(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_2

ID   ASHGO_2; SV 5; linear; genomic DNA; GRV; FUN; 870771 BP.
XX
AC   AE016815_GR;
XX
DT   01-SEP-2009 (Rel. 111, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 19)
XX
DE   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-
DE   1056) chromosome II, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Eremothecium.
XX
RN   [1]
RX   PUBMED; 15001715.
RA   Dietrich F.S., Voegeli S., Brachat S., Lerch A., Gates K., Steiner S.,
RA   Mohr C., Poehlmann R., Luedi P., Choi S., Wing R.A., Flavier A., Gaffney
RA   T.D., Philippsen P.
RT   "The Ashbya gossypii genome as a tool for mapping the ancient
RT   Saccharomyces cerevisiae genome.";
RL   Science 304:304-307(2004).
XX
CC   This Genome Reviews entry was created from entry AE016815.5 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..870771
FT                   /culture_collection="ATCC:10895"
FT                   /organism="Ashbya gossypii"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /strain="ATCC 10895 = CBS 109.51 = FGSC 9923 = NRRL Y-1056"
FT                   /strain="ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome II"
FT                   /chromosome="II"
FT                   /db_xref="taxon:284811"
FT                   /db_xref="taxon:284811"
FT   source          15710..56098
FT                   /clone="BAC clone bAG1580"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          24997..85798
FT                   /clone="BAC clone bAG2522"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          74742..122144
FT                   /clone="BAC clone bAG1411"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          116841..173436
FT                   /clone="BAC clone bAG2125"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          164242..237253
FT                   /clone="BAC clone bAG1528"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          210905..279269
FT                   /clone="BAC clone bAG1783"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          258681..300445
FT                   /clone="BAC clone bAG2001"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          274447..349321
FT                   /clone="BAC clone bAG1331"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          320307..395009
FT                   /clone="BAC clone bAG2210"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          349316..405734
FT                   /clone="BAC clone bAG2158"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          395006..447841
FT                   /clone="BAC clone bAG1059"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          408971..458407
FT                   /clone="BAC clone bAG1550"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          447841..506946
FT                   /clone="BAC clone bAG1244"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          459941..538436
FT                   /clone="BAC clone bAG1077"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          466277..554563
FT                   /clone="BAC clone bAG2084"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          542863..606987
FT                   /clone="BAC clone bAG2327"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          599244..672036
FT                   /clone="BAC clone bAG1123"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          666667..726304
FT                   /clone="BAC clone bAG1370"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          677885..751494
FT                   /clone="BAC clone bAG1053"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          739972..805945
FT                   /clone="BAC clone bAG2131"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          751489..825651
FT                   /clone="BAC clone bAG1222"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   source          805972..863518
FT                   /clone="BAC clone bAG2245"
FT                   /organism="Ashbya gossypii ATCC 10895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:284811"
FT   CDS_pept        2047..2991
FT                   /codon_start=1
FT                   /gene_family="HOG000144380" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059103"
FT                   /locus_tag="AGOS_ABL211W"
FT                   /product="ABL211Wp"
FT                   /protein_id="ADJ41749.1"
FT                   /db_xref="UniParc:UPI0001DB284E"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGA6"
FT                   /transl_table=1
FT                   /translation="MLRDIESTPLIEEHEHLEQLYLFYRYQYRLAICWLFCCVSHLSFC
FT                   SCILTRTWQLPQDEHVKKFISMLEYYDFYSSTACVAISIPMVPYLIMKRWEFTILPFFL
FT                   IPLIVYASMLWWVGDCLLNLFPLVKSWSLDDIATYCIWEGCILCAVVVLVPPAASLILF
FT                   RKAAPTGERAPELYLGAHLDAPGNDAELNDDSLSMKSARTLPKLKLVKMFLAGLVFPYL
FT                   LIQVFFVIRAYSGSILRDISGKSELYAHALLVLLYAKVVRLLSMLFCICYSLISSKTTE
FT                   TVSVYWPLVFLYQSGLVMDSFYGYIVSTVDLVG"
FT   CDS_pept        complement(7069..8505)
FT                   /codon_start=1
FT                   /gene_family="HOG000259757" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778102"
FT                   /locus_tag="ABL210C"
FT                   /orf_name="AGOS_ABL210C"
FT                   /product="ABL210Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS50561.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG293363"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000252538"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E76"
FT                   /transl_table=1
FT                   /translation="MGRIRRYLITRVTELLPGKKLSRERFRHEMDPRRTLSTVKPKTWL
FT                   FVASAFFALLVEATDFFIVSLNVVKIAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIG
FT                   DQFGQKASFMINIGMISILQLLTGFATTFPYFIACRAYFGVELGGCFGTATTQCLDDLP
FT                   ENARSWVSGGFQQAYSLGFLVATILTRVLADTTEKRWRTCFWFLSGLSFLSLLFRASLG
FT                   ETDAFLARKLMQQEGELHKRHVSTYSQIWNSLWNERYIVIYMILLMTGYNYFSHASQDL
FT                   FPTMLIKQLGYSPNQSAVTNCAANVGAIIGGLFISRFSSISSRRVVILVCILLAACLVY
FT                   PWGFVHDRSIIVSVFFLQFFVQGAWGLVPHHLHCLAPNSDTKTFFVGVAYQLGNLASSP
FT                   SSLLESSLARNFPLDNGNKELYDYGRVMAYFVWGSIALMFLVVTLGPEFNPNREYEFME
FT                   WSEEVSTDESMLPPTKQEIV"
FT   CDS_pept        complement(11466..12341)
FT                   /codon_start=1
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762453"
FT                   /locus_tag="AGOS_ABL209C"
FT                   /product="ABL209Cp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50562.2"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0001DB284F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E75"
FT                   /transl_table=1
FT                   /translation="MVRVMQKEDCHFRRLSDGTQIPSVGLGVYQVSEQTVQDLVYEALE
FT                   VGYRLFDSAQAYHNEDGVARGIAAWLKHAPGRRREDVYFTTKINTQNHGYEATKKSLEK
FT                   SLHAAGPLGYIDLVLVHAPMSDRTRRLGTWQALEEAVVEGQVRSIGVSNYGQQHLSELL
FT                   GWEGLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPLMRGKRLDDPILQKVAHQ
FT                   YDKGVAQILVRWSIQMGFIVLPKTAKKERLAPNFDIWDFELSAETMSELTHPDDYFVTV
FT                   PRWDPTTYEG"
FT   CDS_pept        12701..17320
FT                   /codon_start=1
FT                   /gene_family="HOG000034152" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762454"
FT                   /gene_name="ATG2"
FT                   /locus_tag="ABL208W"
FT                   /product="Autophagy-related protein 2 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="late endosome"
FT                   /protein_id="AAS50563.2"
FT                   /db_xref="GO:0005770"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058208"
FT                   /db_xref="HOGENOM:HBG202759"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="UniParc:UPI0001DB2850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E74"
FT                   /transl_table=1
FT                   /translation="MHFVLHCDTTAERTMSSWLPQNVQKRLLIYLLQQISIFSQIDTTN
FT                   LDVSLGCRSQFAFHDVELNVDHMRVPHITVESGHISELELGLVVSGGLDITGDGLCFVV
FT                   RPELSEVAGSHDLAQSLARSIMDLTNSMMQPLPEVLEGDEVLANSCSEAGDAQQPASSS
FT                   ALDKMRNKVLERALSNLTVRIINVRIQVLFPGQQSITVLVGSVELSTVDKTRRVDLQDI
FT                   CISHSELVPSPEQPDEFMSTSASNSIYMSAIDSLPFGSRSKMEENARNVRALLQMDKLH
FT                   VTFQGISSVEDISIRDLMLHMGRVDVFLDAIIAVDIGVFEVLVQFVAEFQQDTEVSETS
FT                   NTLQNYKRFRQEQNLEEDLQITGFTIEELRITLSQSVKVSVIDIQLRNRYIENSTVTVG
FT                   RVTICDYDLDLLHIDAGSKPCLELTVDSRKLQRIISVDGDIHMDISSTFVSSLIPLIFR
FT                   LQELGRGLHFVGTNNCKMSQEFKTQVETKTIILSLPVGDDTLQMIIQPISYELSLHTVF
FT                   TDFISISKVQSSETRDIAIIREIKIGYQTANFQVKSYNLKLSETLLTSKLRGSVSSVEL
FT                   YCSDSDIKWLFDGLSPYQDMITPYMHSKPEVRKPIMNKSVRILSASSVIHRQNVFSDMV
FT                   LLIERITCSLSADSISSFGNVKTELNSSLLSLNTDNSIIFHSSCVKGSTVFSDVKYCLF
FT                   EPIKTKDVTKPALFVQRFENGKLKVNVQNTCIYYHAKWLDILDESKGTKSTPQQESAVP
FT                   VPLQQRIEVKFHDCALSMHPYRLKSALLICVNRCILDISVPPANFKCIIRSPTFMLADD
FT                   CSNMKTSITESWESLVRYYSKAGFAVIGKSGLLSCTIKQSGGQICLDIDVDRIDLSICA
FT                   DSFQCLIQTLIDIKPPVSFPDEKKYRTEPCSIPVFENVDDEFFVPKGTSNLPALNDMHI
FT                   VDDFINNSNNSFSEVQVIEETEEGSPLKLEDNGLLFDEGHFNKEDIPVATDSKFFPFGP
FT                   VAIVLHLFVRKASIKLHDGYDWVYTRRSISKVVDDLEDEVHKQDQPGRVETSLFDSIYL
FT                   YATPDSNIKKAVSSNIQSEDIIAENYSSKMKLRPSKHHKILIELTNMKLTFSGYSYDEP
FT                   TEDIADWSTDLLNSIDVEVKTFEIVDNVATSTWNKFLTELKEAHGGSPSMLALSISLVR
FT                   PIDFLYATELIISAQVSPLRLHVDQDTLDFLIRFSEFKDARFDLIDDYPDIVYIQRFEV
FT                   NSIDVKLDYKPKKVDYVGLKSGHTSELMNFFTLDGAKMTLKRVVLYGVDGLGELHNCLS
FT                   SIWTPDITRSQLSGVLKGVTPLKSIITLGSGVKALVTVPLKEYRQDQRLTRSLQKGARD
FT                   FLKTTSGELIRLGVRMASGTQAILENTEEFFGGQGARARCMSARLPEDELSPVPSACDE
FT                   FDLFRSSIPRKQSPIVPIPSEEDDIEPLKAISLYADQPQNAQKGVKEAYGSLGKNLTIA
FT                   YGAVRRAQRDARHSISAQDAATAFARATPIAFIRPMIGATEAVSKTLQGISNQMDRDQL
FT                   VHMRDKYKQSSHYQRKRER"
FT   CDS_pept        17676..20792
FT                   /codon_start=1
FT                   /gene_family="HOG000165645" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762455"
FT                   /locus_tag="AGOS_ABL207W"
FT                   /product="ABL207Wp"
FT                   /function="zinc ion binding"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50564.2"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058257"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI0001DB2851"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E85"
FT                   /transl_table=1
FT                   /translation="MTNIQKPQLLLTYSDHINHRHSASEQVMRTSAEHKPATSSQKTAK
FT                   ICKQCKGVITQNSLKALGDYYHENCLVCHDCGALCRPKFFPYELPDTSEVVLLCQQDYF
FT                   TRNKLLCYVCNKPLSGVYYNTFGKLYDEEHFCCTVCGTKCKVSSCFHYNDELYCKYHFL
FT                   KYFSKRCKGCNYPISDQYIEFPRGEEIHCWHPECYGIHKYWHVNLSPEFVGIPELPLPE
FT                   EGAGPSTEDTNPTVNEMEKYTESLSGLISKTWNVLYRFEEETASCISDMFQYLTSYDQF
FT                   KGIDSAALFVLKLECLFKALDSLESVGKYSFVDSKKHEPKNTVLCAPESDANENMSSKY
FT                   SKFPRNLSTKIMIYLQLLRKMGSALKEKEVSVGSFMSVITSLAHFLKLLVRYGLYNALE
FT                   HSKAVHTSNALVKFLREIKKNETYQRDPFNYINVTIHATDCCAACEKYIQEECVQYQDN
FT                   RWHLGCFQCSKCKKGIELRDIGDAACNKMLKHIYCAQCSVTDPDSKPGFKPITKLSQLI
FT                   FLLKIALVRSRVVMALQMKNQEVMQRSNSVKETISMQQTYIRTLNDIKRLKSGRQSVRI
FT                   TNDQQDARKSRILKTAEIDVRNGSRTDMDKELVIETENSKSGHGSDSKVFNGQKSLTLD
FT                   DISRIVAAEQARELRPNAFTHFTRIKESDDETNTFVAKKSGTYYSELSIEQFYRLQLVA
FT                   LALLANGTVGLAVSDECIHKLLPQTPKSLNPSGGFWNKLFKTGKENKVMKYKKVFGTPL
FT                   EVLSERWGVDSDLSSGPAKLRIPILVDELVSSLHQMDMSVEGIFRKNGNIRRLKDLTAA
FT                   INENPSEVPDLSKENAIQLSALLKKFLRELPIPLLTFTMYDLWIQAAKLESKFDGQRVF
FT                   PLLYTLLPSAHRNVAEVLFSFLHWTSSFSHVDHQIGSKMDIHNLSTVIAPNILYQEAPN
FT                   NGSYGGSADVIHNTYQDAFAQNEGENYFLAIETVDYLINNNEQLSMVPMFLSTLLKEVE
FT                   DLNLTTYGAVKKHIDMLIEEGKIHVKDFVQKDSIQVKETASVTKVEIHK"
FT   CDS_pept        complement(21006..22544)
FT                   /codon_start=1
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762456"
FT                   /locus_tag="ABL206C"
FT                   /orf_name="AGOS_ABL206C"
FT                   /product="ABL206Cp"
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50565.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG211646"
FT                   /db_xref="HOGENOM:HBG322449"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI000025253C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E77"
FT                   /transl_table=1
FT                   /translation="MMCGEVTRTDAFEKDVIITVFGASGDLAKKKTFPALYGLYREGYL
