttgcaga cctacacgcg tttctggaca     84780
     acatgaaggc gtcgctggag gtggtgaact accgggtacg gtactacgag tttgtggtga     84840
     aggcgattct gcggagcatc aacgtaccga tcgagaagct gcgctttgtg gtgggttcgt     84900
     cgtaccagac gtcggcggcg tacacgatgg accttttccg gatgtcgaac gtggtctcgc     84960
     agaacgacgc gaagcgcgcg ggagcggatg tggtgaagca agtgtcgaac ccattgttga     85020
     gcggactgct ctacccgcta atgcaggcgc tggacgagga gtatctcggt gttgacgcgc     85080
     agtttggcgg tgtggaccag cgcaaaatct ttgtgttggc ggaggagaac atgggcagct     85140
     tgggctacaa gaagcgcgcg cacctgatga acccgatggt accggggctg acgatgggcg     85200
     gcaagatgtc tgcgtctgat cctaactcta agatcgacat tctggaggaa cccaaggtgg     85260
     tgaagaagaa gataaacacg gcattctgct ctccagggga ggttgaggac aacggtctgc     85320
     tctccttcat acaatatgtc cttgggccca tccaggagct gaaaaacgct cctggctact     85380
     ttgaattctt tatcgatcgt ccggagaagt ttggtggccc catcacctac cactcgttcg     85440
     aggagctaag acaggccttc aaggaccaga agctagcgcc tcctgatctg aagactggtg     85500
     tggcagacgc aatcaatgcc ctgcttgccc ccatcagaga ggagtttgcg aacaatcctg     85560
     aattccagga tgttgccgcg aaagcatacc cagtagtcac tgagcagaag actaagaaag     85620
     tcaagaagcc aaagaacaaa ggcacgcggt acccaggcgc cccaaagcct gctgcagatg     85680
     tagatgcaga ggtcgacgag gcttccgtgc aaatgaagaa gacttcctta gaaaccaact     85740
     agtagcctgt tttaaataat ctttttttct tggtttgtct ctggcatcgc agatttctgt     85800
     cgatctccat agtaatagaa ggtttgcagg agtttattat tattttccga ctcggcgctg     85860
     gcccgcgggc gtttcacata cacattacac accgctatac cgacgcagtc actacggagc     85920
     tatatcttac atgctttccc agccaccaac gtcagacatg ttctccgtca gccggtgcac     85980
     taagtgaggt attttgcctc caaggactat atcgtttcct aagtgcgagt atagtttctc     86040
     atctaggaaa acaggcgttc catatttgta atcttcatca acctcgccat gcttattcac     86100
     atatggcgcc ttgaagaatg tgccacgatc tccgtaggcc aaatacactg tattgctgcg     86160
     aaccaataga aagcatccgt acacagccgt ctgtgtgcat tcgttcgaat agtgattagt     86220
     acattcccca atcatgaaat tatgcaacat ggaagcattt tgaataaata cttttgtgcc     86280
     gcaaaataga cacatcgcca cctcatgtct gttgatgcgg tattgcaact gttcctcctc     86340
     atccgaaagc aaatccgaaa gcctatgtgg tagcggaatt aaaggtgagc cataaggtga     86400
     ttcaactcgt aaagaataaa ctttttgtgc gtaagattga atattgggcc ctttcgatgc     86460
     ttctttaatc gtagctttcg taagcggcaa atcgttcacg cgaaaatcag ttaatatgct     86520
     gtccaactgt ggtacgccga agtaagataa tagtgaagac aactccagct ctattgtgtt     86580
     gcattcgcgt ttagtgatcg gatactctgc aaagattagc atcagaaatc ttcttaaaaa     86640
     cacggttaga gctttttcag tcacattata caatagaact ttccattttg cgacacgatt     86700
     taactgggag cggtcaattg aaattgctgt cgataaagca acaatgtaag ttagaacaac     86760
     gcctaggacg gaatcagcgc cctcttggcc agagtcaatg tcatccacgt cccaatccat     86820
     cacattctgg tcaccatcga tcatgcaatc ggaatcctcc actaaagtgg tggatagcgc     86880
     gataaatatt tgatgtagct tcctttttat tgaagcatat acgaacgccg atagaggata     86940
     tccctttcgt gttatggggt tcagataacg gcaggcatcc aacaacaagt tactgtgtag     87000
     aaattcaaca ttgaacgcag cccaatcgtc atattcacgg acggctggta tcggaatgcc     87060
     cgtgatcttc ccagtttggt gagaaaacaa ctttctttct aggatataga ttttcatctc     87120
     ggtcagaagc cgtaatgtta acaattgctg attcgtcaac cttttcgtaa tggggatggt     87180
     tgtatcccct gaacgggtga ttaactcgat attggaaata gtgttggcta tgaccgaaca     87240
     aaacaaggta taaatgtcag gcaatctaga aaacttggat tgaacggtca aggaacaaaa     87300
     tattatcagt gattttaggc aaagagtatc caactcttct gatgacatcg aatatttgtt     87360
     ttcatgagtg cctgcaaata attcttcgtc gcacctagta ttcacatcag agagtcgtgg     87420
     aataaaggaa ttgaccaacg agttgcatag tgggcaaaaa agtaacgaaa atcctaaacc     87480
     attaggcaca tttttagtca tatgattatg cgcatttctg gatgccttca tatgcctttc     87540
     catgcatgaa aagtgcgagc cgtgaccgca agccttcact acatggcata tacttgtact     87600
     accgggtgat gggaagaggg gttgtggctt tgcagaagta tagaggctct gcagtaaatt     87660
     caatttgccg aagtcagtat acttgtccac agtgttctgc tcgaagtgtg tgaagtacac     87720
     aaatgtgtcg ttctctacac gaggcatttt gcagaacaca caagtatcat cagggtactc     87780
     ccatcctatg gcactaaaac ttccatcgat agtcgtctct cgagagtcta tatcctcagg     87840
     tgtcacatta ttgttttcca taaactgctg ctgttgttta gcaagttttc gtaacaacct     87900
     gtcgcgcttc cttttggcca atctcttctt ttcatattca tcttcgccct ttttgagttc     87960
     tctactacgt gacttccaaa tttgaggatc atagttcggt gtctgctcgt tcaagtagcc     88020
     atcaacgtca acatgaggtg cttctctttg tagcaagctg aagatctcac ggatttttcc     88080
     atgatcactg caaaaatcct catccaatag aaatgaaaac aacaaggacc caatgctatt     88140
     atagaaggat agagccgtct cgtcaaagga atactctctc caaaaaacat taacaaatcc     88200
     attcaggttg ttgataaagc atagatgtat aatgtgcgcg acttttgaga gcatcgcttc     88260
     atatttgaat tttgcaatgt gctccaaggt gctctttatg aatatgccaa aaatatcagt     88320
     gcttgttatt tggtatagac cagaaaaagg tgtaaactgc aactccatta ttacattttt     88380
     tgccggcacg aaagtatcca tgtaaggtat aagctgatta ctttccattc tacttctcat     88440
     taacttttcg gcctcatatc tctttgtagc agaaaagcca acgaaatatg gatcaacttc     88500
     attcatgtat tcttccttca aggtatagac accatggtca gttattccaa tcgggggagt     88560
     gtagttggct aaatgctcaa gatataaatc gaaggcggga tgcttagtca catgctctgg     88620
     gatcacattc attagattgc tatgactgca attgtggaag cataatgcgt ggataatctc     88680
     ggagcgcatt gttttctcaa atccctctac tgaagatgac attgttaggg atcgcacctc     88740
     tgacaatagc tggattaata acaacaaaca ttggtccacc atggaggagg tgacatcttt     88800
     gtctggataa tcatctatag gaacaccctc cgtccaattt tttagatgcc atctggaaat     88860
     aaacgttacc ataaagtcat tcgggggcga taaactcatc gctagttgta ggttaaaaat     88920
     atcactgaaa taagtgaact cgcgcatact atacttggtg tacattctca gttgatgaat     88980
     gatcggtgca ccatttcgaa cccaaaaccc agagtttatc tgtgctatca ataccaacgt     89040
     agataacgcc gactcagcca taaagattaa cttcttattc tccttgaaaa aggaaactaa     89100
     gttgatgtat cctttaagtt cctctggtaa agtctcatat ctcccacatt gactccattg     89160
     cagtacgaat ttgaagaagt atgacattgg attgaaaaaa ttttgagtat cgattccaac     89220
     ctggaaactg attatattag acgtcacatt gtagatagtt tccctaacca ttttaacctg     89280
     cggttcagca tctgatgaat cccaaagtga atccgaaaat gggatggaat ttctaaaaca     89340
     gcttaacatc ttaatttcca gggatattga cctatccaat aagtcataca cgacttcgcg     89400
     gcgtcgccgc gggtctttaa tcaggcacac gtttcttaca aaaccatcga ccatcactag     89460
     gatcgaagag aataagaaat aataagaaga aaaatcaaag ttttcaaact ctacgtgttc     89520
     cttggcctct ctccttaggg gcagaatatt attaaacgat gcaaagcact tgattatgac     89580
     cgaggtgagt tcttgatttt ggaaaactga ttcaggtaca gtattagtag acattatcag     89640
     atagatatct ttgaagcaaa cgactgatct cttgctcttt atactatcat ctggtaattt     89700
     gaaatcatag gatagaggaa ttggaggaca gtttattaag gttgccggag caaacgataa     89760
     tagtgcaaaa gcaaattgta aagcacgttg aataaatccg ggtgctttgg ttatgatcat     89820
     gttggcaatt tgcggattct ggaaaatgta ttgtgataac atattcatca atgatatctt     89880
     gtagtctgtt gattctgatg ctacagtatt gtagagaact gcgcaataga cgtccaaata     89940
     ttgtgctgct aaacacttct ttgaatcatc tattattgtg aacatggagc agataacctt     90000
     catcatccta tatcgggaaa ctttcgacat aactgctgtc ccatcggtta tcaaatattg     90060
     aaatctcgaa ccgtttaatg gctgatactt ggcagtagag ttgtcgggta caacttcagc     90120
     taagcgctta tcatactctt tcataatctc taaaaccctt ggatcgtgtt gctcattctt     90180
     agcctcgtca aagctccatg gagagcacca aggaaagcta gttcgctggc tatactgcac     90240
     agtaaaattc cctagaagat aaatctttga ccaataggga accattgttg cctgtgatct     90300
     caaagtcata cccaaaagtt ttgaattcca tgtactcatc atggctaccc gtagcgctaa     90360
     cttcctctgg acatttgggc gcttgtagca aagttcatag atccatctaa tgagttcgtc     90420
     cactagattt tcacgaaaaa cctcgttctt gtttttaata tgcgtcgcga tatgttcgtt     90480
     tgtgaatatt tcttttacag ttttaagctt ctgggtatct ttagactcca ataggatgac     90540
     aaaagcttcc ccacgcacta gtttttcgac catcataatc ccatactcga ggggcttgca     90600
     caataccctg cttatctttg cagctaagtc ctttatgtga attttgcaat ctttttcgta     90660
     tagttgtaat gcatagtatt ctgactgctg ttccaaagtc atgggtaaag tcagaaagat     90720
     atcatcattg gtccactctt tcagctgcat catagtatca acaatgtagt ccaaaacgtg     90780
     tgccaatatc gaaaccaagc tctcatcatg ttcgtaactc attgttcgcc gtggtagatt     90840
     attaagtgca cttttacatt cgaacccctc ttctggattg ctcaacccag atgggtctcc     90900
     acaatggcaa accttacctt ctggacggct cacaaccttt gatgtatact gatgaccaac     90960
     atgttttgtg ggatcgaaac attcgtcgca tatctcgtat agcgggttct tagtgcaatt     91020
     aaagcagtag tacacagttt ctgttggctg gcagagcttg ttgcagctag tcccacggtg     91080
     atcgttgccc acaccctcgc ctgttcccgt atactcctcc aaaaacttct ctcgccattc     91140
     agccggaaga tgtattgact gaaatacccc gttctgccaa tttgggcttt catacacgcg     91200
     tagcagcttc ttccagtcca caatcccttt gctgcggccc tggttcaaac actcgaaaag     91260
     caccttccag agctgataaa gtacagtatc attaacttgg tagttggaga gccgaggaag     91320
     atgcactagg tactcccgta tatcacatat atagtcaacc gtccccatga tactagcccc     91380
     actgatcttc ctgacctgct cctatatcac actgtctcca ggtcagtgta ttttgtgcag     91440
     ctacgctttg tgtcgcagta ctgatccgct gttccagtgc atagattcgt cataaggagg     91500
     gcgcaattcg ccaccggccg ggatcagcgt ctacggtaac acagcgcaga aaaatcccag     91560
     ggggacagta gcctccgcag taatagtgcc agtagcctca gtatccagat attatgagct     91620
     caagtataac ggtcgcctta ggcctctgca gcactctgct caattcacat cctatcacgt     91680
     gacagatatt tattttaagt cacgtgcgaa gctcttgttt tatcagttca cagatccgtt     91740
     ttctgctctg acgcaggaca tgtcagccga tagaaagctg gttcgctatg tatgccgcgt     91800
     ggtagagtaa gactgcgtgc tgtatacgta tgatgatgga ttcaatatag tagtagccgg     91860
     cccgctgact tctgaatatc agatgctgtg tttataatta cagaagagct gtgtcaccgt     91920
     tcccgtagcg ggttattatt tccgctccta tcagatatgc aacaaataca gcagttaata     91980
     ttgtatcctt cgtttgcagt cacccatctg tagagcgccg ctttccgaga tagaatatct     92040
     tcctccaacc agaacaacgt tctaatgcta tcagacgtcc gctgtagctc ggaagagtgc     92100
     ttaaacagtt tgcagaaaca attagggcgc tgtatttaca ccctacttac cgaggacaga     92160
     gtcagccaac acgttgtcaa gacattgctc ttagttacaa gacttccgag cgaagaggtg     92220
     acgagatcac cgctcacgtg gtagcacgtg acggccgggt atgcccccta tttccagacc     92280
     tgggatcagc tcacggtctc tccttgacgt tacagattga tactcgacaa aaacaacgac     92340
     acctgcagtc ttctgtgtac ttacgaacgc atagttgcgc tcagtttcaa ggtactgcgc     92400
     acgccggttt aaaagtgaga ggtagtaacc atacgtagat aggtgcattc catatatctg     92460
     caagatatca aaaagctagt cggtgaaagt gaatcagata gaccaagaat gattagagag     92520
     ggagccggcg aggtacagcg gcacctaaga cacactttag agtctcttca cgaccatgag     92580
     tactttaaat cgccgcgcgg accacaagag cgcagcgaaa tggacaaggt attgcggtct     92640
     tttgtatttc gatacctata ctacgttcta tccgataacg ggcggctctt gccccatcta     92700
     tttgcgggtg caccaaaaga caagtttccg acgtcggtgg aggacgcgat gcaagtggac     92760
     tcgccttcgt tgtcgaaggc agacattttc tatgcgatcg atgaaataac tggcgcaaaa     92820
     agccatcgac acacgggacg gaactgtggg agagcttttc agccaggtga acccctatac     92880
     cgctgccagg aatgtgcata cgatgatacg tgtgtacttt gcatcagctg tttcaacccg     92940
     gatgaccatg tgaaccatca tgtctcgact cacatctgca acgagcttca tgatggtatc     93000
     tgtgactgtg gtgacgctga agcgtggaac gtgccgttgc attgtaaagc tgaggaagat     93060
     gatagcgatg gagacgaaga ggattcggtg tttgagaacg actacaatat ggagctattt     93120
     gaggccgtcc ttgaagagtt atttgatcac ttcattgaag tattcaatca gaatatagaa     93180
     cctttaccga caattcaaaa ggatttgaca atgaagttgc gagaaattat acaggatggg     93240
     aaaactcagg agaaatttga gttgttaagc gcgttggcgt ataggaatca gtatatggaa     93300
     gctcagaagc cgtcaagtgg ccctgcctcc tttgagaccg agcaagatct tgataagaaa     93360
     ctagatggat atgtggtttt aatatacaat gatgaatacc acaatttctc ccaggcaacg     93420
     tctgctttaa ggcaaggcgg gccagataat aagcatactg accaacttac tgcgcgtata     93480
     gatggagagg gccgtgctat gttaaagtgt tcccgcgatc tgtctgcagt cataggaggc     93540
     tttttctcgg tacagaccaa tggactcagc gccacattaa ccccttggtc agagtatatt     93600
     caccaggaag cttgtaaata tatgattcat tgggtcaaaa actgcttatc tatcccaaat     93660
     ccatccttcc aaaaggtctt ccgggaagca atgggcaaag tactatgctc ggaatatatt     93720