FT                   DDSTKIIGYARSELSDAELRERVKPYLSKPDDAASEAKQAEFLERMSYVAGPYDKEEGY
FT                   VQLREQIEAYERERGVEKPHRLFYLALPPSAFVSVAEKIKQFLYAEGGVTRLIVEKPFG
FT                   HDLESSRKLQKQLEPLFREEEIFRIDHYLGKEMVKNLLPLRFGNAFFNASWNKENIQMI
FT                   QISLKEPFGTEGRGGYFDSTGIIRDVMQNHLLQVLTLLTMERPVSFDPESIRDEKVKVL
FT                   KAIVPLDHEDILIGQYGRSEDGTKPAYLDDETVSKDSKCVTFAALTFNIQNERWDGVPI
FT                   VMRAGKALNEGKVEIRILYKRVARGIFNDIPNNELVVRVQPDEAIYLKFNAKTPGLDSN
FT                   SQITELDLTYSKRYRDYWIPEAYESLLRDALLGDHSNFVRDDELDISWKLFTPLLNYLE
FT                   GPDSPRPEIYKYGSRGPDGLTKYLEKHQYVFEKSGLYQWPVSSPKEKASLEPRL"
FT   CDS_pept        complement(22831..24186)
FT                   /codon_start=1
FT                   /gene_family="HOG000191744" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625548"
FT                   /gene_name="NAR1"
FT                   /locus_tag="ABL205C"
FT                   /orf_name="AGOS_ABL205C"
FT                   /product="Cytosolic Fe-S cluster assembly factor NAR1 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="metal ion binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="AAS50566.1"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG139107"
FT                   /db_xref="HOGENOM:HBG738660"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniParc:UPI000025253D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E78"
FT                   /transl_table=1
FT                   /translation="MSAKLSESDLNDFIGAQVACVKPTRTLHTADEGDEALEVGKEPQE
FT                   ATKVSISLQDCLACAGCITSSEEILLSRQSHGVFLEAWRSLAPKALAVSVAPQSRLSLA
FT                   QHFGLSVAELDQCLSGVLGSYFGAKYVVGTQLGRELSVQQTNARLVERKQQGVQGPLLC
FT                   SVCPGFVLYAEKTKPGLVPYMLDVKSPQQITGALLHAADPNIYHLSLMPCFDKKLEAAR
FT                   EDCAREVDCVLTPREFVALLDELQLDLHSFAGAAVPIAQLTPPGWDPRVSWCSSAGSSS
FT                   GGYAYQYILHMQRLHPGSTIATQAGRNADLLEHRLLAPSGVLLASAGELYGFRNIQNLV
FT                   RKLLSPATKRSAKVVRRRLPQASPAPPATDPCNADFIEVMACPSGCINGGGLLNGGLGP
FT                   SQRRDLVSQLNEGYARLPTLDIPMPTYSQPSYIYNLRPLAPTDDVLTVANAW"
FT   CDS_pept        24590..26029
FT                   /codon_start=1
FT                   /gene_family="HOG000064089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762457"
FT                   /locus_tag="ABL204W"
FT                   /orf_name="AGOS_ABL204W"
FT                   /product="ABL204Wp"
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50567.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG028494"
FT                   /db_xref="HOGENOM:HBG350935"
FT                   /db_xref="HSSP:1A6R"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="UniParc:UPI000025253E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E86"
FT                   /transl_table=1
FT                   /translation="MVASVSRRGQTFARALRRGLTTSVRQPNRYRAMSIEITDLARWDQ
FT                   ELKADINHGLASTVLKNYNADEVLLDKTQLLKHYPRVFNVGLSEEVGPVTNQRSSGRCW
FT                   LFAATNELRLNVAQKLNLKEFELSQAYLFFYDKLEKANYFLDQIVDTANEEVESRLVQY
FT                   LLTSPVQDGGQYSMFVNLVRKYGVLPKDLYADLAFSTTNSAKWNSLLTTKLREFGQELR
FT                   EAAARGEDVSGRRTSMQKELVRLMSLFMDLPPYRPDEEFTWEYTDKDGKTQSLFTTPLQ
FT                   FAREHAGLDIAKPVSLINDPRHPYGSLIKIDRLGNVLGGDEVRYLNVDNDTLSALVVKR
FT                   LRNKRPVFFGSHTPKFMSKQHGVLDTRLWNYRGIGYEFTQDKASRIRYGESLMTHAMLI
FT                   TGVHVDSADKPIRYKVENSWGKDIGKDGYFVMTQEYFEEYSFQIVVDIDELPEELAAKF
FT                   QTKEEKPIVLPIWDPMGALAQ"
FT   CDS_pept        26254..28563
FT                   /codon_start=1
FT                   /gene_family="HOG000192536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762458"
FT                   /locus_tag="AGOS_ABL203W"
FT                   /product="ABL203Wp"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50568.2"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG153135"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI0001DB2852"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E73"
FT                   /transl_table=1
FT                   /translation="MRFATVAGLLPLLQYVTGQVVPAKDHINREYFAVEADGSLEELLE
FT                   AHPGWQFEHAVRGLERHYVLSRVRSELQPRAQVQHKAGGARAWHELVPHRLAKRMPIRD
FT                   AELGDQLSQRAVLKKELNIKDPLFDEQWHLLNTRYPKNDMNVTGLWQKNITGHGIVVAV
FT                   VDDGLDYESEDLKDNFCAEGSWDFNSNTALPKPMLSDDTHGTRCAGEIAAAKNQFCGLG
FT                   VAFNSKVSGIRILSEDITPEDEAASLVYGLDINDIYSCSWGPTDNGEELQAPSDLVKKA
FT                   IIRGVTEGRDRKGALYVFASGNGGALGDNCNYDGYTNSIYSITVSALDHRGLHPTYAES
FT                   CSAVLVVAHSSGSGNFIRTTDVNGQCFDHHGGTSAAAPLAAGVYALLLQVNPNLTWRDV
FT                   QYLTILTSIEVNPDDSDWQEGSLGRRYSHKYGYGKLDAYNIVELAKSWKNVNPQAWYYH
FT                   PTIIANQTIATPDVYIDSTTSVSRDALDKANLKRVEHVTVTVDIEASIRGFTTVDLIAP
FT                   NNHISHLGVVRKKDKSHAGFRNWTFMSVAHWGYAGEGDWKLQVRTTSKKNTVHLKGWRL
FT                   KLFGESIDASKAVAAEFGNDQEDLQDTPTGTSDEPVSSTSTPNSTSTSQDELNTGASKI
FT                   VPTHHAKNYYLMIFVVGAVILVLYLFFFSKTRRIRRSRAEAFEFDIIDTDSEYDSTVDN
FT                   HDPTARMLSDNDLNDFDFDLSDLEAPESPSDTGSATAAPHSKNDRSLSTIAENPFEAGD
FT                   EGIPQSEQGANHKYTK"
FT   CDS_pept        28895..31711
FT                   /codon_start=1
FT                   /gene_family="HOG000113525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778103"
FT                   /gene_name="SIN4"
FT                   /gene_synonym="MED16"
FT                   /locus_tag="ABL202W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 16"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50569.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058306"
FT                   /db_xref="HOGENOM:HBG202760"
FT                   /db_xref="InterPro:IPR021665"
FT                   /db_xref="UniParc:UPI0001DB2853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E72"
FT                   /transl_table=1
FT                   /translation="MHLEHLMSSTTAVSWSKIGLIAYGDAQSQDGNLCITFLETVNGSN
FT                   WRFHPPKKYVIHPQLHEDQSSNGNPKSPLFFHDLRSMHWNNWGLLNGELLAVCDELGNM
FT                   TVLAAGQGLNGNGAYDRLSVLFQDNIFKIHNQVLPLESVPKKDATPKVERKHTKKEYYS
FT                   TILDFQWIGNQKPSVAQVAAQRDRTNNIFKNQMHQCPPYGVFHPASIKSACIAIRRNGY
FT                   IDLWYQFSNTLDFKKISLQLSKDKESEWLQYAQIAHTDKEQCFLIGVFSNVAKSFAFYE
FT                   LLINWNVNTTNQAMFHDPKLTLRHILRVRPDALGPNGELLKLENFHVISKTALPGTRPE
FT                   ILISYNILGTERSLVRRFQMVLSNPDMVFLSSLGLAITALHNNHSVLRYSMKHVQDLTF
FT                   DSKIMDIQSHSLDALVCFRLHNGRFQLYNRHTWAVESETADAKQIGGYTKDTIISIFGS
FT                   GFNYPLLPPADAIEWCAISPSSGGIILKLKCKPQPTFYALEQSVLTDPSRDIVHATAFA
FT                   FEFVRFNNMIHSGEDLAIAAKTHVFRLQRLSEERAVNFIASVIGAILSLYGIHFDGPKE
FT                   ILEKLLQSKAIQKIFLLQMELGSHLKNKNVYSMAYASMKLRSINLAMNGVARNVHAMIQ
FT                   HTAVVNSLPNGRAFQFAFSKQDLIYSLIPSVNWFVSFVTFLTQQLIMLVNNPMDNTHSL
FT                   VLGILSCITTRHLMLKVILELKNMIGLITKFPETTYTVLNESSRFLRKALGDSPVNLEK
FT                   FEVFLNEINNKFLSLLDDHGAQSMDREPSFMVKAEIPPALGHVREFLLSFAGSALLAQT
FT                   NLAEVFFASTHNLRIFDHQHFHPSVANLLQPPEKGLVVDDAILPDACRGSSSFSPLDYD
FT                   DISSEWVDMSALVRIKRCVRCGCVTRAGNPVAKNNTILETSIVTKRWTALYSRYCQCTG
FT                   LLYELDTP"
FT   CDS_pept        32112..33422
FT                   /codon_start=1
FT                   /gene_family="HOG000141882" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762459"
FT                   /locus_tag="ABL201W"
FT                   /orf_name="AGOS_ABL201W"
FT                   /product="ABL201Wp"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="AAS50570.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG058102"
FT                   /db_xref="HOGENOM:HBG626719"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI0000252541"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E71"
FT                   /transl_table=1
FT                   /translation="MSSETRNTLYNPLDRSQISFIPAELSSINDSLGDSAYDTSSAEKD
FT                   YFDSMSLKRTVTNNTSSVKTFPGSSQEESDRLTKLSTRDSLGSDIIDRIRYKIVLNLSP
FT                   REIQLIRNSWTMMLTDDISTERTTALFRKLDKLPTVQQPQPPATSQPGGVAAAAGVPSA
FT                   QRRPASTTASSVAPSLSSGAASMVSQPATPAPALDNVNTNTIASSLFCAQFYANLLDMD
FT                   ANLEKLYPSIKHQAVAYAGVLTTAISHLENLSLMDGYLSDLGKRHNRILGIEPPHFELM
FT                   GIAFLKTIQDRFGIYCTIELTETWSRLYSYLANSILQFGIDPVLELNHMEEEIIFPIPN
FT                   LIEQTPTTKAPLTPAEIPQAETPAHNPPALSIPAQKATAPSLVPPHHPAISPSVSPASS
FT                   SPKSLPSKQVDSPSANKRVNFYKMKRKDGGDKDCILM"
FT   CDS_pept        33855..36224
FT                   /codon_start=1
FT                   /gene_family="HOG000095245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762460"
FT                   /locus_tag="ABL200W"
FT                   /orf_name="AGOS_ABL200W"
FT                   /product="ABL200Wp"
FT                   /protein_id="AAS50571.1"
FT                   /db_xref="HOGENOM:HBG058107"
FT                   /db_xref="UniParc:UPI0000252542"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E70"
FT                   /transl_table=1
FT                   /translation="MGDFYSSESNDNVRHARSLRNSVLLEGDVGERGAGSHGTGTETFY
FT                   ESTWESSLHDVGFSDDECEDGEETATQAFMTASPSLSALAGILSEKSKQAEEKMRSRSS
FT                   TLLGTTIEEDGEDDGLPGAPRVERSSVESALRSRQPLGGHALHSQTHLRHNSVLEADDN
FT                   GSIASSFQAGSMLSRTINRVRSRSVTSTITDQANSSGSGAVSMLKKRFPSMSQPKGDAT
FT                   PEKTQRKRRSVFSFLRRKSSAASLAESNASGEPPGIPTSSTFSVTKSASKESLTSATKL
FT                   TKKSYSSSSLFSTFKRNKDNNRSTENISRELRESLNTKKRTVTRPILEDNDDVAVRIDI
FT                   SDPNALFQQTPSKYNKESRTSISYSTAQTTPKQELPMTPKPALGFPRAESPSSTLLENM
FT                   HKVDSGEAVFPKSLNPLEVESIVSMERSRSHKSNRNSMASYRRSLTDNISIKAQNEGMF
FT                   VTEASEVILSTPDLTKSPTNSILRNGTFESLDGIPKSSDISLDDYTYSLTIPHKDGEEG
FT                   MNFSFSSIQEKLNELTMDTDEEEEEIKEVKVTPVQTPILPPNTDPDFMSDIAEFANIID
FT                   FGDEVDFDLELGTGDLKYKTLNPKDILQSDTLRADIRITSSSEYLREAHEPLGDEPRRV
FT                   TIGCDLTHDLSLKTMDYYDEDIDNEHFALDGEEMHPETVDPYLPAQSLAVNRPLSMSFR
FT                   GLTGPQFNRTHDLPRLNSEIGLNSYTMGDNDRSVHFSTRILLHDTYTEDEYDRRPDIAT
FT                   CNQLTPQLAQLIKEELNQVKSEMEIHEDSRCYTHFY"
FT   CDS_pept        36555..37421
FT                   /codon_start=1
FT                   /gene_family="HOG000177330" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625549"
FT                   /locus_tag="ABL199W"
FT                   /orf_name="AGOS_ABL199W"
FT                   /product="ABL199Wp"
FT                   /protein_id="AAS50572.1"
FT                   /db_xref="HOGENOM:HBG118732"
FT                   /db_xref="HOGENOM:HBG629943"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI0000252543"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E69"
FT                   /transl_table=1
FT                   /translation="MDFKSKLPKDVYPGHLICPIYHGVEENGTEFVYQFIPGPGTVQQQ
FT                   YTINGQQIDAIAATLLGKVKLREETNALDGSESAKPDAEADPKAENTTEASQGRRVVKK
FT                   MLVSVSKRASEEDLGSSVDTDFANHLPKEGDVVLTRVTRITLQRANVEILAVENTNSPI
FT                   DYGVGSKGSGIVASNGGNTGFSMSQVPSDLGETFRGIIRSQDVRATNRDQVKMVEAFRP
FT                   GDIVRAQVLSLGDGSNYYLTTARNDLGVVFAKASNGAGGLMYAVDWHTMVAPSTGVTEL
FT                   RKCAKPF"
FT   CDS_pept        complement(37527..38552)
FT                   /codon_start=1
FT                   /gene_family="HOG000176881" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082449"
FT                   /locus_tag="ABL198C"
FT                   /orf_name="AGOS_ABL198C"
FT                   /product="ABL198Cp"
FT                   /protein_id="AAS50573.1"
FT                   /db_xref="HOGENOM:HBG055781"
FT                   /db_xref="HOGENOM:HBG327719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI0000252544"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E68"
FT                   /transl_table=1
FT                   /translation="MVLFKRTKTVSDGDWDVKNLIAVRKPIIEPAPGCVPRAEEPLTAE
FT                   EEQKYKEVLQHFQLPELQLPTTEKHATEARVLSMEEKAWLTRECMIRYLRASKWVVRDA
FT                   INRITMSIGWRREFGISCFGEENGDSLLAATVSDENETGKEVVLGYDREARPILYLKPG
FT                   RQNTKTSHRQVQHLVFMLERVIDMMPSGQHQLALLIDFSDHEDVPKVSGNSKTPPISVG
FT                   KEVLHILQTHYPERLGKALLTNIPWLAWTFLKMIHPFIDPLTREKLVFDQPFVNFVPEE
FT                   QLDKLYGGLLDFTYVHEQYWPSLLQRTRENRAHYMARFRELGGHIGLSEYALRAHGDKS
FT                   T"
FT   CDS_pept        complement(38926..39924)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762461"
FT                   /gene_name="ELA1"
FT                   /locus_tag="ABL197C"
FT                   /product="Elongin-A"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50574.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058124"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniParc:UPI0000252545"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E67"
FT                   /transl_table=1
FT                   /translation="METGHPPSLQELCVVVLMRHHAQLEDIGHMPYALVRRVLLKMSAE