     cgtgcaagcg agacgactga tatgacaccg gtaatagata agtatttcat tcctgacaga     93780
     agaaatacag gctgtcacat ctacgccgat ttatctgtat tagggaaagg caatgtcatt     93840
     ccactcggcc accataaggt cttgcttcaa gaaagcctta atgaaattgc cttgaacctt     93900
     aacaattacg aagaactcaa atacagacgg tattcaaaca gtcggttaca gcaaatatta     93960
     ttttttgaca atagatattg gaagaagttg agaaaggata taaggcgagc tgttattccg     94020
     acattggcat catccgtgaa gtacaaaccc acttttagcc aacaggttgt tgaaattttt     94080
     aaccatatga cccgctcggt tgcctttatg gatcgagaac ctcaactcag tgccttggca     94140
     gattgtgtgg tacagctttt tacttgccca acaactgttc gaactatttt cgaaaacgaa     94200
     aactttcctg atataatgtg gtctgttatc gatatcttta cggagttctc aaaagttgat     94260
     gatggtattt tactatggca gcgagtccag aagagtaacc caagcaaatc ttacagttac     94320
     tcctttaaac atggacttta tgccgttgaa actttattaa gcaaggtgga aaacgcaaat     94380
     ctcatactga gaccccctga gttcatatcg attgtgacct tatgcaagct attcaatggc     94440
     gcttggagga ttaaacgtaa agagggtgaa catgtcttaa gggaagacca acatttcata     94500
     ttgtacttgg aatacaccac ttctatctac aatatcatta gggcaatgaa ccgcgtttta     94560
     gattcatcta gagctgcact atctgaggac actttgttgc aggctattgg actcctaaat     94620
     acgttcttgg gtcataggac actaccatac aaactggtac aggaggcaca tgatgtgatt     94680
     gcttttaagg tgagcaagca gaaagttgca ttcatgaacc ctgtacatac gctattctcc     94740
     tgtttgatcg aaaaagtgcc gttggcaaaa gcatttgaag cagtatcatc tactaaagat     94800
     tttctcacaa ttgcagactt ttcgttaaga gctgctgttc tttgctcgca gattgatgtg     94860
     ggcttctggg ttagaaatgg aatgtctgtt ttacatcaat ccgcatacta cagaactaat     94920
     ccagaaatca actcttatag tagagacatt catttgaatc aattggcgtt tttaaaggaa     94980
     aatgatgacc taccaagagt gatatacaac ctattggata gatgggagct attagggtgg     95040
     ttcaccggag cagaacagta cgaaactaca gtttacgagg agagaattac gaatataata     95100
     caacagttca ttgcgtttgt ctaccatata ttgagtgagc ggcatttttt cagatatttc     95160
     ggctcgagtg cagagcgaga aacacatacc atgaaaaata ttatcatata cagtttgtta     95220
     atgaaaccat tgccatactc tgaattgttg aaatcagttc cagattatct ttcggagaaa     95280
     ttatcagttt ttgatgagtg cttgcatgaa gtttctgaat atgtcgaacc aaagggtctt     95340
     gaggatagcg gggtttttag tctaaagaag gagatgtaca aaaagataga tccattgagg     95400
     ctgctaaata tgaagaatga ttttgagcac agtgcgacaa ttgtcaagac tcatttagca     95460
     gaaggatcaa atgctgtcgg ccaggtagta cttcaacctc agcttatttc gccgaagcat     95520
     ttagacgagt tagccgcgca tttaggtgac ttcacaagga cacaggtttt tgcaaagtta     95580
     atatacaaac ttttgcaagc ctgtatcgat cgcgaggatg gtacttactt atatgagctc     95640
     ttacatttgt tgcatggtat ctttaaagat gatgagcttc ttcgtgggaa aagttccatt     95700
     ccagaagcat acatttcaaa gccaatatgc aacctcttat tgctcattga cactaaggcc     95760
     aatgttttct cggagaacgc tatcagaaag gctgatttct tgcttgaaca tatgatccga     95820
     aaaagacata acgatatctt tgaatcattg gcagcatact tcggacaaga ctacgtggag     95880
     caatacaagg caaagaagtt aaaccaaggt ataaatttcg aggaaactga gaaagatcgg     95940
     aaaaagaggc ttgccagact gcggcaacaa aaaattatgg cgaagttttc aaaacagcaa     96000
     gcaaagttcg tcagatccaa cccaaacgtg attacggatg atttgtttga tgcagaagtg     96060
     cgtacaggtt ctgatggcct tgtttgttcg ctgtgccaag atgaagaatc actcgatgct     96120
     tttgtaatcc ctgcttacca cgaaagctca cctattttct tctatggtga ttataccccg     96180
     caaaactttg ccaagccttg gaatggtttt gtaaatgacg atgataactt aacattttac     96240
     gatgacttga agctctactc acttcaggag gcacggaagg gtagtaccac gacatttgtg     96300
     tcatgtaacc acattatcca ctatgaatgc ttcaggaggt acatacaaaa gaaaaggttt     96360
     tccaataatc tatttatctg tcctctatgc caaacatttt ctaattgcgt attacctatt     96420
     ccgcactggt cgctgcgcct tccaaaatcg cctgttactg tggatcagct cctttctcaa     96480
     ccatcagaag agaatttgat aaacttattt atcgatgatc aaacgcctaa ctccactgct     96540
     gccatgaaca tgctaaagga agtttgtaag aaaaatggta actacgataa atcatacgga     96600
     agtgtatccc aggaatttgt tactagtatc ctaacgtgcc attgggcaaa tacgatttcg     96660
     atgattgaga ttgcctcaag aatagaaaag aatacgcacc aaaccctact tcaaggcaaa     96720
     gaacaaaagt tcaagacttt gcgtggtgta ttaagcgcta ttggctggtt ttacaaatgt     96780
     atgggtacgc caaggcaaaa atttgtacct tatgttttcc atggcgagga tgatggtcct     96840
     gccaatcaag tcttccaata tatcgtacac aaatccctat tttcaggcgc acctgtttca     96900
     gagaccattt cacatgcgct cgctatctgg atacgaacct tggcaactca attcctcatc     96960
     tcctccaata aaaccgggta tgaaataacc taccatcaag ccgtttctct tggccctgtc     97020
     tacgaagccc ctcctgagtt tactactgcc tgcagttctt tggatcagat aatagccata     97080
     gaagatacca cacttaaaac aaaaatggtt gacctcacct acactatgct gatgaaaact     97140
     ctacttccaa ccttgagaag atgcatgatc atgttatatg tcttctcggg gttgctctct     97200
     gctgaatcgt gcttgaggat cgatggttta gacttgagcg cagatttgcc atttgaggac     97260
     ctcccttcct atttccagaa gcttgttacg ttgttgtgca aaactggctt tgtctcgatc     97320
     ttcaacaggt caacgataga aacaatggat catcagtact tgagaaacat accgatggag     97380
     tatgcaggca cagtaaagtt ggtggacttg gcaaagtact tgaacacata cgtgacaaac     97440
     accaagcagc tcaagctccg tgacgaggcc acctcgatgc aatcgcgcaa catcaagaat     97500
     aggctggatt tcaagatatg tttgacctgc ggagtcagag tctattctcg cagcgatgga     97560
     acagaaataa tgaaacacat ggctaagaac tgtttcaagg catacagctt gtttttgatc     97620
     ccccacgaca gcgaagtacg ccttgtgttg caacatcctc attcacatat ctcaattcca     97680
     gctccttact tgaattccca cggtgaatca ggcaaaaacg ctatccagcg tggcgattta     97740
     accaccctca acatccatag atatgaacac ttaaactact tgtggctcaa caacgagatc     97800
     cccggctaca tcagtagaat tatgggcgac gaattccgcg tatccattat ctcgagcggc     97860
     gtcgttttca atttcgacag aaatgtcttg cgccgccaga tgcgcgcaaa cgttggcaat     97920
     gaggagagca gcgaagagga ggacctgatg gacgacgatg agatgagtcc tgatgacgac     97980
     cctgatttcc gctgggaagt cacccctgag gagttcttcc gcgatggtat tctccgactg     98040
     ggtggtgcac ctggccaagg tggagatatc cgcgacttct ttcagtttat taccaacctg     98100
     cgtacagatg atcgcaacga taatattcca actttccagt tcacaaatgg cgccctagga     98160
     cgcaaccaga acgatgatga tgatcaggat ggcgatgaga tactaccttg aagcagcagc     98220
     cttgacctca gctaactccg caaattcctt tcatttttcg aaagcagatt ataattgctt     98280
     ctaagccatt caattgcttt acttttccgt taatcaatgc tctattttac catcattcga     98340
     agtaagagta tgtcgatatg tctgacctaa gctacagatt atctaatcac atagttatgt     98400
     acgaaccaat aagattatcg aatttcgttg aaaaactcag gcgaacggta cagcgttgct     98460
     tgcgcctatt agatgctttg agcatagcat atcacgaagt gacctcacag ctttaagcaa     98520
     tcggaatagt ctgcagatat ggtatgtgaa agtttattgc tgtttcaccg ctggaatcta     98580
     ggagcttgct cttggtttct taggttgtga atacgggttc cggatgaccg cattgacaga     98640
     tccaaagcaa gctgatgaag ccgccagtcg cgaagttacg ggctcggcac caatgtttgt     98700
     acgcctcgct tggtctgtct tacgttaacc agggagccat gtgcggcgtc actgtcagtt     98760
     ccactcacag tactaactat tacagtcctt ttctactctc tacaacactc ttttcagaag     98820
     aaactcggtg ttcgtcggta ctatctttgc gtctgcattc gtcttccaga ctgcatttga     98880
     cagtggcatt accgcctggt acgagaagca caacaagggt aagttgtgga aggatgtcaa     98940
     gctacagctg caaaacgggg aggacgacga tgacgacgag taagcatgcc tgctgtggca     99000
     tataacacgc ctggctgtga agtaacttgc gttgtagccg cgtttattta ttacttacct     99060
     gcgttcgcgc atattatggc gcgtatgggt cggcgtcaac cgtacaagct gtggggcccc     99120
     tacccgcgta atggccttac tgtcgcctcc ctgtgctcgt cggcatgatc tactagccaa     99180
     aggccgcaga ggaccgctgt tctttataac attaccgtat gtagccaatg gaagcataac     99240
     gaatacgaag ggtagctatc gttgctggtt tatatcggcg gagagcgagc taggctccgc     99300
     tacatatata tactatacaa gccagcagat tatgctgaca ggagttcagg ttagatgtct     99360
     ccgttggcgg aagcctgctg gattctggca acgtatgctt gcgaaatagc gttccagctt     99420
     ctcatgtact tggctagaca ctggtcaacg caagtatcct gtttgctggt gtaaggtgcc     99480
     attaagcatt tctcaaagca gttttccgtc actttgttaa ctaactcagt tgcatttgcg     99540
     acagccagct cttgagcaat ctggcctttc aattgatcct tgaccgaaga agatgcagag     99600
     gaagtaggta ggtttgattg ctgcgatggt gatccgccac caaatatcga agataacgcc     99660
     attcttgtat tgctcgttcg ttcgagtgct cgttcaaagc atagctgttt ctcatcgact     99720
     aaggatgaaa acttctcgag actatccgat cacatgctgt gaaattattc tcacattatt     99780
     gcaaatgttc agttacacca cagaggcgca agtggtttag tggtaaaatc catcgttgcc     99840
     atcgatgggc ccccggttcg attccgggct tgcgcatttt taaatttttg aggtgattgg     99900
     cgatccgcct gtctgcgaac tctactgcga ccttacccaa gaattaactg ctcggctggg     99960
     atagaggtgc atattgttgt agttcagact cacggctaac cgtgttgaaa actcagatga    100020
     ttcacgccgt cctgatatgt atgaacccct ttgccaccgc gcagccacag tacttaaatt    100080
     atcctactaa cacatgaagt taacaagaag tgccaaccta ggcttgtaaa gtactatact    100140
     cctgtcgatc tcccgaagca gaagctacta ctggagcagg tttacgagct gatcagccag    100200
     cgcaacagtt caattcagtc ttcattctta attacgccgc cctcgctact atcgagtggt    100260
     agtgaaacca ttaacgaaga tatccaaata atctacaaga actatgcaac actctatttt    100320
     actttcattg tcgacgacca ggagtcagaa ctggccatct tggatctgat ccagacgttt    100380
     gttgaagcgc ttgacaggtg ttttgcggaa gttaacgaac tagatctaat attcaattgg    100440
     caaactcttg agagtgtctt ggaggaaatt attcaagggg gtatggtaat tgaaacgaac    100500
     gtgaagaaaa ttgtggagac cgtcgacgag ctcaatagaa cttctaacca ggaagccagg    100560
     tttgggaatg gactaggaaa cgcttttcag gccatcacca tgggtggctt ttcaaattgg    100620
     ggtgcgcggc agtgaatatt agcacacact gtcttgaaac cccataataa atgaaataaa    100680
     tactccttgc tagtgtctaa gtacgaaaca acgccaaggc ttttgcatca tctatgtacg    100740
     cattcagttc ggcagcactc accatggcca ccaactcttc ttacttgcta tttcctgtgt    100800
     cttatttgcg ctttgctgcc tgatggtctc aagctcctcc ctaatcctct gtaattcttc    100860
     tcgttgaact tgctctgcct tcacctgctg gaactgctct ctgctttcag cggaaacacc    100920
     tttccgctcc caaggagact taataggtcc agtattccaa acaggagttt cacttgcagc    100980
     tgtttgtttg acaatcctca taagctcctg ctgctccgcc tggcgtagct tacgttcacg    101040
     ctcgtattgt tgtctcaact ctggggaaag cgcggcaatg agctcttcat ctgtcggagt    101100
     cgtgtactta aatagcagga cgcctgcacc aataattcca aatccaattg catagacgcg    101160
     caaccatcta aaccaaactg gacgctccat cttattcttg taaaggcatc atcatcattg    101220
     agagttactg cagggaagcc cagtaaaagt ataaaaccac aaatgccggg taaccgtccg    101280
     tccggtacca gggtcaacca tagtccgacg ttgagtctta tgtcgagaag atggaacgga    101340
     gaaccgatat agattcccat tgcatcataa atattaatta actagtgcaa taatatgtaa    101400
     atttcagtat taggtggcta acaaattaat agcccaccgc aacgatcatc tggaattgaa    101460
     gggtatcgat cctacttctt ttaacaatcc taatacgggg gcttactgaa gtagctgctc    101520
     atacaaaaat ggtgtgaaaa ctttagcggc ggtgaagatg attgcaaagc cctcatagat    101580
     cgccaagaga aagcccagag gtgtcctacc gcggaaattt atgagaacag agtacagggc    101640
     aacggtgaag aatactttgg tcaacaaata agggcttggc aagacaccag aaaggaagga    101700
     gatcggctgc ctaacccaat cttcgcccct gccaagatac tcaaagcaac ccttctgaag    101760
     cttttttagg taataactgt cagctgcaaa taaagagtag agagcgatcg acaaagtgtt    101820
     aatgacacag gcatgtgcct ttcgctcata gtgaaaacct agcagctcgt tcagaacctc    101880
     ctctcgatcc gaaaagtcca tatcaccaat ggtcttaaca agaaggacga catccatcag    101940
     acccacggcc atacctccac cggtcagagg atggcgcatg tttaaagcat caccaacgac    102000
     acacagccca gttacattat tttgggaagc aggtagccaa gagttgggca tacacttata    102060
     ggactttgat tctagagccg catcgaagga tttgcgaaga gaggggggaa tgaaaggctg    102120
     aacttccttc tgaagccact ccgggacatt tttcggtagg gtaggatagt tgtaggcaca    102180
     caaaattctg gtttcggtag atgatatctg gtatgctatg actggcatat gttcagagcc    102240
     caaaatgaca tgaccgtggt gtttggtggg aaggtcggca tggtgaagcg acaaaccgac    102300
     aaaagaagac cagaccttgg acgtgttagt cgttgatagc tcttttctga atctggagaa    102360
     gatcccgtcg cagacaaaag tcatatgcgc tttaaaatct acttttcccc tccctggtac    102420
     gtcaaccttc gcaccgatga cttccttcga gtcattgcgc aagatgctga taacgttacc    102480
     ctgcaatctt gtcaccctgt cctcagcagc gcagatcgcg cggaggttct gtaaaaacct    102540
     tccatgcaca aaccccacac catgctcccg ctcgtcctct tcaaactcct tcgcactaat    102600
     ggtgccgtcg tccacgactt tatcattccc gtcaaacact aagtcaggga tcttctcggg    102660
     aggactcaag tccgccttgt aagggtatgc gaacgagatc ttctcgccgt tgtatatgac    102720