FT                   QLLRLERASPALLLEDEEAWQQLLKKDFPTNVHEVWVARKKDVYEYYLESVRELGPQVL
FT                   EDRALVRSLLRAAVCKDPVLFKYRVPSRQLYQRYVHEDARRQELSAARLRQSTLQLQQE
FT                   KQKTRITQLEDPLYLERELNAGRQRAAPQRSSIYLKSFKELRQRQAHFRSGGYDPTQRR
FT                   IVRVQTPSAQPAASLHPPPQSAPMAGSPQKPAPPEQPLAASPTPEAPGPLAQRRRPSAR
FT                   RQPPPASPAKRRSALFSSPALSTLLPQQDDTDSDTGGRPPKKPRVYIHTPR"
FT   CDS_pept        complement(40216..40317)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778104"
FT                   /locus_tag="ABL196C"
FT                   /orf_name="AGOS_ABL196C"
FT                   /product="ABL196Cp"
FT                   /protein_id="AAS50575.1"
FT                   /db_xref="HOGENOM:HBG058129"
FT                   /db_xref="UniParc:UPI0000252546"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E66"
FT                   /transl_table=1
FT                   /translation="MQLTNNTNKDESTENKDNWIAKGYMWTPQCVIV"
FT   CDS_pept        complement(40853..41917)
FT                   /codon_start=1
FT                   /gene_family="HOG000125742" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762462"
FT                   /gene_name="URE2"
FT                   /locus_tag="ABL195C"
FT                   /product="Protein URE2"
FT                   /biological_process="nitrate assimilation"
FT                   /biological_process="regulation of nitrogen utilization "
FT                   /protein_id="AAS50576.1"
FT                   /db_xref="EMBL:AAM91943.1"
FT                   /db_xref="GO:0006808"
FT                   /db_xref="GO:0042128"
FT                   /db_xref="HOGENOM:HBG416344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI0000069542"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NJR2"
FT                   /transl_table=1
FT                   /translation="MQQEIRNSNTPNTGSGNPVSNLSSALRQVHLGNSNTTTDQSNISI
FT                   DYTSRAPQQQPLDELSRGAAGGPAAGGGPEGSNMVGASSAAQVTAFGGPSVVDSSRITK
FT                   FFQNQPMEGYTLFSHRSAPNGFKVAIVLSEMGLNYNTIFLDFNLGEHRAPEFVAINPNA
FT                   RVPALIDHSLDNLSLWESGAIILHLANKYYRETGTPLLWSDNLAEQAQINSWLFFQTSG
FT                   HAPMIGQALHFRYFHSQKVPSAVERYTDEVRRVYGVVEMALAERREALIMDLDSENAAA
FT                   YSAGTTPLTQSRFFDYPVWLVGDHITIADLSFVPWNNVVDRIGINIKVEFPEVYKWTKH
FT                   MMRRPAVIKALRGE"
FT   CDS_pept        complement(42211..43869)
FT                   /codon_start=1
FT                   /gene_family="HOG000193307" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778105"
FT                   /locus_tag="ABL194C"
FT                   /orf_name="AGOS_ABL194C"
FT                   /product="ABL194Cp"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50577.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG382717"
FT                   /db_xref="HOGENOM:HBG522783"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI0000252547"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E64"
FT                   /transl_table=1
FT                   /translation="MKTCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATE
FT                   IFASIRAAYEVLSDAQERAWYDAHREQILNDDFENDEEDYTVDSAVTGVTTEEILHFFN
FT                   SGLYTRIDDTPAGLYQIAGKVFAKLAKDELICGRRQGLAEYSALNDDQFEKDIIELGYV
FT                   QACEKYQYPDQTVFPVFGYSATSYEDLRAFYKAWGSFNTVKSFSWEDEYMYSRNYDRRT
FT                   KREINKRNEKKRTQAKNEYNKTVRRFVTFIKKFDRRMKEGAKRAEAEKKRKLQETLRKQ
FT                   IEKDRLANEQSTGQFKLQSWQTVDQQCLDDLEKHFAGSESELKSADEEVTVLIYDCFVC
FT                   NKNFKSERQLQNHNNTRSHRKAVRQIQWEMKKDSLELGLDEISDLEEFDSAYEDAMSSG
FT                   PLQAAPASDLADIMAELAEIEQQLQQPASPSAQPCFEIDDQVESGEPSVAGDTEEPAVK
FT                   HTDPELDRLLASLVADEQSDDWDALPNKRSRKKQTKSAKRASATQTASRPFTAAGHRCA
FT                   SCSQSFESRNKLFQHVQSLGHGAPPQKVKKQQRKA"
FT   CDS_pept        complement(44012..46600)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778106"
FT                   /locus_tag="AGOS_ABL193C"
FT                   /product="ABL193Cp"
FT                   /protein_id="AAS50578.2"
FT                   /db_xref="HOGENOM:HBG058141"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniParc:UPI00015A2494"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E63"
FT                   /transl_table=1
FT                   /translation="MLAVGNSFDEIRSSGKIPLSLSEEKFDYTESEFDENDDSAVSEGH
FT                   IKLDKSFNFRGFMDMLTGKQKAFELAHQLDVKRGVSSGMDELVSPDALTEQPSNDEKAP
FT                   VGAIRRVPSGARHATVGPTLEATPVRQTTQGRGSDLLLMQSTPLAKPATLSRTQPKDLL
FT                   REKLIENHHRKASGNSVGSGQAQRDMVQEQKDLREEMSRLQEELAALENRQLKKDGEIS
FT                   QLNRTLNDKDMQLAELKKQLESKTGEVISQELKAANAHQRAKTLENELEQQKNKVRVLE
FT                   KAMETTAMEVEAERTRLNKDLEQVTLEYKKYKVETGLRSNETSNTLQQIKGKNKILKDD
FT                   LEKKTNEVNELRDNISTKEKEVSNLKNLLADLKVLVNELRADKSTVDVQLDIQKKELEA
FT                   ASSKLNSLRVEFDQLKNEKDTEINTLKADIENNWKKKQVRLEEVEAKCNDLTALLQKSY
FT                   ETNKELSVQLKRKDTEIGKINDQLKRTTVEKDSLRDFLEKAKWFEIPVGTILLDLFKKQ
FT                   RRPANGYKTILSEKYEIVGFRLTSDDELLNNLRQKVGSLENSNNLLQEELESKIKNTQE
FT                   MFGSQEASMKNDIIKLSEDLKARSAMIDKLQSVIDSLQKDAAALLKEKDESVNKNIELS
FT                   QHIAQLQEDQLQRDNTTFLELCQKNQEILQYNHEMMEKMHVMEAELRSVVKASNDLQFS
FT                   ISEKEAVLKEKQQIITDLQMNINQLRKNLEKLKGNPADMISFESAQRIYHNLDRKMYNT
FT                   LMVDQVNQLDLVELQNVVKNIILLLETPFSKLSKKMPLVSIYLRYEKSLCFHFANKLHF
FT                   QVYQEPIDIKKFTNDAYSQYLERHDITKIKHPLEICLEKLYDEVRSRLKY"
FT   CDS_pept        complement(46987..49026)
FT                   /codon_start=1
FT                   /gene_family="HOG000154406" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762463"
FT                   /gene_name="SQS1"
FT                   /locus_tag="ABL192C"
FT                   /product="Protein SQS1"
FT                   /function="nucleic acid binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50579.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058146"
FT                   /db_xref="HOGENOM:HBG202634"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI0000252549"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E62"
FT                   /transl_table=1
FT                   /translation="MAKRHKHYENRGSSGRGRRGGRAGHRGRGGRRRYAERNNSERAAP
FT                   VWAGSGDLGNPEMVDDYYFGRQADRRLWKKDSMRMGGFRPGDMGASEQPQSHLPARKRP
FT                   VTFTLARDVYDPSHNLNQLLNKQLDEGAEEEDSNSSSPSASGDDEPEGEYEPNPEPKMY
FT                   RISELNDDALFFVDEQGKLPTKIPAVEVAQQETPRSVEFNDTLTVGKVQLQLRQDSNGG
FT                   TFVDAPHAKRIFRDDLYGDVSEEEDEPETPKTEQLDNSKSVRTMQPPSPVPQLLSTNIG
FT                   RLTLSELASESESDTEKPTAEAGAEPPKGEPGFGFLDEDHLADMSEIQVTNIRLGAAAH
FT                   SYFVASPRTFGDSVARWVDHDTMVDIALELGLPEGRLHAYLRHVYEQLVPPEEPADDGA
FT                   DDHYGDENYDDSEEDEQDDEYENDGLIALVEHTLANDPYRNRDYNTKSLEYRGHGSRKR
FT                   LIIDKESMIDETVRTLLEDKAAQRSAKRAAKRHAKEDYIAEEARMSSDLFRKYPYGFHI
FT                   ENIIDELEAFLVSPRAALEFPPLDPHGRRTLKNLACAFALICKQVGQSTHTRVLVQKGG
FT                   RYEPDYDAVNRIRRQRRVFMRVDVRRPRDDITPREPRAKFHVREGAIVGGDAPTIGQDN
FT                   VGRRLLEKLGWTHGEGLGVHGNKGISEPLMARVKKNRSGLRYTE"
FT   CDS_pept        49057..50622
FT                   /codon_start=1
FT                   /gene_family="HOG000034154" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762464"
FT                   /gene_name="ATG4"
FT                   /locus_tag="ABL191W"
FT                   /product="Probable cysteine protease ATG4 "
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50580.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058153"
FT                   /db_xref="HOGENOM:HBG202635"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="UniParc:UPI000025254A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E61"
FT                   /transl_table=1
FT                   /translation="MGFLIAYVFNLSPCSGDEMFETIGLAIIHFEGLNTNRVSKCNQNW
FT                   HQESKQVAMELIQKVSQGLWELENCDTVNSVVVLGKEYPPVPEQRQEERHENGVNMFQH
FT                   IFTRQGRWNEEFLADVHTRLHFTYRTRFVPIPRHPNGPSPMSISVMLRDNPLNVIENVL
FT                   NNPDCFQTDIGWGCMIRTGQSLLANALQRACLGRDFRIDDNAANEHELRIIKWFEDDPK
FT                   YPFSLHKFVQEGFSLSGKKPGEWFGPSATSRSIQALVAKFPACGIAHCVISTDSGDVYM
FT                   DEVEPLFRADPSAAVLLLLCVRLGVDVVNEVYWEHIRHILSSEHSVGIAGGRPSSSLYF
FT                   FGYQDEHLFYLDPHKPQLNLASYQQDLDLFRSVHTQRFNKVHMSDIDPSMLIGILLNGK
FT                   DDWQLWQQHIASSQIIHLSDSKPVDLMLDHQLESAILGDRYLSEDGQGPSSKVDTGDYI
FT                   DVGSFVPCTDSSCKINESEDEYQDVKCKNQRIVVVGETTTNGSPEVEVEKVLVEKETIP
FT                   VRSK"
FT   CDS_pept        50695..51540
FT                   /codon_start=1
FT                   /gene_family="HOG000183445" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625550"
FT                   /gene_name="SSU72"
FT                   /locus_tag="ABL190W"
FT                   /product="RNA polymerase II subunit A C-terminal domain
FT                   phosphatase SSU72"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50581.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG022057"
FT                   /db_xref="HOGENOM:HBG381219"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniParc:UPI000025254B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E60"
FT                   /transl_table=1
FT                   /translation="MAPKRGSSPAIAGHCSLILSRGLPSVRVTDSNRQKKLIRHLHTFL
FT                   LYLPADTSCGYRPECGAASFRTRQSSLMVSSEMPNTSTLRLCTVCASNNNRSMESHRVL
FT                   KEAGYDVSSYGTGSAVRLPGLSIDKPNVYPFGTPYNDIYNDLLAQSAERYKSNGLLEML
FT                   DRNRRIKKAPEKWHDSQKVFDFVFTCEERCFDSVCEDLMNRGGQLNKIVHVINLDIRDD
FT                   NENAKIGGRAMLELVKALNSKMQECDQQGVPFEDTIMDVVADWQQAHPQLPLLYSPAYY
FT                   "
FT   CDS_pept        51850..53019
FT                   /codon_start=1
FT                   /gene_family="HOG000141883" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625551"
FT                   /locus_tag="ABL189W"
FT                   /orf_name="AGOS_ABL189W"
FT                   /product="ABL189Wp"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS50582.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG058161"
FT                   /db_xref="HOGENOM:HBG203065"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000025254C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E59"
FT                   /transl_table=1
FT                   /translation="MMLLSQPGIWLLVSLFLCSSVNSISLWKSHPLVAGSNEPDQKRPD
FT                   TPSSPRPLGITGAALLNYFEQNLRTMEVPDTAGVPQDSAYYTALTHYLGLCGARSENCD
FT                   PGQSAVAKLTRDVPVLTRVHSHNDYWRRVPLLQALAYGVASVEADVWLENNGTTLLVGH
FT                   NRVFLEPAHDLGRLYIEPITRMLQEVNCKSENKGDPYGIFYNAPEEQLLLYIDFKSLDR
FT                   KLTYKLLLDYLKPLIDNNFISYYDMDAKRFVSRPVTVVLTGNYPSDEEIGVPSPRRYTF
FT                   LDAPLGRLSSVGDEFTANNVSVVASSSLLELMLRCGKASNPSLTEQTAWESYGCLVEYV
FT                   REAHRRDLRARIWGLPDWPVSTRENLWDMLTDMGVDYLNVDDLDAVSKF"
FT   CDS_pept        53440..54468
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778107"
FT                   /locus_tag="ABL188W"
FT                   /orf_name="AGOS_ABL188W"
FT                   /product="ABL188Wp"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS50583.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG058169"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI000025254D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E58"
FT                   /transl_table=1
FT                   /translation="MPFLRPIIYFLLSNIGAALELPGTNSEHLTSFEDDSAVYGMQSTS
FT                   VPSNFKNTEVHRLTGNVTVHSWVHSHNDYTRDRPLFDAISYGVVSIEADVYLRGNNRLA
FT                   VAHVPMDVRDAKDLRELYLEHLERLLDEVNQQGQDSWQGIFYKYPTQSLQLLIDLKKDD
FT                   DKLYTVLMDDYLKPLIDKGYLSYIEIKTEEIVRRPLTVVLTGERPKDQRTVDGDRNEGY
FT                   FSDGRRYVFIDFEIGRMVCDKALYGPSVLASGNLVLTLAKCLKSMDIGKFASDPTDEQI
FT                   RCLRNVIKSGTAHMNTRLWGGPSAPDSLRDRLWKLQLEAGINMLNADNLAAAVKIGQEY
FT                   FG"
FT   ncRNA           complement(54597..55079)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR19U1"
FT                   /product="AgSNR19_U1"
FT   CDS_pept        complement(55351..57858)
FT                   /codon_start=1
FT                   /gene_family="HOG000247847" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762465"
FT                   /locus_tag="ABL187C"
FT                   /orf_name="AGOS_ABL187C"
FT                   /product="ABL187Cp"
FT                   /function="ribonuclease P activity"
FT                   /biological_process="tRNA 5'-leader removal"
FT                   /protein_id="AAS50584.1"
FT                   /db_xref="GO:0001682"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="HOGENOM:HBG058175"
FT                   /db_xref="HOGENOM:HBG397923"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="UniParc:UPI000025254E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E57"
FT                   /transl_table=1
FT                   /translation="MASRKQLNPNQEFKRQKVRNARQIRSEAAAASPEEFSETGHMLKV