     cgtgtacccg gacgtcgaac aggcatcgat gttgttgatc gcctgcacca ttcccagaga    102780
     gcgtaaggca cgcacacctg caggctgcat caattcgcca acaattctgt ccggctggct    102840
     ccactcacgc tcgacgatca ataccttctt acctttccga gccagcgcag tggccacgca    102900
     aggcccgacc acgcctgctc cgaccacgat cgcgtcgtac accacctttt catccgcaca    102960
     gagcagctct ttgggataac ttgtttcctt ggacatctga tggatatcta tactaacctg    103020
     cgcaggaagt ttgaagtttc tgttcgcaaa taatttgtac tgcgcctacc gcttaatacc    103080
     ttcacctttc aaagatgttg cagaatgagc acagaactat ggaccctcgc cgtctaggtg    103140
     ggctctatga gtacgctgaa tacttttata cctttcgccc acgtcggcta tcactcttag    103200
     gagataatcc actgatcctg ttgcgtcgga atctgatgat gagcgttaaa cgttctgatc    103260
     ggatggtcat atcgttaaca gtgatatctt taaggcgatc accgatcgtt taattggcta    103320
     cctccgagct ctaaacgaag gctaccgatg ctgagcccac ctgcagatgc gagccttata    103380
     gaacatagga agcccagaat gcgttctgcg gcgaaatttc tatgttgcct gacgacgtac    103440
     cgcaactagg cattgttttt gtattgtgtt tacggcattc gtaagttgct gtgatgacac    103500
     accaaactca gccgccagat ctctcacgag cttatgcctg accttcgcaa ctgcagcgga    103560
     ccttgtagcc gcggcgggtg attcagatac tgtggatagt gaagaagcag ttgtaaagta    103620
     gaattcctgt aatgtgttga tgaaggtccg cgatgaaggg tgcgtgggtt cgagcttagc    103680
     cgctggagct agtggtagaa tattgtagag cttccggcgt gcaatcttgt gatctagggg    103740
     aatgtggcta ttcgtaaaat ggtcgtattt tggcagaaag tcagattcta gccagtcgag    103800
     atatgcggaa gcctgttctt ggctccatgc gacaggtaat tgggtaggct gctgtgcgag    103860
     atgggctagc tccctatttc tggaggcggt atcctgagtt aggcgcacgg cattttctcg    103920
     tctaagccac gccaataggt attcgatatt gtagtaatct tgctgctgga ggacccaatc    103980
     cactgacgtg ataaataaag cagcaatgcg cagctcaggg tataagtggg gtctcgcaac    104040
     atgcgtgctg tcgtgcgcaa gcactgaaac gtagctgtgg tgttcgatta attccaacag    104100
     ggtagtagta tagaggtaaa actcgggtgg cagcccagtt agtgtcacca gttttaggat    104160
     catgggccca gctggaatgg catcttggaa atgcgcagag aacttgacct gcagggccac    104220
     agatgaaatc ttgtgatgta gctgagcatt acgagggaca gagctacctt ccattatctg    104280
     cgtgtagtag ttcggtaact tcttctgcca ctcagcaggt aagcattcga cggcgcggaa    104340
     gtacggcatc tcgagcgaac taacccatct aataaagtca tctgtatgcg ctggtaatcc    104400
     cagatgaacg catgcaaggt aatgaaatgc aagggtggaa agcatcgaaa ggcccattct    104460
     gccgccgttg gccgttctgt atctctctgt taatgtttgg gagggagcgc tgaccgtttc    104520
     atttgcatcg tccccggcgg gtggtgtctc cggctccata tgttttaggt atagcatcca    104580
     tatgatttta acggtcttcg agaactcgat tgggaagccc tgctcttcaa taagccatga    104640
     gcactgcttt cgcagaatat attgaaagca tttgagaaac aattctcgtg caggggcacc    104700
     gagcagccgc ttctcgtcct cgtgctgtgc gagtacctgc gtctgactga atgcttggct    104760
     tgactgaaaa ttccccgtgg cattagttgt caagtttagt ctcctagtta cgacacccat    104820
     agcgctaaat tcttcatcat cgtcgttgaa ctctacatca ccctccatga catggccgta    104880
     ctggcaggtc ctatggccat tgattatacg ccatagtctg cttctacagt tatcagtccc    104940
     gcatacaggg cctctgatat atgtggacat gtgctgattg cacctttctg gagaatatgt    105000
     gatggaaacg atggtatctg ttgaaatacc gtttcctata actttgttgg gaaagcacag    105060
     acacaaacgc tacaggtaaa agagataaaa agttcgctaa taatacattt gagattttat    105120
     tccttcgcta cacctacagt aactaagaac tatagaagtc gtcatctatg tctgtggtat    105180
     cggttcccat tgttgtggtg gtgataatgg tttttatagt tggaaccgtt cccattcggg    105240
     cctgctactc cgttcacgtt acctgttcca accggtgcca taataggttg aaatgcagct    105300
     ggatatccaa atggccctat aggggcgcca tttatgaaag ctggggcgcc gtggggagaa    105360
     tttgtggtgg gtgaagggct atgtgtgcta tttctccgat catcggcagg tccaccgacc    105420
     attgtaagca tctgagggac cggggggtag aacataggct gtggctggaa tggcatgaac    105480
     attccagggg aggccatgaa cggggtagat tgagaacctg ccggccccac tggcatggcc    105540
     atcatgcccg gaatgctgcc cattggcata tttccgccga tagcgttcat tatacggtgc    105600
     tggagacgca attgcgcctt ctggatggcg gtcctctcat cagggaataa agttctgaaa    105660
     gacctgtcca tagtacttat ccaggtgggg gtagtaaagt aaggcttctc aatcagaaaa    105720
     gcatccatgg ccttcccttc tgctgtttgc ttatgacgag accggctttc aaaagcctcc    105780
     ttggacttca ggaaaacatt gaagttcttc ttgaagtcct tctttaagca ttttgggcca    105840
     tcatcgccga aaaacggtgg attattacgt ctcctgtaag tgtttgctct accagccgag    105900
     ggtgaattag atggcgtgtg gccactctga ggcccaaact tgttctgtgg ccgcttcaat    105960
     tctaccttag atgaggctgg agtgctaggt ttggagtttc gattgctagt tttcgaggga    106020
     gttatcgaag gtgtggcagt cgagctagcc ggctgtggtg tgggtttggg agggagcgag    106080
     gggtttactt tcagggcaga tggcgacttg gaaggcaact cctcggattt tttaaaaatg    106140
     gttttgacgt cctccggcat cttgtatggt actttaaatt tctcagagaa cttttttaac    106200
     tcgtccaact gtatcttctt atcaacaggg ctcttcggtg ccggcggtga ccaacccttt    106260
     ttggtcgacg acaggatagc aggatcggcg ttgtgcggtt cattccgcaa actagggggc    106320
     acgtattttg taggtctccc cagtgccggt ttcgcgttca tcttcaattg ggcaagaagc    106380
     tcgtccccgc gacggtcgac tccggagtac ttgtcttcct catccattcc tgaatcatcc    106440
     acaacaatgc cgcgctcctc cgccaaatgt acgttacctg cagtgccctg tgcttctatc    106500
     tctcttgcaa ttcggtccgc ctccttgagt cttgtctcgt agtttggatc ccccttattg    106560
     atcttcgtag tgtataagta ctcgtcgaag gttgatgtga tgccgaactt ctgctcgttg    106620
     accgcaaatt ggtcccactc ctccgcgtgg tcctccagag atccttccag cgcaaacgcc    106680
     tcgctgtcgt ccggcgtcca cttttgcagc tctcgctcct tgacctcgcc agcgccggca    106740
     atatctgtgt cggtcctgaa ctcctgcagc ttaccgtccc tgcgctcgcg cgccttctgt    106800
     tcctcgcgcc gcttgatctg ctcccacttg tcgtccaggc tgaagtccac atccagcagc    106860
     tccagctccg ctacgtcgtc gccctcgata agcagtgtct cctttaactg cgcagacagc    106920
     acagccgcat cttcttcatc aattcccttg tcaataatcc gaggatactt taaaataaca    106980
     tccaccccat ttgacgtcgt cgcgttgcat gccaacagca tccccgaata cttcacgcct    107040
     gatggaattg tcaccacagc cctcccacca atgctgttaa cgagcacgta attcatccta    107100
     tcgctgaacg cttttttggt ttcctcgttc tcgtagaaag acccacccac atcattgcct    107160
     gtgcgcccgg ctgttaccga gctgaacgcg ccttcctttc tgctattcaa acttcccttc    107220
     atatttgggt cacgatcttt taagacctaa gtaatacgcc ttatttatat ctaatgttga    107280
     ctatcgtaaa tgctgtatca gcctcctctt ataggtttta taaaggtggc gtttggtgct    107340
     tcccggcctg ctatagtgtt aacgtagaag gtgatatcaa ggcaatgtgc gcacaaggtc    107400
     actcggtgtc gctgagatgg agattgaggt catcgcagtc tgctaagtat gtctcgcgtg    107460
     tgttttcggc atctttgatg aggccataag cgttggacac agccttgttc agcgcgggat    107520
     gcaagttcgc cgttaggcgg tcaagaagca cctttgcaga ggcatcggag cgctctgctg    107580
     tgcgagccgc cagggcctgc tgctctgcaa gcagctgtct ctcgaggtcc tctgcagcat    107640
     tcagctccgc gatgtggcgc tgctgtatga aggtcctgcg ggcgtagata tcctcgatgt    107700
     ctagcacgtg ctccgagacg cgcgcaggaa agtgggtccg cttgaggcgc gttcgcagct    107760
     tgtgaagaat gctgcggatg agctgttcgc ggtcgtgacg gaaggcggcc agctcgttgg    107820
     ggcccagggt ccgcgtcagc tcgcggtggt acgcggacag tgcgccctcg acagcgttgt    107880
     ctgcattggc actgagcaag tccgcgagcg agcgcagcag cgcgcggggc ggccgccgcc    107940
     atgtttttat gctgtagttc tcgggcagct tgtcgcggaa ggcccgccgc accgctcgcc    108000
     ggatatccca cgggttgaag tctgccacgc cccgctcggc cgcgctgaac ttgacgcgtt    108060
     tgcgaccctc aggccgcctc tgcgtctctg gcgcctcgcc ctccgcgtct gagctgccgc    108120
     cttccgagct gccggaccct ccgtgcggcc gtcgcagtgg gctctcactg tcgtcgcgga    108180
     gaaacaactc ccgcgccgcg ggctccgccg gcgctgcttg gtccagccgg aacgcatcgc    108240
     cgtccacggc gagcagcgaa ccctcttcgt cctgcgacgg gtcggattca gatgcgatct    108300
     cgtccagtat gttccttgcc ataagtccca cctcctggta tgctgacggc tgccggtttc    108360
     ttgcagggcc tagaaaaacg tctcagctgc ttgtgaggtg tatgcaaaac tttgcaggta    108420
     ctgcagtcgc atgcccttta tgtctgctca ccgtacttca gctatgccgc ctgaaagtgc    108480
     ttcgaggacg cggttacgtt aagaaagcat gtttttggag gtcgtgcagt ttgtgagagc    108540
     atgtgtttac agttttactt agtttgcgag ggcgtttggc gtgtgagtgt ccgcgctttg    108600
     gccatacatc tcggcctaaa aacgtatttc atacttcaat acagacgtta gatctgtaat    108660
     tatgctacac aagacaaaag ggtagaccag atattaaact tgaagaactt ctttgttatt    108720
     cgcatatgag gaaagcgccc acagcctctt atttgcggca aggcgggagc ttccaacaga    108780
     tgctaacgcc tgcctctttg cacttcggag agcatgcgtt atactacaga aaaagatcca    108840
     gtaatagcat actgcggacg tgaatttaat cgattagtct gccattgttc acgcggaaag    108900
     cagatttatc cagcaaaccc ttagttgcat gcgtgcagag cggtggatat atatattggc    108960
     aacagcgcca ggataagggg ccaagcgatg cagaacgaac actcggaatt tgcaaagatg    109020
     tcacagaccc tcaccaacgt ccaagaattg aggcttcgtg cctccactac ccggcatgct    109080
     ctctccgaca tcgtgcgcga gaaagactgg tctgactttc aatttgctcc tatacgggag    109140
     gcgactgttt cccgcgcgat gacgactcga tacttcgagg acctgtatag gtatgcggtg    109200
     tcggatgttg tgattgtggg tgccggctcc tctgggctgt ctgcagcata cgtgcttgca    109260
     aagaatcggc cggatcttcg cattgctatc atcgaggcaa acgtcgcgcc aggcggcggg    109320
     gcttggctgg gtggccagct gttctcggcg atgatcatgc ggaagccgac gcatctgttt    109380
     ctggacgagc tagagattcc gtatgaggac gagggtgact atgtcgttgt caagcatgcg    109440
     gcattgttca cctcgacagt tctttcaaaa gtgctgcagt tcccaaatgt gaagcttttc    109500
     aatgcgacgg cggtggagga cctggtgacc aagccctcgg ccaacggtgg tgtgaccata    109560
     gctggggttg tcaccaattg gactctggtg acaatggccc acgatgtcca gtcgtgtatg    109620
     gaccccaatg tcatcgagct ggagggatac aaggatgacg gcacgagaga ccccaagaag    109680
     aagcacgggg tcgttctatc tactacgggc catgacgggc cttttggggc cttctgtgct    109740
     aagcgactgg ccgcattgga tgcccaacac gctatcaaag gtatgcagtc gttggatatg    109800
     aacacagcgg aggcaggcgt ggttaaggaa tctggtgcta ctgcaggagt tgaatatatg    109860
     tactttgcag gcatggagac tgcaaccaag aaaggtgtct cacgtatggg acccacgttt    109920
     ggggcaatgg ccgtgtcggg cataaaggct gcggaggaga ttctaaggca cttcgccgaa    109980
     tagccaagca agcgattata taactttctg caggagtatt gtgagcctta acaattagat    110040
     acttgatatt ttatactagt cgtagatgag atatttacgt tatggtcaag gaatttatta    110100
     gttaacctgt gaaaattaga tagtgtctgg aaggtggtat agtcgggaga agacccatta    110160
     gaagtcctca tcgaaggtaa acgcaccgct ttctgactcc tgcttagttg atttagccat    110220
     cacaccggcc ttctggtaat cagaaacacg cttctcgaag aagtttgttt tgccagctaa    110280
     cgagatattc tccataaaat caaacggatt ggaaacgttg tagtactttt tattgcccag    110340
     cgctacaagc aagcggtcgg caacaaattc gacatactgg ttcatcaagc tggaattcat    110400
     tccaagaagc gcaacaggaa ttgcatcctg gaagtagcgc ttctcaatct caacagcttc    110460
     tgtgatgatc ttctctacaa tctcagtgtc tggtttgttg ttgaggtgcg caaacagtaa    110520
     acaagcaaag tctgtatgta gcccctcgtc tctgcagatt agctcgttcg aaaaggtcag    110580
     accaggcatc aaaccctttt tctttagcca aaagatggct gcaaaagagc ctgagaagaa    110640
     gataccctcg acagctgcga aagcgaccag tctttcggca aagagcgcgt ccttgtcctg    110700
     gatccatctt atggcccact ctgccttttc tttgatctca ggaatcgtct caattgcgtt    110760
     gaacaggtgg tcggcctcct taggatcctt gatgtaagtg tcgataagta gcgagtaggt    110820
     ctccgagtga atgttttcca tcatgatctg gaagccgtag aaacatttgg cctcgggaat    110880
     ctgcacctcg gcggagaaat tctccaccaa gttttcgttt acgataccgt cagaggcagc    110940
     aaaaaaagcc agcactcgcg agataaagaa ccgctcgttc tcggtcatcc ggttgttcca    111000
     gtcgtgaatg tccttcgaaa gatcaatctc ttcggccgtc caaaatgatg cttctgcgcg    111060
     cttgtacgcc tgccagatgt cgtggtactt gatgggaaag agaacaaagc gccgcttgtt    111120
     ctccatcagc agcggctcgt tcttctcctg ctctttcagg tggtgccgat gtacttggtg    111180
     ggatctcaag aactgctgat gctcccgcgc agcctgcgac aacgactgat tcgcatccac    111240
     gtctccgtca gccaccgcat gcttctcgtc tatgatatgc accttctcat gcgatcccag    111300
     ttgcggctga ttctccttcg ccagcgtcgg gcctaagctg cgtctggacg ttgtgaggtc    111360
     gagctcggat agtgcgtttg ctgtcacctt cgatggtgtc tcttttggta ctgatgtctc    111420
     tggcatagtt tgttgtgtcc cactggtccg ttgagtcgct acctggatcc ccggtcgatg    111480
     tccttgggct tcacgctact ggggtggaca ggagagagct ggcgctgacc cgacacgaaa    111540
     aaacccgcct atttatttcg cgtcacatga gccgctcaaa gcgcacctca agtgcgggta    111600
     acaaaaagca tcgaaaggca gcggattatg taattatgca gacctatacg aagatggcca    111660