FT                   GEFVTSRQFELEQLQSAIHRSRNSSSTRVFQSLPRRLRRRTASHNVRRIPKRMRNRALR
FT                   EMSKSDQLITSGTRQKPKHGISAGKLYKMKMAVSLLRLASRNTAMRLALPAGVTPATSK
FT                   LRQTIRSLHRQIKDAERGKQVHKLNNSMGSYDNTGVDELAPKPLGRIKYMRRQRFFTWL
FT                   PTHVWNAKRSHMMKRWGYQIPWSPTQKCFRMTHRLLGPTIASNGAMCADTSYMGTMVVS
FT                   ADNSGTVAAFADRLTDGRASKPKYRELQYLFEGLVYSTTASSPLGPGIILWVDANMLLV
FT                   RLHPAIYECVFKDAKEQGLRVHDCRYSISSFVIGGSKALQALSHIIRTPPGSNSESFQQ
FT                   FQRVCKISDSSVFPERTAFVFKAYDPRHLSKPTKLGTVPPPSASTIIKLQNEYPKTEIS
FT                   DVLHALCDPASRQESYKNQQTLKQLARRRRKLLTKEASRNLIPFDPAIDPEIPIAIVRQ
FT                   PASMNWLVMLPWFWLLPFWYQLHRVPHVYHMGLKQLHQQHFERGKLMFPNDYPFTPAGQ
FT                   DENSVYKAEASRNTWGRKPVGKRLNFDAIKAVHASECPGFDGEIGDHFSSDWKLLQILQ
FT                   NGTALLGSEIETHNPARTTQYDSETGLPQLNYVRDLLELHRSSVLQQDSSLKLPVTLYN
FT                   KPVVSFSKPPMDTGLPVQLAVVTTQLPVIAVVCTALERGHFRDNARLYAVPVKHLAHWQ
FT                   AVASRKYNAAGKRTHDADQPLPRVQDLVGFITSGTYHLGEGKSTGNGLISAEFAHRAEH
FT                   NLLLVRNVGTNRYRLAQWRQIYV"
FT   CDS_pept        58557..59858
FT                   /codon_start=1
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082450"
FT                   /locus_tag="ABL186W"
FT                   /product="Adenylosuccinate synthetase "
FT                   /EC_number="6.3.4.4"
FT                   /function="GTP binding"
FT                   /function="adenylosuccinate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50585.2"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004019"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="HOGENOM:HBG364928"
FT                   /db_xref="HOGENOM:HBG658237"
FT                   /db_xref="HSSP:1ADE"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="UniParc:UPI0001DB2866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E56"
FT                   /transl_table=1
FT                   /translation="MVNVVLGSQWGDEGKGKLVDLLVSKYDIVARSAGGNNAGHTIVVG
FT                   GIKYDFHMLPSGLVNPNCQNLIGNGVVIHVPSFFGELEQLEAKGLRDARGRLFISSRAH
FT                   LVFDFHQRTDKLRELELSGKSKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVSEQPEA
FT                   WAEFETKYRRLLETRQQRYGPFEHDAEEELARYRRYREELRPFVVDSVVFMHNAIQQKK
FT                   KILVEGANALMLDIDFGTYPYVTSSSTGIGGVLTGLGIPPRCIDEIYGVVKAYTTRVGE
FT                   GPFPTEQLNEAGDKLQTIGAEYGVTTGRKRRCGWLDLVVLKYSTLINGFTSLNITKLDV
FT                   LDTFKEIKVGISYSLNGKKLDLFPEDLLVLSKVDVEYVTLPGWDEDITKISRYEDLPEN
FT                   AKSYLKFIEDFVGVPVEWVGTGPGRESMLHKEVS"
FT   CDS_pept        complement(59995..61653)
FT                   /codon_start=1
FT                   /gene_family="HOG000205434" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082451"
FT                   /locus_tag="ABL185C"
FT                   /orf_name="AGOS_ABL185C"
FT                   /product="ABL185Cp"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="AAS50586.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG177204"
FT                   /db_xref="HOGENOM:HBG736291"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI0000252550"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E55"
FT                   /transl_table=1
FT                   /translation="MPINVRAAGLLAALAVLRLYVQPLYSLISDCDETFNYWEPLNLLV
FT                   RGFGKQTWEYSPEYSIRSWAFLMPLQVLLLGVRRLVQAREWPTATLFYAGRAALGLLSL
FT                   VFEKNLYLELVKTTNTEVAEMWLAFQLLNPGWFHASVELLPSSLAMVLLLGYLKDSLRY
FT                   LSTDKEKPFVSALFYLFLAGLLGWPFVLVLGLPLVLHYVLSHRMIVTLRTGFSSVLVLS
FT                   MILGCVFVVDSIFYRRLTLVPWNIVKYNVLGTSADSGPHIFGTEPWYYYVFSLLLNLPL
FT                   PTLIFAIVALLHTNLWPVWCSLFAWLVVFIAQPHKEERFMYPIYAFVTLASSIGFTKVS
FT                   KLLWRSKLYRHSFKGAVFAVLICQSVLRITALVNNYTAPLHVYSTLEPSDAPVNVCTGR
FT                   EWYHFPASFFLPDSHRLRFVNSGFDGLLPGDFPEEMPLLEVISQVPEGMNQFNKFDPGK
FT                   VVSIDMCDYYVDIMMQSDPEQDVFDPTDMPLGWEISTCAPFIDGANSSFLGRAFQIPAS
FT                   VLSRLPKSVRALVERYHKAKHLQYCVFKNSAAELA"
FT   CDS_pept        62110..63039
FT                   /codon_start=1
FT                   /gene_family="HOG000068104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625552"
FT                   /locus_tag="ABL184W"
FT                   /orf_name="AGOS_ABL184W"
FT                   /product="ABL184Wp"
FT                   /function="phosphatase activity"
FT                   /protein_id="AAS50587.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG074589"
FT                   /db_xref="HOGENOM:HBG646794"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006349"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniParc:UPI0000252551"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E54"
FT                   /transl_table=1
FT                   /translation="MTGQQAPVKLDTPAGVHSFLDQYDTFLFDCDGVLWLGTHLLPLVK
FT                   ETLAMLTAKGKQLYFVTNNSTKSRAAYAKKFASFGITVGVEQIFTSSYAAALHVRDELR
FT                   LAPGADKIWVFGEAGIQDELQLMGYETMGGADERLDAPFAADASPFLEGGLDPAVRAVV
FT                   AGLDTHLNYHRLSVTLQYLQQPEVAFVATNLDNTLPQKGLKLPGAGTMIQCLVTASGRE
FT                   PQACGKPNQNMLKSIVAATGLDRTRTCMVGDRLNTDMRFGADGGLGTLLVLTGIETEAG
FT                   ALAPSAEHPQPAYYADKLGSLYEFSEIV"
FT   CDS_pept        63194..64837
FT                   /codon_start=1
FT                   /gene_family="HOG000017623" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762466"
FT                   /locus_tag="ABL183W"
FT                   /orf_name="AGOS_ABL183W"
FT                   /product="ABL183Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS50588.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG000345"
FT                   /db_xref="HOGENOM:HBG635390"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="UniParc:UPI0000252552"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E53"
FT                   /transl_table=1
FT                   /translation="MSSRTGENLIKCPVCGRRVAFISINSHLDACTAGGGRKERGTTSV
FT                   SEMLGRKHKLEDEDSVTVISDVNMEDSEVIEMDDSPQRKRARATGTVNSDQRELQKMAH
FT                   LPLSEKLRPRELREYVGQQHILSQESGALYKYVSQGTIPSMILWGPPGVGKTSLARLLS
FT                   KTVNARPQAKITYQLVETSATKANAQELRTVFDNAKKEFRLTKRMTVLFVDEIHRFNKG
FT                   QQDLLLPYVESGGIVLIGATTENPSFQLNNALLSRCQVFVLNKLTEDEMNRVLTRGIAM
FT                   LNKCRRLLWENPRPLKLEMECIEYINRVAVGDTRKALNILEMVEVSTRQIPTDKSLQLQ
FT                   DMKSLLQNDSNVVRSYYDAGGENHYDTISAFHKAIRGSDENAALYYLARMLQGGEDPLF
FT                   IARRMVRIASEDIGLADNTMLPLAVSAHDAVMKVGLPEADLSLAHCAVALARAPKSVLL
FT                   YRGWKQLKGMLSENKYQMASSEIPLHLRNAPTKLMKDLGYGAGYKYNPTYKDGKVKQEY
FT                   FPLEVLANCTDRNELRFLAGPHLGTEVDPD"
FT   CDS_pept        complement(64955..65371)
FT                   /codon_start=1
FT                   /gene_family="HOG000190539" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625553"
FT                   /locus_tag="ABL182C"
FT                   /orf_name="AGOS_ABL182C"
FT                   /product="ABL182Cp"
FT                   /function="signal transducer activity"
FT                   /biological_process="two-component signal transduction
FT                   system (phosphorelay)"
FT                   /protein_id="AAS50589.1"
FT                   /db_xref="GO:0000160"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG058200"
FT                   /db_xref="HOGENOM:HBG395866"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniParc:UPI0000252553"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E52"
FT                   /transl_table=1
FT                   /translation="MSSVPIPTTVVNWDILNEVVSMDEDDPGFSQSLFVQYFDQADTTF
FT                   QQIQRELESEAPELAALSSLGHFLKGSSASLGLQRVAWACERIQNYGKRGEGAASAHEP
FT                   DAHYVQLISDTLQLARAEVQAARKELSEYYHTEL"
FT   CDS_pept        65825..66754
FT                   /codon_start=1
FT                   /gene_family="HOG000000849" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762467"
FT                   /locus_tag="ABL181W"
FT                   /orf_name="AGOS_ABL181W"
FT                   /product="ABL181Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS50590.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058209"
FT                   /db_xref="HOGENOM:HBG202637"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0000252554"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E51"
FT                   /transl_table=1
FT                   /translation="MIIIRLSALVLMATLLVSCAATTCPLPLPVVETVRQVTMGPGQRI
FT                   LFVGDVHGMYDQFHKLLAQAGTDADTTVVLLGDFLTRGTNPKGMLHYLLTNSHADCVLG
FT                   NNDIAVLFAAANPDRIKLFNRQLKSDHVNASDFCAIEFSSGAFLPPTTIKKEHVRVAAE
FT                   LGLSACAQLAARCSALTRYDLPSGDTVFAAHAGLLPGAWHAPRVYDLAWMKYVDPDDWD
FT                   RTAKDEFEGAVRWTDLWECPATPPNVSVVYGHDAKRGLTLANHTLGLDGACVAGGQLAA
FT                   LDYHVSVGGYKRTLHVVSCDYVTGGYPV"
FT   CDS_pept        66978..69023
FT                   /codon_start=1
FT                   /gene_family="HOG000115833" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082452"
FT                   /locus_tag="ABL180W"
FT                   /orf_name="AGOS_ABL180W"
FT                   /product="ABL180Wp"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50591.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058214"
FT                   /db_xref="HOGENOM:HBG202638"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015280"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR021661"
FT                   /db_xref="UniParc:UPI0000252555"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E50"
FT                   /transl_table=1
FT                   /translation="MSDSQDDFETAPDHFSEELKSHHGIFHGLKFYFADDINKDYYKSA
FT                   VSKLGGVVLEEPPKEVQRDQYIVSHVNTFDLPTVDPLFISNSLDQNTLLNVGPFLLPPV
FT                   NERSEYDVDVSDTSRIDSRIRQASAAQAEEEDARGTQHDDVASAAVAAAEAASLAHEHT
FT                   HATGRDVVRQKIDDARQELASSTRSGALDTNTAQSGQVGAVGEPAKAMLTRSSNLPPHN
FT                   KSSFTEEEDEFILDVVRKNPTRRTTHTLFDEISHYVPNHTGNSIRHRYRVYLSKRLNYV
FT                   YKVDENGKLLRDEKGEFIKTDVLPQGLKRKFTADEDYQLALNIKKQFYKDIYQVDPDTG
FT                   ESLIRDDDEPSTVAKRKMVMDPTFIPGKEPSFQDYNVGDRRGPLSREFFKTYGEKYPSH
FT                   TENAWRDRFRKFLLNYGIDEYIAYYENEQAHNRVPEPMKNMTNRVKRPGPAPGNYNNAK
FT                   KVKFMSPTSQQAHSASTNQYTIPQDDLLDEETLSFITGLKRDLSRMESHQNQAPDIPFE
FT                   YTQELAESIRNNFTMEETQFDNINPDEIPFPPQIATTDLFMPEFFHFATTRDFLNKVHE
FT                   IVNRTYHTSQAEKLVEDLRDECGIRKAFSTSILTALSGDLMVLPRYFLCAFRYSANPPM
FT                   NVPGIWTKEDDEMLKNNSDEDMKLLIKKHGSGRIEMRKRFHQNDLV"
FT   CDS_pept        complement(69346..71571)
FT                   /codon_start=1
FT                   /gene_family="HOG000201594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762468"
FT                   /locus_tag="AGOS_ABL179C"
FT                   /product="ABL179Cp"
FT                   /function="Rab GTPase activator activity"
FT                   /function="calcium ion binding"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50592.2"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG056234"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI0001DB2867"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E49"
FT                   /transl_table=1
FT                   /translation="MSTSLLFCKSQVLVRLSGSSKDQKSGVLLISKDEQQVAHDAMVAW
FT                   IAVDEMSAQEAEQLLKGEMKLAQDSQARVKIPKEVVVQAMYGTWSFAVKLGYIRSIQMM
FT                   PPDPNGWYQGSLSISSRNQNEEIPVLFLADDKCPSTRERSRQLIDTFQPFQSATGVYWG
FT                   GVDFKAAVERLAQLTVAPLDQTVFLLNATEEDLRQYTGRPAGSGVGSDGTAPVGDIING
FT                   WTWSALASLASATTKATSFVEGLVRKHPLVQLAERNSSNPYVRQMLENPRVQEVQREYD
FT                   SAKIYLARWSLGVKEQAEKYRKSNEHYRRLLAKEFNSDGDIEISEDELNTAMERTHPLS
FT                   KAEWDSLFDGMGRLSLSAQEIKERIFHGGIKDNQLRRRVWPFLLGVFPWDSTQVDRERI
FT                   ERDLREKYEKEYKNRWLSRETSPNQEEEAYWQDQLCRIEKDVKRNDRHLALYKYNTPDA
FT                   KPPAQASQESDSQCNEQSVTEESGENDDWEIKNPHLLILRNILISYNLHNDNLGYVQGM
FT                   TDLLSPLYAILEDEAMSFWCFVMFMDRMERNFLRDQSGIRDQMLTLSELCQYMLPKFSA
FT                   HLQQCESSNFFFCFRMLLVWFKREFEFADICTIWEILWTDYYSSQFQLFFLLAILQKNS
FT                   RPVMAHLTQFDEILKYFNDLKCVMDCNDLLIRAELLFVHFKRSIDMFERTTSHIPPSNN
FT                   STATGFRRRPSVERDASADVISDSLRAVLSTRLIIKRESERTKDSIK"
FT   CDS_pept        71627..72502
FT                   /codon_start=1
FT                   /gene_family="HOG000144426" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762469"
FT                   /locus_tag="ABL178W"
FT                   /orf_name="AGOS_ABL178W"
FT                   /product="ABL178Wp"
FT                   /protein_id="AAS50593.1"
FT                   /db_xref="HOGENOM:HBG058227"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="UniParc:UPI0000252557"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E48"
FT                   /transl_table=1
FT                   /translation="MVCSPSKIPTKASVAASLLPTDTYNGHRRSQLAQLAMKSDMSDEN
FT                   GYEDGSAEDYSLQEVAEDDLYAEGDNDDGDYQYDEGEDDEESAPSAKRTSRSARQRVVY
FT                   DYGEAEEEYEELDEEEVATDEVVSPRKKVSAITFADDEDDDDEEDDEEAAVVARARANS
FT                   RNKMVLDLMDENNVRKRGTDHLTEEELQLRRAENARKRRNLSEKKLEEEKQDTINKLLK
FT                   RRAGKSRSNLQASEKEASVDEAAYSKPRRPYHAIGMLRVLRTASEDRFAIAPRPVDDSA
FT                   AQRSPTASEG"
FT   CDS_pept        72794..74305
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082453"
FT                   /locus_tag="ABL177W"
FT                   /orf_name="AGOS_ABL177W"
FT                   /product="ABL177Wp"
FT                   /protein_id="AAS50594.1"
FT                   /db_xref="HOGENOM:HBG058231"
FT                   /db_xref="UniParc:UPI0000252558"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E47"
FT                   /transl_table=1
FT                   /translation="MNIPAVQPQQHQQSAQQPQQGHMEPQGQSMGGSSQHGYQFMQGGG
FT                   GQLLGSHMNMMASQHPYVIPPPFGNVHFAAQRQPGVPPQPVPVSPQGPGPEQQEAQAPP
FT                   GAGVGGRGPRARVAEAQPQAQFSGGGLPRRIPMSHMLSSYPVRKYLSNMALLRAHEVVN
FT                   QVNQSMGKVDDYEYWSRFTKDIFAPDGVLRYARKNGDDTRLFEFAMPIIPSLLKFLGST
FT                   GVVRIEMVPQQLHVQVLSNGTIFFEHPRCPVTYFYPDGSYMANFSRIKGIFDASLKIEW
FT                   CDVCTYSFVPGIEWNSLERVLSDQKVSQKIFQALAGSNAPPDTVPDGNKDYSLKMDQQM
FT                   PANFSAITQLRSQFKVFHNISSFGLHESLMRVLQVNDVMSYLKNLKVYQRVNNIQSPLE
FT                   SLRSFVAAAEERRRMSQPTTSPTKTTASAPMHGSAQQNPQANPSGLFMATMAYNPAVPK
FT                   NERKSFKKRPSSEVLLPLSSDDAMKSPMDGSDPDRSSNPYKKMKF"
FT   CDS_pept        74515..75138
FT                   /codon_start=1
FT                   /gene_family="HOG000141884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082454"
FT                   /locus_tag="ABL176W"
FT                   /orf_name="AGOS_ABL176W"
FT                   /product="ABL176Wp"
FT                   /protein_id="AAS50595.1"
FT                   /db_xref="HOGENOM:HBG103984"
FT                   /db_xref="HOGENOM:HBG123761"
FT                   /db_xref="UniParc:UPI0000252559"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E46"
FT                   /transl_table=1
FT                   /translation="MNHIKWPNEANIVPYKRPKTLQQITGLFYNAGFLFSAMYLLTSLI
FT                   LRPLLLRSHNQRLEMSYITLLRLRKLVNDLAKRLKTTPVTVIGFNERVAEGTNSGVKYV
FT                   DRCSQTSQEDFEQANMHLPHTDPSTENWERINGRISQAITSLNSFAYENAHTLDHCDRF
FT                   SFEAKLLADSLDQHRDTSFNKKCTEISDTIIELKSWFIRGSVPS"
FT   CDS_pept        complement(75222..75866)
FT                   /codon_start=1
FT                   /gene_family="HOG000000850" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762470"
FT                   /locus_tag="ABL175C"
FT                   /orf_name="AGOS_ABL175C"
FT                   /product="ABL175Cp"
FT                   /protein_id="AAS50596.1"
FT                   /db_xref="HOGENOM:HBG058240"
FT                   /db_xref="InterPro:IPR010487"
FT                   /db_xref="UniParc:UPI000025255A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E45"
FT                   /transl_table=1
FT                   /translation="MLGSYFANLPHLYVHAAGLRALSTSAQLRTKAPSARKLIKMVTES
FT                   SLSKKELESGTPIETQVGKGHEEVPEWKKQKLALHKKLNGEHWNPKKKLSRDQQDAVRM
FT                   LKQRYPDMTNSNLADYFKVSAESIRRILKAKWQPNEDEMLEMQERWKRRGTRIKEELRE
FT                   SGAIPERRIRIASDGNAFRVRSVETPGEKSSKGISTPLQKNLHRLLRNTRK"
FT   CDS_pept        complement(76213..78054)
FT                   /codon_start=1
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931076"
FT                   /gene_name="SSB"
FT                   /locus_tag="ABL174C"
FT                   /product="Heat shock protein SSB "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /biological_process="translation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50597.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI000025255B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E44"
FT                   /transl_table=1
FT                   /translation="MAEGVFSGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVA
FT                   FTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDANGSPM
FT                   IEVEYLGETKSFSPQEISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDA
FT                   GAIAGLNVLRIINEPTAAAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLNIAGGVYTV
FT                   KSTSGNTHLGGQDFDTNLLEHFKAEFKKKTGLDISGDARALRRLRTAAERAKRTLSSVT
FT                   QTTVEVDSLFEGEDFETSITRARFEDINAALFKSTLEPVEQVLKDAQISKSQIDEVVLV
FT                   GGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQAAILTGSNLSDDTKDLLLLD
FT                   VAPLSLGVAMQGDVFACVIPRNTTVPTIKRRTFTTVHDGQTTVTFPVYQGERVNCKDNT
FT                   LLGEFDLKGIPPLPAGEPVLEAIFEVDANGILKVTAVEKSTGKTANITISNAIGRLSSE
FT                   DIEKMVSQAEEFKAADEAFAKRHEARQRLESYVSSIEQTVSDPVLSAKMKKGAKSKVEA
FT                   ALADAFSALQIEESSAEDYRKAEIGLKRVVTKAMATR"
FT   mat_peptide     complement(76216..78051)
FT                   /gene_name="SSB"
FT                   /locus_tag="ABL174C"
FT                   /product="Heat shock protein SSB "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E44 "
FT   CDS_pept        complement(78295..79203)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931077"
FT                   /locus_tag="ABL173C"
FT                   /orf_name="AGOS_ABL173C"
FT                   /product="ABL173Cp"
FT                   /function="RNA binding"
FT                   /protein_id="AAS50598.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG058248"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="UniParc:UPI000025255C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E43"
FT                   /transl_table=1
FT                   /translation="MTNKRRAPLEDISNAIIGQVLETKDARIGRGNGEDFSVDRPQVTA
FT                   AALDGLFLDGRQLRIGGGQARSIGGWVRLRVARWSLRKALNTGHVLAAERGQAALIARA
FT                   HDSQTVELSGRSLDCTTLSLLRVVGQVAVTVTPALLTQLRCRQLKLRSAIRAWQDTVLL
FT                   PTHDSEALLADLRIIVSSGVYPASGPMLIHSCPPLPTPVAPLHAALALPTITQELELNK
FT                   PQVSFLIGENGSRIEYIKVASSAIVKVLPIKNKLQNSELKNPSCVRQSLAITGDLCAVA
FT                   RALTSIQAFLDLYHANAKHKF"
FT   CDS_pept        complement(79449..80531)
FT                   /codon_start=1
FT                   /gene_family="HOG000243992" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931078"
FT                   /locus_tag="ABL172C"
FT                   /orf_name="AGOS_ABL172C"
FT                   /product="ABL172Cp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="AAS50599.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG058250"
FT                   /db_xref="HOGENOM:HBG714231"
FT                   /db_xref="HSSP:1AAX"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="UniParc:UPI000025255D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E42"
FT                   /transl_table=1
FT                   /translation="MNRYALKFHKRGNNRQPSVPLPVTNRRSAECPEDDKCAMQKPRYL
FT                   AQPDRTLSEKFRYIQCLEDERLRDATLYPEASKWSLGPAVDKFNQYRNRYVNIIPYDRT
FT                   RVRLQVESGSDYINASYTHVDVPGQSVRRGNYISTQGPTRRTWQQFWQMCYQQCPGPDV
FT                   VVVMVTPLVEQGREKCHLYWPQSRSGVTTLHVPQVQSPSGLPGDVIAFATDLHVELVSE
FT                   SRHEHFVETQLLLRPGDPQLPVKRVHHFYFDQWRDMTRPDTVLPVLELSRRSHSASSPE
FT                   NPIIVHCSAGVGRTGTYITLDHLIHDTRDFTEGVCEDYSHDLIEQIVMQLRMQRLKMVQ
FT                   LLQQYEFIYHLAGCIYGHTA"
FT   CDS_pept        80672..83833
FT                   /codon_start=1
FT                   /gene_family="HOG000095257" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762471"
FT                   /gene_name="BRE4"
FT                   /locus_tag="ABL171W"
FT                   /product="Protein BRE4"
FT                   /biological_process="protein transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50600.2"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058258"
FT                   /db_xref="HOGENOM:HBG203089"
FT                   /db_xref="UniParc:UPI0001DB2868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E41"
FT                   /transl_table=1
FT                   /translation="MEVLKGSYKQKSFQSLKDLGQQGSSAAPGVRPTKSLQTSPIGSWT
FT                   SLSHLRLEKLAEGSGWEELQDYGLEELRDGFFDASYSRPQRVAATEPPVSTSPKAQSPL
FT                   AVRCKAFRDRLRVHWKAVVKFTVAYLAAMFLCLVRPASDWIGDVYSCFLPVAVLIHHPV
FT                   RTVGVQLEITVQSIVGLALGQGWSALWWYVCSVARVGRHEGALLFLSLVLSGLWSSWLA
FT                   AAYGRLVYMSVSFGITATFFATSMPPSEGSLPIWRHFWDQGMSYLFGLLLSLLVCIFLF
FT                   PRFGHATIGRGFSSAANDLKHLLDYLVDARYCNDIPMLVEAQENAVSAIDVRLSEGYRE
FT                   FANQFSITRFDGKLLEQLRNSLTIAASPLRSLPLGHGLLTNVELERFHQARPQSAPENT
FT                   ICVRDADDHYEDQAIKTEESANLGLACGSTDLCSAIIRDKFSETIFDLIMELIHALNSL
FT                   QVGLNNISESNVSASERADIKANILACLSNLHDRIRRLDIKYKEFGRAGLFTSELLLNP
FT                   KSSDALVFLRYIRQCAKHMTKVLEVFLQLNASVHWRVIPPKYQWHRAIHRLSHQCALDQ
FT                   GASFLWNYFQTKRDVDDAFEMIYNSYTSKHHEVSDLFSRQGMRPRIRAFDHKDFAVHST
FT                   SNPIRYKLWQLNNSLLGPESRWARKFTVVLVALCLPGWLPGSKVWYREYHCLWAPIIYV
FT                   ILSNRRNSSNWRALYKRLAGCVLGVFWAWCANQAKHYSNPFIIATFSVLLCIPLAFNYF
FT                   AYNRRKSTLAALICFTVPALVTFFLEEHTTASLWKQAWTTGVALLIGTFCSIPINWFIW
FT                   TFTARSELSLAVSGLLMHLSQSYQIVAGRYLYRDTDDHPNDLTRSLASIREVRLSQSLL
FT                   ATRALVRSAVSEPNIVSEFRAYLFDELLDHFSVLLERLIEARRLGQHFQVWDRDPNTET
FT                   TRALLSLRRDNVASVIFIFYMLSNCFSSGSKVPKYLPNPIFVRKKLFDTFMKLAEDASA
FT                   RGTSAHSSTPAAPNNTDPSSPSSAGQDHWDEVYAICFSRAFTDISVELQRIIDLAKEIL
FT                   GQEGD"
FT   CDS_pept        complement(83965..84090)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762472"
FT                   /locus_tag="ABL170C"
FT                   /orf_name="AGOS_ABL170C"
FT                   /product="ABL170Cp"
FT                   /protein_id="AAS50601.1"
FT                   /db_xref="HOGENOM:HBG058263"
FT                   /db_xref="InterPro:IPR018943"
FT                   /db_xref="UniParc:UPI000025255F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E40"
FT                   /transl_table=1
FT                   /translation="MITDSQLNNLAISFGLAMFASIVLYYFVCSMSGDDTENKKS"
FT   CDS_pept        84308..84568
FT                   /codon_start=1
FT                   /gene_family="HOG000248270" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778108"
FT                   /locus_tag="ABL169W"
FT                   /orf_name="AGOS_ABL169W"
FT                   /product="ABL169Wp"
FT                   /protein_id="AAS50602.1"
FT                   /db_xref="HOGENOM:HBG058269"
FT                   /db_xref="HOGENOM:HBG626636"
FT                   /db_xref="InterPro:IPR020301"
FT                   /db_xref="UniParc:UPI0000252560"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E39"
FT                   /transl_table=1
FT                   /translation="MAHIPPIFEEWLFRKLLYSRGFQSFVRTVYCKINGIKPRAPQSIV
FT                   NSGLPFHPTRGQKFRAFRVLFWDEVKVVFGATRTFKKSGKQ"
FT   CDS_pept        complement(84647..87043)
FT                   /codon_start=1
FT                   /gene_family="HOG000195804" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762473"
FT                   /locus_tag="ABL168C"
FT                   /orf_name="AGOS_ABL168C"
FT                   /product="ABL168Cp"
FT                   /protein_id="AAS50603.1"
FT                   /db_xref="HOGENOM:HBG053118"
FT                   /db_xref="HOGENOM:HBG328372"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000252561"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E38"
FT                   /transl_table=1
FT                   /translation="MNIIRKFMESGSKPEVVSIPSGQLYLTRSRQSPKSSSECLYNDAT
FT                   VTVRACARYAYELVVRKQAEEELTPGAEDDDEDDGLSELSGQSTEDEWVFRLDETLRLH
FT                   RRWNKSGELTVVWRNTKGDCGEKFQFVVNSDIPLGDVEDFLETVYRCEYEAKYRRLASE
FT                   ATEQDLKQFDFSYLANHDSAVFFSDDETEVREPEFLSAQMGALAISDDDSDEDPDLYED
FT                   ALDEPQPRLHTNPPGVVRFLQYGDLSVYDPMTGRYALQERNVNVALLQDNKHRYVYIEG
FT                   SEIILAVETLPEVNPFLEVGIRSFLFNYTHEGIVLSYKVKFKNAAAFTHFHLHWTIALW
FT                   EMSTGQKWSDLSETEQNYILYSTSGKNEELDVFLEEPENQNDTLGDAQIGTDEQEEEEE
FT                   EEAEGSNLLISSSSFGDDEYDERRAEREYEESTSNVGNKALAVGFKSDRTFVLRGDKIG
FT                   VFKTSDADSLDFVTAINEVSDIKGNVLNPNSAMLYTEDRALILQDENHKERLFKMDLER
FT                   GKVVEEWVAGGRDVLQIGPNKKFDQLTSEQTFLGIAPNSVFQMDPRLSGQNKVVSSSDY
FT                   SYSSVRDLRSLCTTQLGYVAVGSNKGEIRLYDKLGKRAKTLIPALGEPIRHLCASADGK
FT                   WLLATCKSSILLFDTEVKEGRNAGALAYQKSFSQGALPQCYVLKVDPSTAIYMQTETGA
FT                   PIEFTKATFNTGLDTKEQTITTSTGPFAMVWPIKSILQGKKTPYVIKKYHSNVTEESFK
FT                   FGSDRNVIVALKDDISMAKKKSFRAPSRAMLTKMGKQKSRKASKE"
FT   CDS_pept        complement(87380..88372)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082455"
FT                   /locus_tag="ABL167C"