     tcagcgcgaa gacgctatag aagatcagca gagggtacgc gatgagcacg cggacgttgt    111720
     gtagctgaag gtagtatatg aaaaacccgg aggacgacca ggtgcaccat acgaccgaaa    111780
     tcagccctag aatgtagcca aaccagttgt tgagggagca gaacacgccg acagtggcca    111840
     gaaaacatag gggcagaaac gagtagccca ggatggaggc ggtcttgagg aacgaaacgg    111900
     cattggaggc gtgcggaacc ggtgtcgcac tggggctcgc ggtttggctg gccgggctca    111960
     caggctgact catcaggcgc agaagctggt acagcgaaag cgagccgaac agcgcaacgc    112020
     cgtatatgta gccgaagtgc actttgcccg cggtgagcag catggtgcca aagaccaggc    112080
     agaacaggag cgggcccgaa aggtctgtgt cgttgaagat ctccagaggt aagttgacgg    112140
     acgtggtagg tgtgagtacg aacttggtct ttgtaagaat gtggccgaaa tttatcccta    112200
     gctcctccaa caacggcggc tcaaaggagt agccgcgcgt agagagcgca ttgatgatcc    112260
     cgttggggag ctgctcgttt gtaaagtttg cggggctgct gttcgacaaa ccgccagacc    112320
     cactcgggtc gaacgacatc gcgccctgtg ggaactgaaa ctgctgtgat ggctggtaga    112380
     aaccgccttg agaattgtga ttagcgtagt acgacattct gatgtttccc gctggctgct    112440
     atgtctcttc ctcgtagtct ttgagggttc cgctgtagca gtgtgccgtt ttatgtttca    112500
     ccaaatgcgg gtaaccttga aggccgaaaa tttttggcta ggcctcttaa caggcctgca    112560
     ctgcgtggag acatcggcta gctgatatag gttcggagaa ctcgtgggta ctcagagcat    112620
     caacagctgc cttggaggag gcgacggcga atagttaata gcaaatatgg gtgtgatcga    112680
     gaaaattaag gcgattgagg aggagatggc ccgtacgcag aagaataagg cgacggagca    112740
     ccatctcgga ctcttgaagg gtaagctggc gcgctatagg cagcaactgt tagaggagag    112800
     cactgcatcc agcggagggg gcggcactgg ctttgaggtg gccaagtcgg gtgatgcacg    112860
     ggtggtgctg atcggatacc cttctgtcgg gaagtcgtcg ctgctgggca aggtgaccac    112920
     gacgaagtca gaggttgcgc actacgcctt cactacattg acctcggtgc ctggtgtgct    112980
     aaagtaccag ggcgcagaga tccagatggt ggacctgccg ggtatcatcc acggggcgtc    113040
     caagggcaag ggtcgtggtc gccaggtgat tgccacggct cggacggccg acctgatcgt    113100
     gatggtgctg gatgcgacga agagcaatca ccagcgcgag tctcttgagc gcgagctgga    113160
     gacaatgggt atccggctca acaaggagaa accgaacata tacttcaaga agaaggagac    113220
     gggtgggctc aagatcacat ttacgtcgcc ggatcgctcc aatttgacag aggaagcaat    113280
     caagctgatt ctgcgcgact accgtatcca caacgcggat attttagtgc gggactcctc    113340
     ttgcacgatc gatgacttca tcgatgtttt gaacgagcag catcgcaatt atatcaaatg    113400
     cctgtatgtg tacaacaaga ttgatgctgt ctcgctggaa gaagtggatc gcttggctcg    113460
     cgagcctaat accgtagtca tgtcttgtga aatggacctg ggccttgaag acgttgtgga    113520
     cgagatatgg taccaattgc atttgaaccg tgtcttcaca aagaaacgcg gggttaggcc    113580
     agacttttct gatcctcttg tggtgcggaa tggctctaca gtcggagact tgtgtcatca    113640
     gatccacagg gactttaaag ataagttcaa gtatgctcta gtctggggat catctgcgaa    113700
     gcactcgccc cagaaatgcg gtctcaatca taagatacat gatgaagatg taatcagtct    113760
     cttcactaag tagataggta gtaatatata acctatgtta aatgaatgct gttaggaagg    113820
     agaccgatca gcatgggaga tctcagccgc tagtcgctcg ggcgggccag gccaaaattt    113880
     tgactaccgt aaaaaagtta aaccttgatg gcttcttcag aaagctttcg aggcagtgat    113940
     taggcagaaa tatggtcgca agtacccgtc gggcgctgcg agccattcaa aaattccata    114000
     ttaccactcc gatcttctat ccgaatgcaa aaccgcattt ggggcactta tactcttcat    114060
     taatatgtga tgtgcaagct agatggcaaa aacttaggga ttctgaagtg ctattcacca    114120
     ctggaaccga tgagcacggt ctgaagatac aaacagcaag tgaacagcaa ggctacgcta    114180
     gtcctaaggt gtttgtagat aaattatgca cccattttat cagcttagat gaacaggcta    114240
     acattgggta cactaggttt ataagaacaa cagataagga tcatatctcg aacgttttaa    114300
     ggctatggga gctttgcaaa gcgaatggct acatatacaa gggtgagcat agcggctggt    114360
     actccgtgtc ggatgaaacg ttctatcccg ctaccaaagt tgtccaggtg atcgacggcc    114420
     gcgaatttcc ggtgatggat ggttccaccg ttactgaagg tgccgagtac atcaatactg    114480
     agactcgcaa ccgtgtgatc caccagacgg aagtgaatta ctttttcaga ctatcttctt    114540
     tcagagagcg gttaatcagt catttgaagg aaaacccagg ttttatcctc ccgccatccc    114600
     ggtcagcgca gattttagat ctactactaa aggcagaact acccgacctt tcaatctcta    114660
     ggcctaaaac acgacttaag tggggcattt ctgttccggg cgatgagagc cagaaaatat    114720
     acgtctggtt tgatgcgtta tgcaattacg taacctcgat tggtggggta gatgctgtct    114780
     tagaggatag gcccattgct aacctagtcc actctattcc acagggctcg gtttcaggct    114840
     catctaaaga atggtggaat gctactactc atctcgtcgg taaggacatc gtgaaattcc    114900
     ataccatata ttggcctgca attttacttg ctgccggatt accgctacct gaaaaggttg    114960
     tggtacacgg acattggctt tcagatggtg tgaaaatgtc caaaagcttg gggaatgttg    115020
     tggtacctga agagatgata gagaagtatg atacagatcc aatgagatgg tttatcttgg    115080
     agcacgacac tatagaacat gatgcttcct tttctgaaga aggtctttgc caaacgcggg    115140
     aattgctgtg ctcgaagtgg ggaaacctcc tgcatagatg tggtggcccg aagtttaaca    115200
     tccaccgcgc tgtgcaaaag ttccatcata aaccgatcac agatttgacg aaaaataatc    115260
     ctgagctata cggtaattta ttgtccagat taacaacctt ggcagatgaa attgatcagc    115320
     tattatcaaa gtatgatacg gcaaatgctc tgaggctgat ctggtctatc ataaacgacg    115380
     caaacatggt agttcaacat ggggaacctt ggaaaaaacc acttgaggaa caagatctca    115440
     tcatctatac tgcagttgaa gctgcacgta ttgtttctat agcagcacag cccttcattc    115500
     ctgtgcttgc caatcgcttc ctggataggc ttgacgttca tttcgacaag cgctccttag    115560
     aatatgcaag tgtgggcgca gattcatctt atggcactac tgcaaacgta cgtgggagag    115620
     aggtcccaat atcgtcttta tcgaggcaac gttaggcaga actttaattc ctgtaaatat    115680
     acaaatacta cgataacttt ttgttggaga agctaagcat cgatagtgat aacttctgcg    115740
     tttagcgtgt ctaaatctag tataacaaac tgaccagaag agctgaactt tggaagtgtt    115800
     attagaacca cttctacttc attttctaga agaacttttc ggtagccata tgcatgttgg    115860
     ttgccaatga tatatacatg aggccactca ttcatgatga acggatcatt atccttatac    115920
     ggatagcacc acaaagtatc aggtgctgtt ggagcaatat tctgccattt caatgaagct    115980
     tctatcaaat ctagccggtg ttctatggtg tctcttaatt gttctgtccc gaggtatggt    116040
     ataacatatt tgcacatgtc gtctacattt tgcccgctgg atactaacac ctggattcct    116100
     tccagatcaa accagtaggg gttggttacc gactcaaaaa cttcactatt aacctcagca    116160