FT                   /orf_name="AGOS_ABL167C"
FT                   /product="ABL167Cp"
FT                   /protein_id="AAS50604.1"
FT                   /db_xref="HOGENOM:HBG058277"
FT                   /db_xref="UniParc:UPI0000252562"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E37"
FT                   /transl_table=1
FT                   /translation="MRARRPRLTFLLLVSVLLVSLCQQQPANGGPCANSDVLDQIRAEW
FT                   RFAALSRRWAPLALLALLRLLVALLALLVALLVALLSLLRLLVALLSLLRLLVTLLSLL
FT                   SLLRLLVTLLALLRLLVALLALLVALLALLIALLALLVALLALLIALLALLVALLALLI
FT                   ALLALLVTLLALLVALAESLLACAVLSIVRVSLPSLPIPLYIMLSDSATSHMTLAVAAW
FT                   PALAVLAGPPLVPPTMAVSTLLLLPAWASSGAVAAAVGRLPFVIVCAFSARHLNCSSGT
FT                   SLWQSRTSRPPHLMFIYQPLAPLHIVRHSRKCVSGCATYRRRSALPRLP"
FT   CDS_pept        88547..89791
FT                   /codon_start=1
FT                   /gene_family="HOG000225685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931079"
FT                   /locus_tag="ABL166W"
FT                   /orf_name="AGOS_ABL166W"
FT                   /product="ABL166Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50605.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG461643"
FT                   /db_xref="HOGENOM:HBG746084"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="UniParc:UPI0000252563"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E36"
FT                   /transl_table=1
FT                   /translation="MKLDTSNMRYLTADDFKVLRAVEFGSRDHELVPVHLIHRNSGMRA
FT                   MSGTNRSIGDLAKLKLVSKLRNAKYDGYVLTYNGFDYLALKSLLEKNAIYSVGNTIGVG
FT                   KESDIYQVSDAASQSLVMKIHRLGRTSFHTVKTKREYLKRGQSANWMRLSHLSAEREYA
FT                   YMCLLYSKGFSVPKPYANSRHAIVMEYIRGYPMRRLRSHSNVPKLYSDLMAFVVKLANH
FT                   GMIHCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK
FT                   KLKYEPKSDRTFLDTDGFGDGFRYAYPVFARDVNRCDNLDELVMASGFKKQHPGDRDLE
FT                   QSMDAMRNTDYTDEQSDSDAEEDTESEEYDELSEEDSEEEEDDLEEENKRIIEALSTGV
FT                   GKLKMDNLGNYILEE"
FT   CDS_pept        complement(89837..91102)
FT                   /codon_start=1
FT                   /gene_family="HOG000066074" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762474"
FT                   /gene_name="RTT106"
FT                   /locus_tag="ABL165C"
FT                   /product="Histone chaperone RTT106 "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /biological_process="transposition"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50606.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0032196"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG189714"
FT                   /db_xref="HOGENOM:HBG202644"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="UniParc:UPI0000252564"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E35"
FT                   /transl_table=1
FT                   /translation="MPEFLERLPHAVKQKVLQISNNDAKILGVFEQVFQCGQENQDARR
FT                   KAVKTGVSERLEDSELIFELRDVSFLSPIRKKLNLAITIGSDGKPALLFNKDRVPEMAI
FT                   PNLQESVKFAAFLPFPEKKNLLYLFIVYRTASDEAPDPVLLTMNKEGVLKQFKDKGLIP
FT                   VDSSNFGECVDYMRKQAILTGFRIGDPFSNSQGPPAFHVECHRGTKEGTLYFLPDHIIF
FT                   GFKKPILVFESNEIESITYSSITRLTFNVTLITKNQEKYEFSMIDQSEFANIDEYVKRN
FT                   QVKDKSMSDELKAKPMVKAHQVGEQSALKEAQQQLRENRPTGGVPIDSDDEEADGNFES
FT                   ESELSDGSGSDSEADSDEDADDTDDSDGTNDTHDVLQHEEIQIAAADAEDEVLPDFDQA
FT                   EAGIDIVIEEDDEEEGSGVEYD"
FT   CDS_pept        complement(91564..92646)
FT                   /codon_start=1
FT                   /gene_family="HOG000172923" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778109"
FT                   /locus_tag="ABL164C"
FT                   /orf_name="AGOS_ABL164C"
FT                   /product="ABL164Cp"
FT                   /function="ARF GTPase activator activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of ARF GTPase activity "
FT                   /protein_id="AAS50607.1"
FT                   /db_xref="GO:0008060"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0032312"
FT                   /db_xref="HOGENOM:HBG329000"
FT                   /db_xref="HOGENOM:HBG538808"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="UniParc:UPI0000252565"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E34"
FT                   /transl_table=1
FT                   /translation="MSEWKVDPDNRRRLLQLQKLGGNKKCADCGAPNPQWASPKFGIFI
FT                   CLECAGIHRGLGVHISFVRSITMDQFKPEELERMEHGGNAQFHEYLAKHGVDQKLPQKA
FT                   KYDNPVAASYKEKLTCVCEGKDWVEPDLSGAGGATLDRGSSEQASPGTATPNGGAEKLE
FT                   SRRATGPADEQKLRNENYFATLGKKNQTKPEHLPPSQGGRYQGFGNTPTPTNPNQARQG
FT                   GTTADLSLDNLQKDPWGTLTKGWGLFSTAVTKSVEEVNESVIKPGVQHLQSSELSAEAQ
FT                   RAAQQFGQKFQETSSSGISAFSRWTKNLQQQYVQQSPGAPDQDSQYSRLFDSLESRSKD
FT                   HSQLRAQKKGGEADTEWDDF"
FT   CDS_pept        93015..93893
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762475"
FT                   /locus_tag="ABL163W"
FT                   /orf_name="AGOS_ABL163W"
FT                   /product="ABL163Wp"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50608.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="HSSP:1BDB"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252566"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E33"
FT                   /transl_table=1
FT                   /translation="MPNTLDKSYVQNGPWRDGVFQGKVVFVTGGAGTICRVQAEAMVLL
FT                   GAKAAIIGRNVEKTKKAAAEIAELGDSADCVLGIGGVDVREVADMKRAVEQTVAAFGRI
FT                   DYVIAGAAGNFLADMTNLSSRAFKTVLDIDLVGSYNTVKATLSELAKNKGAVLFVSATL
FT                   HYTGTPLQAHVSAAKAGVDALSNVLAVELGPLGIRCNCIAPGLIGGTEGVDRLSGGLPV
FT                   TDAVKKIPLQRPGLTKDIADGTVYLFSPAASYTTGTILVVDGGAWHLGNLMGTHFPETL
FT                   KRKQSVLKSKF"
FT   CDS_pept        complement(94114..96630)
FT                   /codon_start=1
FT                   /gene_family="HOG000115652" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082456"
FT                   /gene_name="PSY2"
FT                   /locus_tag="ABL162C"
FT                   /product="Serine/threonine-protein phosphatase 4 regulatory
FT                   subunit 3"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50609.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058286"
FT                   /db_xref="HOGENOM:HBG202646"
FT                   /db_xref="InterPro:IPR006887"
FT                   /db_xref="UniParc:UPI0001DB26C6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E32"
FT                   /transl_table=1
FT                   /translation="MAKESLRIGVASTEPKRVKVYILEDNEWRDTGTGFCTGQCEQDKP
FT                   HAYLLVRDEEQPERVLLKSKLEGNIEYQRQEETLIVWKDLQGQDIALSFEESTGCNALC
FT                   EFICLVQKTFENNISLVSVRSNDDGMGSVHEIITGPVHLPSNDPQQNEETLMESLRILN
FT                   ENTSFEFLKNETVDFILNTNYLHTLINHFHIAEEKLLHKDLLLLSHIIKTLFLYNEREV
FT                   LEQLIDDKHYMGVVGILEYDTDFPDCKASHRKCLQGVRPKFQEVIPLNDENMRQTINKT
FT                   FRLQFLKDVVLIRFLDDHAFNLITDVMLTYQTTIIRCLQEGSFIDDLVNLYTNNADTSD
FT                   SDLIERKRQGIRLLDECVQISCNLDPPDRSIFYKVLVKKGLFNVLDFAFNVETNSDIRI
FT                   LATDMIISIIEYDILLINSVRNEVDDSPFAATNEDSNINTGLIDEGGADSADNNCNGNS
FT                   AVKAGESNGAESPIAPPGSRSPSRHTSDISLLLILSKILLTDQSPGLKEQAFQALITLL
FT                   DPEDFMGEEYEDQSNLESLMKFYANSKLREKPSTPPQFQLLEYFTKFYEQVAPVLFQSF
FT                   ISGEVEGMDDQLLLRLVKLVDLLIHEHDIMLSRGFILENGILLTIGKLMEPSHIIQLRL
FT                   AAVRCIKGIVAVNDEFYHNYLISKNLFDPICQLLQENLYFDNMANSCVLDLFKVISARF
FT                   GQDQEYAEVSTKNFLVLNQYLVERFGPLLEKVDYVPYTSSMIQMSRVGRDAINKQQDNN
FT                   GERNTTTGGEADNEEFDVMGAMDSSLASESDGENNENNEESPYGGAQNSKRSFSDIEDN
FT                   TIGVEKGNPEPGLPIKKLAEEISESS"
FT   CDS_pept        complement(97049..97780)
FT                   /codon_start=1
FT                   /gene_family="HOG000174236" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762476"
FT                   /locus_tag="ABL161C"
FT                   /orf_name="AGOS_ABL161C"
FT                   /product="ABL161Cp"
FT                   /protein_id="AAS50610.1"
FT                   /db_xref="HOGENOM:HBG346277"
FT                   /db_xref="HOGENOM:HBG608485"
FT                   /db_xref="HSSP:1JZT"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="UniParc:UPI0000252568"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E31"
FT                   /transl_table=1
FT                   /translation="MHQPMELKQLTGEQAAALDAELMGPDVGYSLHQLMELAGLAVAQV
FT                   VVRHWGAAQAKKKVLVLCGPGNNGGDGLVAARHLRLFGYDPVVYLPRLSAKQPFYAQLA
FT                   KQLHFVGVPVLSEGDDWRAHLEPRDTLCVVDALFGFSFRPPLREPFASIVAELKRHEDD
FT                   IPIVAVDIPSGWDVDAGPLTPSDLMPRVLISLTAPKRCSAHIDTGVTTHYVGGRFIPDA
FT                   LARRHGFDPFPYSGTDQILRI"
FT   CDS_pept        complement(97908..99170)
FT                   /codon_start=1
FT                   /gene_family="HOG000000851" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778110"
FT                   /locus_tag="AGOS_ABL160C"
FT                   /product="ABL160Cp"
FT                   /protein_id="AAS50611.2"
FT                   /db_xref="HOGENOM:HBG058287"
FT                   /db_xref="UniParc:UPI0001DB26C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E30"
FT                   /transl_table=1
FT                   /translation="MSAFSDRQFSTKSTAYGSPVTGSSQMKLDVFLIKGYQLVSHSGTQ
FT                   DVPTSVSVVLRTAMDETISEKEQQRFQKLSQLYNAIIQNALLLDSSSSPKSAIELYQRF
FT                   QQILKELELSGDASPYAKYFCKLEDDAGATWHIRDDQEMQGDSVWHSVSENIKKIYDSD
FT                   RGLILPILNKRRSAVNSTRNSPPPYKEDPLSYQQLRRKLSKLQGHYDYGGPGDSTRTVT
FT                   AHAPDERDSKNVNGNGAIDFFNGGHSRSRNNDNDALLRGYYTMPTSPTSLWSSGINLSL
FT                   QSRREFSSQADNDPVEELLQMATGTASNNAAAVAAADRGAAVANANGSETPLQKNSTAT
FT                   ADSTAVASGLTLMDDVQAIPTSLTLKETELYDRLLKEKDERIIELERQLVCERNECQWL
FT                   RKLLLEDVGCIRNMLTGMKDR"
FT   CDS_pept        99825..101567
FT                   /codon_start=1
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762477"
FT                   /locus_tag="ABL159W"
FT                   /orf_name="AGOS_ABL159W"
FT                   /product="ABL159Wp"
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="AAS50612.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG490088"
FT                   /db_xref="HOGENOM:HBG715249"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI000025256A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E29"
FT                   /transl_table=1
FT                   /translation="MTAVQYSNALPPALFRRKKEQKRGVTYSVLLVGPSGTGKTTFANN
FT                   LLESTIFSHRYQTEQPQYQNPMVKVVNPTRVVTFNSKNGIPSYQVPFDPMGAHLEPGIT
FT                   ITATSVEVSTDSSSDDPRDKMCFNLIDTHGIGENLDNELCFDEVVAYLEQQFDLVLAEE
FT                   TRIKRNPRFEDGRIHAALYFVEPTGHGLRELDIEMMKRLSRYTNVLPIIARADSFMEDE
FT                   LSSFKAAVMRDIENYNVPVYKFEVDEDEDDPETLQEVGDLAAIQPFAVVCSDTKGKDGR
FT                   YVRAYPWGDLFIDDETVSDLRVLKSVLFGSYLQEFKDTTHNLLYENYRAEKLSSISEWD
FT                   TTKTSSKGTSIVKTEKNSSTPSLSNFASIVNTGNLKSQQSLTKVPNSDVPAPSTPSNES
FT                   DSLFRETESPIRKMSVNIRRDNEEIIRNIKSSPSTAESGSQDRTKLRNISETLPYVLRH
FT                   ERIIAKQQKLEELEAQSARELQKRIQELEKKAMELKLKEKLLKQQKRNGSTTSIGSTVT
FT                   ATSAASTNLTSGKPTIMQEGTPSTVNRARNGSLVSPSTQVSPSADSSQFASDGYASRAT
FT                   GQVQ"
FT   CDS_pept        complement(102437..104626)
FT                   /codon_start=1
FT                   /gene_family="HOG000074699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778111"
FT                   /locus_tag="ABL158C"
FT                   /orf_name="AGOS_ABL158C"
FT                   /product="ABL158Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50613.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG124713"
FT                   /db_xref="HOGENOM:HBG203116"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000151AB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E28"
FT                   /transl_table=1
FT                   /translation="MSLVNSHSSASVENAAYNLHRAFSSSTENVGHMTPSNSSPLHHST
FT                   VVAMGAESQGGGASNNNNNPANPGSTANNNSNNVNMNSIGGGASLGAGSGATGSISGTK
FT                   GMNNSHSPLHIATMLNTLSMNSNPPSQQQSNVQGPYLVRLQNVPKDTTLRECHALFALA
FT                   HGVLSIELSSFQQYAERSQTSGQESTNYIVAKFDSLHLACQYATILDEKAQIFGPSFPF
FT                   KTYVEVVDELTQQQIPFQTQMQMHQGSPPAPTHVTAYQQPLLSASGVVSPPQSASSVKR
FT                   PSLLVQRSRFSFTDPFSSEQTNMGSQQPDLITTPLKGHQDTGKSFLLMESDEINDSIWG
FT                   NGTGIPSSISGLTTSQPPTPHLEWGTTGRRQSSTFYPSQSNTEIPPMHLTGQVQSSQLA
FT                   TGLQQPLPQPQRQSLSYNLVTPLSSDMNLPPQSSQGGILPHQAPAQTQPQSQALQHHQH
FT                   LHHQQQQLQQQQHHLQQQQHQQQQQSLSQQPQQQQSQQSQAHSQQHQQQHQQQQQQQQP
FT                   QQQQPQQHPPQQPQQQNSQQAIVGQSQQQVTSGQQKGSSRNSISKTLQVNGPKNAAAAL