     aaataaggtt tcagtgcctg cttgaagaga gccttatgga gcggttgctg cggaagactt    116220
     ctttcacttg gatcgttggc accgggcaga atagttatgg gcaaactcgt tagtgtgttc    116280
     gccatgaatg aaccaagttc atctaatgca ccacctatac tattactttc gcaggttcca    116340
     acggaatcac cgcaaataat taacctagcc acagaagcta tgctaccagt gtccccgata    116400
     tcaccgctaa gcaaatcttg cagtaggcga agcttcagcg agagttttgg atcgtttgag    116460
     gctgcacaaa tcccggatat taacgcaaca ctcttgcctg gagctctaac cagaggcgct    116520
     tgaggtatag cttgtggata gcaaatgtcc acaacctgaa acgtacccgc ttctgcttcc    116580
     attcctagca cgccaacaac tgtccccgtg acaaagggcg tgctcgtaat gatatccccg    116640
     acgagcagca cgcgtccgct ttcatcttct agcattatct cgtctgtccc ctcgggatca    116700
     gtataacttt tcaccggagc cttcgtgccg taagtatcat tcacaacctc ctctaacacg    116760
     tttggcttat atttcatctc acagtagata gttccaacgc accaacatgg ttctcctgct    116820
     tgtatatcaa gcacttttgc tttttgtaca accggctttc cttgaatacg gaaaccgtca    116880
     tcccacttcc gctggcaatt agccaggacg cgtttcctac tttcattcaa acgatatgca    116940
     tacatctggt agaattgcat ctcatataca cgtttgtcat acggtagctt gaaagtgttt    117000
     gctctgttgt gcccgatagt taacttcggc cggtcgcggg ctacaatcga tgccctttgg    117060
     ccacttttgg gagttagcaa tagagctata acatcttaat acacctgcat catataacat    117120
     actcaaattt ctggagtaac tcatccatag tcctcgaaga tcgacgctgt ctctgtgcct    117180
     agtgcatgca tcctgtacaa gatgccttta caatttttca tgtcgtgatt tcgtgtgatg    117240
     ttcgtcgatt cttccgcacg tacataatac tatgtagtca tataggtggt tatatgaata    117300
     aatatacgat ttgacatagc tgatttctat cactctgtta gaatatctaa caaaccttgg    117360
     aactctggtt ccttctcatt tagtttcttt agtgtttggt actcccaaga cgtgtagttg    117420
     gtactctgtg cattctcttc agtaactgta atagtacgct tgatccgctc gagctcctcg    117480
     ttgtcgttta catgcacctt tgttctgcaa tgttccttta tgtcgggagt atgaccaatg    117540
     ctcatgccca cgcggaccaa tgtctcaatg ttctcctctg agttcttcac gagatcagtg    117600
     tccaggacaa tatttttact ctggagcacc aacaagacag tagatccgcc aaatttgaag    117660
     taacccagtt cttggccccg tttgaccttg tcgccagggt tacaagtgag aataatggag    117720
     cccaccatca tggcaccgat ggggatgtat aatagagtgc catattcctc cgatatgatt    117780
     ggaaccacaa ctcgcacatt ttctgcaaac acgtctaatt ccgttctcac agccataggg    117840
     ttgacagtat aatactcgcc actgatgtaa tggggtttac caatgacgcc attacacggg    117900
     gagtgaaacc tgtggtagtc ttgtggcgcc aaacggaata tccccacgct gcaacttctt    117960
     tcattacaaa gctccggaaa ttggccgccg gttagttttt caagggtaaa ggttctaccc    118020
     tttatccata tctccttcga tcgccgcacg gtagcgaaaa cagtacaccg ggagtcagca    118080
     ggagatagga gcacctttgg gtttggcgat tccggcgtgc ggctgccggg ctttaacttc    118140
     cggtaaaaga actcattaaa tgtcgtaaag ttagtttcaa ggcattctga catatctagc    118200
     gagtggaact tgataaaagg ttcaatatct ttggctgacg caggtctatc aaatttcttg    118260
     ccctgcttta ttgtcactga gcgcaataga gacttgaact tctttgactg tttcccccgc    118320
     gcattgtaga taatgcgaat acccaattta acgtatgcac tgatcttttc ttcaattaca    118380
     atgccggtat ctctatcctg gaccaagata tttgcgttgt tagagcctag cgcatacttg    118440
     ccgtaagtta acttgatcag tagtcttgaa aaccaacgtt tcgatgcaaa gtccgatgag    118500
     acataggacg gtttcaattg ctttttatgg ccactgctgc aaatggcgaa atgcgtgatc    118560
     aagtcattct ctgcatttaa ctttgagtgt cgtagagctt ttgtggcctt gacctgttga    118620
     caacaaagtg ggcatttctg gactctcctg aaggcgctac tattcttcca ttcttggagg    118680
     tgacgaataa tcacttcctt aggcagagta tcctttgacc aaggcgactt ccccgaatga    118740
     taaaaaaact cattaacctc atcttctgtg aaatgcccta gtccatctaa cagtagcgta    118800
     agctgtacaa cgtcaaagtg ctgcagtgta gacgcggcat taatgacttg atcccagaaa    118860
     tgctttttca agatatggta tgggaagaaa ctgagcttca ggtacattct tgaagcgtgt    118920
     gtctctgaca gggtattata tctcaggttc agtgggactt caagatccca gtgacatata    118980
     ccattggtcg acttccgcga tatgacgtct ttaaaatcaa cacttgcgtc cgccactcta    119040
     tcatgaaaag aaaaagaatc cctatcgagg acacgaaagt ctagcttgaa agacatctcg    119100
     tgggggtaga cctcaaaagc cgcttgctcg ttgtattccg ggttcaagct gtgtttcttc    119160
     catgatgtct tgaaaacgcg tcttccgaag gttataataa cgaagggatc catgtcaaaa    119220
     gtagtcgaaa atttatttct gagagggggc aggtctagaa ttcgtttaac ttccacgaag    119280
     gctacgccca tagcatgcgt cttcttggag atctcaaagt cgttattcct gggccgggct    119340
     ctgcgcatat tccgtttacg acggccaaat agcataacct cagtaccctc ggtatcatcg    119400
     ctggaatgac tgtccttctc ctttgcattt gaactctcgg atacctcggt gaagggtgtc    119460
     gtcgacactt cgggcacaaa tgcgaatgag tcaactgagc cattgttctg gttgtatctt    119520
     tttgactcca tgccttgctg gtcggttcca taagatttat cgtcagcata aaatatgtca    119580
     tccatatatt cccagtcgtc gttgtcgaat gtgtctcctt catcctcttc ttcatcctcg    119640
     atgtagcagg agaccatcga gtgttcaata atatcttcat aattcgtaaa atcatcaggt    119700
     gaagaatcag acaaggacgt gtagcccagc atgttttcat tgtcctcatc gtcgtcatca    119760
     ccttcgtcgt cctcggtatc cgcgagccgt tggccttcac ccaagagttc tatttcctgc    119820
     ttgcgttgaa tcctcctggc cgccagcgag tccagaagat aacttctcca ctcccggaag    119880
     acggccatcg tcgacggctc attgccagat gagaccagac tgaacgccag cagcacttct    119940
     ccagccttgt aaccagtgcg accactgtaa aatggaaccc attcagcact cctctcgggg    120000
     ctgtacttgc ccttttcccc tcggaacaga tccagtagag agaagcgtgc ttcacccagg    120060
     tacaggtacc gcccgcgttc gagcgagttg tctccattgt cctgccaccg gagcacgtcg    120120
     tcgtacagca gaacgcggag ccactctgac gaaggcttgg acggcagcgc caacttcagt    120180
     gtctggcgcc agctaggcgt cgacgtattc ttgaaccgct tggtccgatt gaacaccccg    120240
     ttcgtaacta caagacacag cgggttgcac cgagtgtctt ccacggtcac gatccgcgcc    120300
     tgctgcacct cgaccttgag cgtcaaacgg ggctgtcttg atcttctgcg tcttctgatt    120360
     aacccaacgc ccatgacacg cttttacact ccggcttccc tgctgctctg ttcatggtac    120420
     cgtcactaaa ccaactatca ataattacgc actttgagga attatttata acgtcgaata    120480
     aaatactcga tagacgcttc tacttccggc tacggctgcg cagttcgctc ccggcagcct    120540
     atcattgacg tcagccgttt gaaggtatgc tgccatctgg aaacgcatgc agttcgctta    120600
     cgatatctgg cccgcgggcc acggaaccgc ttgtcgcagt gc