FT                   QNTNGISQVDLSLLAKVPPPANPADQNPPCNTLYVGNLPPDATEQELRQLFSSQKGFRR
FT                   LSFRNKNNNGNGHGPMCFVEFEDVAHATRALAELYGSQLARTSGTHNNKGGIRLSFSKN
FT                   PLGVRGPNSRRGGATNNTSNAGTTNYSYAAAFGKS"
FT   CDS_pept        105305..105853
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082457"
FT                   /locus_tag="ABL157W"
FT                   /orf_name="AGOS_ABL157W"
FT                   /product="ABL157Wp"
FT                   /protein_id="AAS50614.1"
FT                   /db_xref="HOGENOM:HBG058288"
FT                   /db_xref="UniParc:UPI000025256B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E27"
FT                   /transl_table=1
FT                   /translation="MGRWQQTGTDCQPVPRGSSGSGKRWQACMRPAIFRWRAARAAGAG
FT                   PRNWGGGPSSSERSWTLEGAAVWMPRETISGRGPARGSLNTKSGVAGASGTRRAGARGD
FT                   FGVAAEAAARSSGRGFARPATCLVLLARLLELLSLLMLLIWRVVTGEMCACHRFCPRFQ
FT                   PAALPKAGGCRGNGRNMGG"
FT   CDS_pept        complement(106137..107426)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762478"
FT                   /locus_tag="AGOS_ABL156C"
FT                   /product="ABL156Cp"
FT                   /protein_id="AAS50615.2"
FT                   /db_xref="HOGENOM:HBG058289"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001DB26C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E26"
FT                   /transl_table=1
FT                   /translation="MMFKGVITSLSFLLLLGSCLLGFFTILSGAKHTGVLKNFYWLEAN
FT                   TSNFNQAPPNTRWYNYNWCEYGDDHTGVCSNNKVMGFAPRDHWGDSSEMPENFISKRAT
FT                   YFYLSRVGWAMLVIGLFFMVLAILPYIVSIFTEKAAYVSTPALWLALFFVTLAACLYTA
FT                   CYVKARNAFHSRNRYAKLGPRNFAFIWTAVFLLFLNCVWSTFLAASRAVMSFRNRNKND
FT                   NYYDPASDKSFDNSTAIHSGATVVPSRKNYFREDGRPARGAAYDGEVMTGHGHQYNNAT
FT                   NYGVGSKTAAAGAAVAGAAGAYGASNYGHSEPHAPVSKQAAYDTYQAPSAPQTTSYTTS
FT                   EPYKVYKDPSAKAPKVYVYSESATRDAFPEAVERQNKPSKQGVSRNSGRIVDPTEYQTA
FT                   KDAASGTTAHDDLAHPRGLGMAAQAAAQAV"
FT   CDS_pept        complement(107859..110459)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762479"
FT                   /locus_tag="ABL155C"
FT                   /orf_name="AGOS_ABL155C"
FT                   /product="ABL155Cp"
FT                   /function="DNA binding"
FT                   /biological_process="telomere maintenance"
FT                   /cellular_component="nuclear chromosome, telomeric region "
FT                   /protein_id="AAS50616.1"
FT                   /db_xref="GO:0000723"
FT                   /db_xref="GO:0000784"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG058290"
FT                   /db_xref="InterPro:IPR011564"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000025256D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E25"
FT                   /transl_table=1
FT                   /translation="MQGEYQYISRPAELLRFFSSDDIVAQKVEFVAVLTRIVFTPSTSC
FT                   VLMLQNFEHGRDDRIPYVVKLPCRTWEQSQLVAIVLKLLMHGFGLDTEKVGDESGFDLA
FT                   DIHIKHLCFARCRGKFITNDKNGSILLDEILGIDIDKELRNEAAGSQRLSNEDWGVVNK
FT                   ITDNLIRLDRDSSHRFNFNNLAHSTRQFIDYLKYRTERLTQVDLRMNPMFGANQLLCMK
FT                   ESQDDFNSQQDDPYFNSAEQLHTGFSLPNPLEETAAVSSGYPQGVVTEPKADSPSVELP
FT                   STEHGRSYTRDERPVLSMQPISRIMQLTNSSKRKQMPHSPLSTHSAPCDGTNKRPTLPL
FT                   VPDDATGKRKRTSTTAGVVETALTIDTLENSEEGKLVSTTGFIAGLYPNVYEECVPRGS
FT                   SFILYFPLTTADTCEVQDPAKNCIEIYSSDIDYVLQQYDIDHNMDRKEALILLNSRLDK
FT                   LEVRLSITKAKLFFSDSTYSFCWELKALQVNAETLTQFTSIKMPNPLPERGNALSIDQL
FT                   SATTSSATIFAMLICARVDPGSKVHHFSFTDFTENLLISCKLDPYLNDYCNRLKATECI
FT                   YVKSYPEYIHNLDAYTLRHYNRRLVDCHNGRDTNLTNFGMVFRLKLDVKSYQQRINGII
FT                   REAVLITGDTRFTGDEERLLEAFYNRAFQRIENKCFFHNYKRYKVCFPINSLGERNSRL
FT                   PVPSLLAHTLTLPAECVCARIPAANSDVASHSIKVFSSIAELQSNPLSSEGVLYLLKGK
FT                   ILSTVVDSSKATIYITNDAKLQEEVSVRGFLRLQILGEANVSYFCGADEASTDVLQALN
FT                   LRAFKFYLLPGEVQISPSKTARVWCPVECSIEELNSQLQLSDNLVKLEQHTCNN"
FT   CDS_pept        join(110518..110587,110640..112141)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082458"
FT                   /locus_tag="ABL154W"
FT                   /orf_name="AGOS_ABL154W"
FT                   /product="ABL154Wp"
FT                   /protein_id="AAS50617.1"
FT                   /db_xref="HOGENOM:HBG058291"
FT                   /db_xref="UniParc:UPI000025256E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E24"
FT                   /transl_table=1
FT                   /translation="MKINTMTFRHLSAPCKMTTPTGRRVKFNKAKKVEQQCCEIQEEFY
FT                   ERAIQLEEQAERWVLSDVVKSLRFYSQAYIAYEQGLCARDATDNGTYNILYNQSRMLLK
FT                   VFCEYRAADDYIDLLRYVNMDTVPEASNVLLPLPAIVAKFESAVARFPEKCGWDLYFNL
FT                   LTCFLLYLEAVDNVAEFEASYARFEATAYVLLQHMQREIESLERRPSEEALSPPADQPM
FT                   EVSTGSLATEVVEMMDSASPQDLLDSLVLIYRVVQFALEAALDGTRFGSPDPAFRDRLV
FT                   LCASRLRSNVENAYNFACGLAGADTQELRLGRHALECLDALLSGDLARFETLLQSAAPT
FT                   DIDAQLHNVDLLETATTSVQDMDTLWKLCGVLDRTLRTCQDLLTTERSRMISTQSDLHL
FT                   LSRTVFRLCDVLTRRADNEVHRLFIQKQGAAETQTLRILYKNARTLLANSVAYAQKSCG
FT                   FREYVTDKLKRNYVYHQAQRRLLFFDGHGGESTEAHTAVQEVMQQHTYYCVLPSAELQA
FT                   MADTSG"
FT   CDS_pept        112378..115443
FT                   /codon_start=1
FT                   /gene_family="HOG000162144" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762480"
FT                   /locus_tag="AGOS_ABL153W"
FT                   /product="ABL153Wp"
FT                   /function="chitin synthase activity"
FT                   /biological_process="chitin biosynthetic process "
FT                   /protein_id="AAS50618.2"
FT                   /db_xref="GO:0004100"
FT                   /db_xref="GO:0006031"
FT                   /db_xref="HOGENOM:HBG175045"
FT                   /db_xref="InterPro:IPR004834"
FT                   /db_xref="InterPro:IPR013616"
FT                   /db_xref="UniParc:UPI0001DB26C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E23"
FT                   /transl_table=1
FT                   /translation="MEHGFAGNFSNFQRGSPRRPYTAASGGGEEEQVQQGLEASRGGET
FT                   AQLHRDGTAYPPVFSVPPQAARLGGYGVGNGLRSQPAIGIPQATSRNDVLGAHGAQVYS
FT                   NVVPYNDDEFYEDVGRVSYVHDNSANQNHYYEHKETVPMLEEKSAPYTLSVVEDSQQST
FT                   GLQLTDTERQEGYIDQRGDEYQIISYLDSQGDTVNPYGSGHIMSARTDVDPMYRSADTP
FT                   EAYFSTSGSDLSRSGLIGSTPVPKGSGDCSDLSSERLLSGLPQSKQPKNRIVLRKFKLY
FT                   RGNFIFDCPVSEQLVSQYARGMREDYLTNEYKFMRYQAVTCEPAEFQLKNFTVRQLKYA
FT                   VPRRTEIMIVITMYNENDILLARTLKGVMDNIKYFTRRKRSDIWGPDAWKRICVCVVSD
FT                   GREAINPRSLALMSALGCYQDGFAKDEINGKKVVAHVYEHTTKINITKVSRSKVHLACG
FT                   DNTVPVQLLFCLKEKNQKKINSHRWAFEALAPVVQPEIVTLLDAGTLPGKDSIYQLWKE
FT                   FLDPNIGGACGEIRTDLGPGYSKLLNPLVASQNFEYKMSNILDKTTESNFGFISVLPGA
FT                   FSAYRYAALEGEPLRKYFMGENLNSTVFLSNMYLAEDRILCFEIVIKKNARWLLRYSRA
FT                   SYAATDVPDRIPEFILQRRRWLNGSFFAALYSFVHFYKIWSSGHTIFRKLLLTVEFFYL
FT                   FITMLIAWFSLSSFFLVFRILTLSLTISYPEYSAFRYLSVIFLWLYGITILITFILSLG
FT                   NKPKGTPKFYLTTFIFFAILMIYMMFCALYMSVSTIKTMVIENKVSFQALLKSGSFKDI
FT                   VISMSSTYCLYILSSIVYLHPMHMLTSFIQYVLLSPSYINILNIYAFCNVHDISWGTKG
FT                   SQPKPLGKLESKADGTVRMEIPVSAREIDYNYNKYLDILQNPERGMDDSIPSFEEQKTS
FT                   YLAAVRSLVIIFWIISNFVIIALVLETGGIGQYQYLKAADEDEPDTIAILSSNATVYFS
FT                   AILWLVAIMAAIRFVGCCIYMIKRVSRRFRRN"
FT   CDS_pept        join(115605..115669,115741..116128)
FT                   /codon_start=1
FT                   /gene_family="HOG000113981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625554"
FT                   /gene_name="DTD1"
FT                   /locus_tag="ABL152W"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase "
FT                   /EC_number="3.1.-.-"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="D-amino acid catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50619.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="GO:0019478"
FT                   /db_xref="HOGENOM:HBG269319"
FT                   /db_xref="HOGENOM:HBG286048"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="UniParc:UPI0001DB26CA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E22"
FT                   /transl_table=1
FT                   /translation="MRVVIQRVSQASVVVENKLISSIKTGYMLLVGISTEDTIADIEKS
FT                   VRKVSGLRLFPDDSNAQWKRSIKDIGGEVLSISQFTLIARTKKGTRPDFHEAQKGHLAL
FT                   EMYDRFLDLLRQELGEKQVQDGEFGAMMSCSLTNEGPVTIIYDTKE"
FT   CDS_pept        116349..117422
FT                   /codon_start=1
FT                   /gene_family="HOG000256686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082459"
FT                   /locus_tag="ABL151W"
FT                   /orf_name="AGOS_ABL151W"
FT                   /product="ABL151Wp"
FT                   /function="amidophosphoribosyltransferase activity "
FT                   /biological_process="purine base biosynthetic process "
FT                   /protein_id="AAS50620.1"
FT                   /db_xref="GO:0004044"
FT                   /db_xref="GO:0009113"
FT                   /db_xref="HOGENOM:HBG001116"
FT                   /db_xref="HOGENOM:HBG680774"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI0000252571"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E21"
FT                   /transl_table=1
FT                   /translation="MCRFLIFKGTEPIRLAHLLTRPAHSIINQSFDSRLRLDMRRPING
FT                   DGFGVAYYPNDAELDGSGPCLFKATTPAWNNQNLESLAEKTKSNLVFAHVRASTYGVLS
FT                   ETNCHPFTYHQITFMHNGGIANFRKIKRRLLLHLEEEFFNCIQGSTDSECCFVLYLDTL
FT                   YKLGYDPSREQGDFGHQVLRQALARTIEYIKDWTKDAAEDIDATHEPSLLNFAVTDGVS
FT                   VVVSRYVTSRTDEAASLHFSCGSSFVEYAPGEYRMQRLDRNQDVVMVASEPLTFERGDW
FT                   TTVPTNSILTIKNQTVLLHPIIDEYYQNDPLYERNASLAESKGLIGSVPLGQPAAKDVP
FT                   PLEREGRTRPCTAMHSA"
FT   CDS_pept        118310..119941
FT                   /codon_start=1
FT                   /gene_family="HOG000167616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762481"
FT                   /locus_tag="ABL150W"
FT                   /orf_name="AGOS_ABL150W"
FT                   /product="ABL150Wp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="protein import into nucleus "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS50621.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006606"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG162494"
FT                   /db_xref="HOGENOM:HBG590318"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0000252572"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E20"
FT                   /transl_table=1
FT                   /translation="MESESSATNKFVPEYRRTNFKNKGRFSADELRRRRDNQQVELRKA
FT                   KRDEALAKRRNFSATTAAGGNESEEEDGETESQDQQFYQQLTQELPQMLQQIQSNDFQE
FT                   QLAATVKFRQILSREHRPPINLVIDSGVVPTLVSFMNENQPEMLQLEAAWALTNIASGT
FT                   SEQTRFVVDAGAVPLFIQLLYSNSVEVKEQAIWALGNVAGDSTSYRDYVLDCGAMEPIL
FT                   SLFEVSKTSLIRTATWTLSNLCRGKKPQPDWNKVSQALPTLAKLIYSIDTETLVDACWA
FT                   ISYLSDGPVNAIQAVVDARIPKRLVELLTHQSTLVQTPALRAVGNIVTGNDLQTQIVIN
FT                   CGVLPALRNLLTSPKDSIRKEACWTISNITAGNTDQIQAVIDANLIPPLVKLLETAEYK
FT                   TKKEACWAISNASSGGLQRPEIIRYLVSQGCIKPLCDLLEIADNKIVEVTLDALENILK
FT                   MGEAEKEARGAAVNENAEFIEKAGGMEKIFNCQSNANEKIYEKAYNIIEKYFGAEDDNI
FT                   DEAMAPQAAGNTFGFGSNMNQQFSFN"
FT   CDS_pept        120226..121218
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762482"
FT                   /locus_tag="ABL149W"
FT                   /orf_name="AGOS_ABL149W"
FT                   /product="ABL149Wp"
FT                   /protein_id="AAS50622.1"
FT                   /db_xref="HOGENOM:HBG058292"
FT                   /db_xref="UniParc:UPI0000252573"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E81"
FT                   /transl_table=1
FT                   /translation="MSTSSGRPRGHQEPMGSAYLPSKKSRLMSENRVSKINRLYEDVQK
FT                   RKSRPGAEHAHRDSVVSNSSTSVLTVEGGLEDATMLQGLLDRGPRAYGDLTLRPPAVRP
FT                   LRPRTLSPGRLRESLQSPLTSDADSMADEEEDLKLTPKLRSRRSIIRMSAESTPYRYAL
FT                   EERTRPTNKKSTTRMQLRSQLGQPLPLGYIAHAATRPRAEDTHRVDLESRLRNIMQKDR
FT                   TSFEKRLQQIRQGYHELPIGIQDDALSLQNKTRESEASETTISFRDNTGVVAETEVLRS
FT                   ELNRHAQKLDEVLTLLRSTPTNSHAELISWSACVIILLLCNVYVYYYFP"
FT   CDS_pept        complement(121309..121914)
FT                   /codon_start=1
FT                   /gene_family="HOG000161169" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778112"
FT                   /gene_name="TIM22"
FT                   /locus_tag="ABL148C"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM22"
FT                   /function="protein transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50623.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG113205"
FT                   /db_xref="HOGENOM:HBG594005"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI0000252574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E80"
FT                   /transl_table=1
FT                   /translation="MVYRGFGLEHISPPVNKPFAEMTPEEQGERGAQMMMEFMTSCPGK
FT                   SAISGVTGFALGGVFGLFMASMAYDTPLHTPAPVGAGPGAGIPGAPTLQQMADLPLKQQ
FT                   IKIQFADMGRRAYSSAKNFGYIGMIYSGVECTIESLRAKNDLYNGVAAGCLTGGGLAYK
FT                   SGPSAALIGCAGFAAFSTAIDLYMRSENGRPPKNDFDE"
FT   CDS_pept        122094..123317
FT                   /codon_start=1
FT                   /gene_family="HOG000141918" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778113"
FT                   /locus_tag="ABL147W"
FT                   /orf_name="AGOS_ABL147W"
FT                   /product="ABL147Wp"
FT                   /protein_id="AAS50624.1"
FT                   /db_xref="HOGENOM:HBG058293"
FT                   /db_xref="HOGENOM:HBG103867"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000252575"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E79"
FT                   /transl_table=1
FT                   /translation="MNILAHTGDIFHGRGKLHASLKEQQVWDDLRRPGHDVPQLPRPQG
FT                   YTASQPIYKRLPVVCRGLTWSFDGSSLVAVHEDCGIRQYAVCEEQGPVMAPVQRFFKPQ
FT                   AIISHAVHPQNSLFQADSSLNVVVVSCKDMPYQLYPLHSNPDQPARALQTYNSASESTE
FT                   EFRAAYAMDFLDDAHFLAGSTRNTVSLFDASRRESIWVSSATRRGCGRGQHKAIVSCFD
FT                   EANERRDCVRYAGTYRSELLRIDPRTSSISSWKAIQDKSRGIYQVLQSNNGHYFYIMKR
FT                   YSNSITVLDSRKSMAIVNQFKLPFQTHAQKLRGTYSTRHGLLIGDEAGRILQWAPEVVE
FT                   FGGIDRSGSVPSYGIGETGITHVCAEGSRINIIEKNPADSDIFAISYSPDKYGEDVSCN
FT                   AGILLMRL"
FT   CDS_pept        complement(123312..124574)
FT                   /codon_start=1
FT                   /gene_family="HOG000112017" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778114"
FT                   /gene_name="RRI1"
FT                   /gene_synonym="CSN5"
FT                   /locus_tag="ABL146C"
FT                   /product="COP9 signalosome complex subunit 5 "
FT                   /EC_number="3.4.-.-"
FT                   /function="metal ion binding"
FT                   /function="metallopeptidase activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="AAS50625.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058294"
FT                   /db_xref="HOGENOM:HBG103866"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI0000252576"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E19"
FT                   /transl_table=1
FT                   /translation="MDTPSAALHRHTVGQLRKLLLHREGSAGCGRLQPALDGSQPLDSP
FT                   LSTVPSSRSQVRVQQELWKQDPTYFQKAALSALACMKILRHAFDGGDMEVLGMLLGYVQ
FT                   DEMIVVVDSYRLPVEGTETRVNAQMESYEYTVQYLETAVPEGLAIVGWYHSHPGYGCWL
FT                   SGIDAETQTLNQNFQDPYLAIVVDPKRSKASGVIDIGAFRTMPETADTRSVSSHSNASR
FT                   YGHHSARYYELEVSYFEVPQERRWCDSRLSVEPPKPADATERAMLAQLLEAAKACKNVK
FT                   RLQTVDRALVPESIGPYALREQADQDLQFRRPLRSFSSNSIARRSSTEVALGNANEELD
FT                   PLPTLADANLRNHDSPSADMAMDNTSISSNEEQPHLTFQESSGVQLNAAETEYFDIKNE
FT                   LLTLKLLEYQKARFYRDAFTL"
FT   CDS_pept        124839..127088
FT                   /codon_start=1
FT                   /gene_family="HOG000248158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931080"
FT                   /locus_tag="ABL145W"
FT                   /orf_name="AGOS_ABL145W"
FT                   /product="ABL145Wp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS50626.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG058295"
FT                   /db_xref="HOGENOM:HBG448354"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0000252577"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E18"
FT                   /transl_table=1
FT                   /translation="MSVTKDSIKPLVDRIVSQPLHFSKAKNQDQVMIDPRSYIVIGERR
FT                   NGTVESKKSRNESGVSDSSGAGEPGLSGVAAERKPRSFQEALQLYTVGSSSTKPKKRQM
FT                   KNQDISDDEYTASSSDEEEDITTASAKAGQSLSSSSDEFYEAHEHAAGTSTAAGVDWQP
FT                   ALAGSPDEEDIGEDIGEEVGGDSVHSSRESSVGVVEADQGSSSDEEYNPEGDNGSIEES
FT                   DVCMAAGERRKMPEMESESDDEYELASSGSIQSERQQLQQEVDEHAAEEAKSVLPADAD
FT                   KLHGEHDAQVSLQKLTVPELELATSPTPPTTLSDTGEFYQFSENDHDRGTNAPHRIKKN
FT                   WGPALATSRPKGLLNHGVTCYQNAAVQAMLHIPALQHYLFDIAQGKYKDVISPSSVSQV
FT                   LAETSKRMWSLENGKSKASYINPKKLIGRLEDINCMMSVWNQEDSHEYFMSLISRLQED
FT                   SVPRGHKMTESLIYDIFGGLLQQRVKCKSCGSVSITEQPIYDLSLHLKGKKLAKGDDST
FT                   VDDSITGDVKNSAAPSGSTDGAELPKRRYSIEKSIRDFFNPELIKKVDNKEGYVCEKCK
FT                   ATTNAIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLP
FT                   VKYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKITERNVLKEVNAYYLVY
FT                   TRLTPKSVKLTEKMDSHAHDLKNSSAAARATHTAQDLVPSRKKKFKKSKKRRLNK"
FT   CDS_pept        complement(127322..127771)
FT                   /codon_start=1
FT                   /gene_family="HOG000082123" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762483"
FT                   /locus_tag="ABL144C"
FT                   /orf_name="AGOS_ABL144C"
FT                   /product="ABL144Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50627.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG023340"
FT                   /db_xref="HOGENOM:HBG594170"
FT                   /db_xref="HSSP:1ACI"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniParc:UPI0000252578"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E17"
FT                   /transl_table=1
FT                   /translation="MSQRAKEILVKLIVGAGQAAPSPPVGPALGSKGIKAMDFCKEFNA
FT                   RTASYTPGVPIPVLITIKPDRSFTFEMKSPPTGYLLLRALNQEKGHGKPNIKKPEGTLG
FT                   ELSLKHIYEIAKIKKADGRHTYLDMENIVKSVVGVAKSMGIAVVP"
FT   CDS_pept        complement(128215..130428)
FT                   /codon_start=1
FT                   /gene_family="HOG000093332" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778115"
FT                   /locus_tag="AGOS_ABL143C"
FT                   /product="ABL143Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50628.3"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG191804"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB26CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E16"
FT                   /transl_table=1
FT                   /translation="MSSLTKLLQERRRESTAVRNFEEVDAAGAAQSVRDRQITVLGVQK
FT                   PPLTHVSSSTTTITQVDSDTDSDTTPLGSKDGGRFSKAFLESSVGSTISYGNGGAFCGR
FT                   ERQSLVPMGDCVSGVFKGSRATGSSASGRNLPSLSSSIPYSVPNSNSGGERTGTNGAMN
FT                   MPSSWVEKYGNPLPRNVSVIDSNIISSPKVDSVEPRFMISRQKLQKCSTDANPGHAIPQ
FT                   SSSISSQLSNLFTKAAKDPPVTNCNPTILAASIANKETTAYGKSIPKPIHMRRGSIYSA
FT                   SRQNFGSLNDPFIESPSPLYDSNMGQHNYRSRHSSFADLKRFFKRSSSSGQLSTSPGTP
FT                   PASAGSLSSQSSTHSSSITSCSYGSQSGGDTLLYNASIGTQTIPFSKRYSRTGEKLGAG
FT                   AGGSVKLVRRLKDNVVFAVKEFRPKHENETKRDYIKKITSEYCIGSTLRHSNIIATIEI
FT                   VYENNRILQVMEYCDYDLFAIVMSNRMSYEEICCCFKQILIGIGYLHSLGLAHRDLKLD
FT                   NCVLNSQGIVKIIDFGAAVVFTYPHSGTLVEASGIVGSDPYLAPEVCIFSKYDPRPVDI
FT                   WSAAIIYACMILKKFPWKIPKLKDNSFKFFCSGRDCDSLSALVTRTADPPPYDPAGDSS
FT                   DRSQTCSNNPADPNNPNIGPQRLLHSLPEESHQIIGRMVSLAPACRASIEEIMEDSWIK
FT                   SIDMCYVAGDNGKSISAKSHTHTQVDQSEAHIAGLERKKRAAK"
FT   CDS_pept        complement(130875..131498)
FT                   /codon_start=1
FT                   /gene_family="HOG000001011" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762484"
FT                   /locus_tag="ABL142C"
FT                   /orf_name="AGOS_ABL142C"
FT                   /product="ABL142Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50629.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058296"
FT                   /db_xref="HOGENOM:HBG395898"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000025257A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E15"
FT                   /transl_table=1
FT                   /translation="MAEDQKLTKKQLKAQNFRKSKDEKTEEKKRPLQSEPKEPETGHAE
FT                   PAVKKRKTRRGKGGKGKVDSNGNRFLVFVGSLPKGITESELQAHFKTSSPDVIRLRPDK
FT                   NIAFLEFDGKKDPSTIQRRMDIALLQHGTQLKGKKINVELTVGGGGNSQQRLEKLRQKN
FT                   DKLSEERATRMKALIQDSRAKKTSAEDESRVVQGVHPDRAKLLQ"
FT   CDS_pept        complement(131706..133262)
FT                   /codon_start=1
FT                   /gene_family="HOG000113091" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625555"
FT                   /gene_name="IPI3"
FT                   /locus_tag="ABL141C"
FT                   /product="Pre-rRNA-processing protein IPI3 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50630.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG202654"
FT                   /db_xref="HOGENOM:HBG433953"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000025257B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75E14"
FT                   /transl_table=1
FT                   /translation="MDEQVIFTTAVSGTVCQVHSVGQANLRQCAASTPNSAVLMGDKLL
FT                   VAQANKALINVYSVDSRSKKEALEQRLPLPEQLSCLAVVENHTGDAGVHQQLPYLLLGS
FT                   TPSGKLYVWEAGSGKLLTVKAMAHYQAITKMQAIINGKYVVTAGADSRLIIWQTASLVL
FT                   EEEPKPLYVLHDHTLAITDFAVSNAHNGKYLNSKLYTVSEDMTVRCYQLSSQLEQPQLL
FT                   ATFTFPLALTSIALDPADRCLYVGTREGAFALPLFYKLDSSGATLVNLLQPGKHQIYSI
FT                   VPEQAGVEVNKQELYRMGQLLCSKMLSCHVSLIRVSMDGSMVLLATGSGNCVVVDTYSK
FT                   QPVKELAPLLAPGTQTGPVSNIITRSMTVKSDSLLQDLNLADARATEAIKIPALAKTVF
FT                   DKTGTHDIIYCAPTDTLSSVLPRALDLPQYLDMIAEEDSVFANTPVTRSTVKVVGELAP
FT                   AKAEALPASSAEAQQSADDTDAEVARLRESLQQLTGAYKDLRALHEKLYEEHEKLLQTS
FT                   K"
FT   CDS_pept        133515..134693
FT                   /codon_start=1
FT                   /gene_family="HOG000175307" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931081"
FT                   /locus_tag="AGOS_ABL140W"
FT                   /product="ABL140Wp"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="AAS50631.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB26CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E13"
FT                   /transl_table=1
FT                   /translation="MPLNILGTLIFEGTDKIPFYPQIKRYAPYVAVIGGLKYWLRGRSN
FT                   TWERNLHGKVYIVTGATSQGMGTSVVLDMARRGAQLVILTRSTDEWASEWCEQLREQSN
FT                   NQLIYLEKCDLADLHQVRKFATTWLDNSPPRRLDGCIIMSGDIEPLGWPWARGIAPRRF
FT                   SPYGVEIQVATNFAGTFHLLHLLQPSFKAQPPDRNVRIIVTTCFLQALGTANVEDPLWL
FT                   KDSGLRSLRLFSSSKLQLSLCMLELQRRMFQDIKKTSKDGRSGKNISVTLVDPGLMRSS
FT                   SLRRVVSNGSVWLLLMLYCGILYPIIWLIAKSGYRGAQVVLHALMSPELEEVNRADPES
FT                   VLYLVDCQKAPFARSEFKDTELQKKLYDATVERIMALEKKVAAKRNIAKNTK"
FT   CDS_pept        complement(134909..135793)
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762485"
FT                   /locus_tag="ABL139C"
FT                   /orf_name="AGOS_ABL139C"
FT                   /product="ABL139Cp"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50632.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1AM4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI000025257D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E12"
FT                   /transl_table=1
FT                   /translation="MCFSQSGRLSAQAADTMRSIKCVVIGDGAVGKTSLLISYTTNSFP
FT                   QDYIPTVFDNYSTTIAVQDPASSTGEQQLFKLNLWDTAGQEEYDRLRPLSYPQTDIFLI
FT                   CFSINEPVSFQNIRDKWFPEIKHNTNYENMELFLECGKYPILLVGTKADLRDDDHEEDR
FT                   LREMNTDFVSQAEIERVVQDCGFMGYVECSAATQEGVREVFERAVKYVVYEPDRLMNRS
FT                   KNMSILVNSPLPLDSYANEDASNPKNKGGDPSAGSGPLKKAVGDDGAHGKELRVSADKL
FT                   KKKRRKRSRCTIL"
FT   CDS_pept        136377..137111
FT                   /codon_start=1
FT                   /gene_family="HOG000210611" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778116"
FT                   /locus_tag="AGOS_ABL138W"
FT                   /product="ABL138Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS50633.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG396698"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniParc:UPI0001DB26E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E11"
FT                   /transl_table=1
FT                   /translation="MVAVISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTT
FT                   TEVIIRATRTQDVLGENGRRINELTLLVQKRFKYQPGTIVLFAERVQERGLSAVAQAES
FT                   LRFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFSDGFLIHSGQP
FT                   VNDFIDTATRHVLLRQGVLGIKVKIMKDPSKSRTGPKALPDAVKILEPKDEDAVVEPSV
FT                   KDYRPKAPPAQEQAQAQAQVQA"
FT   CDS_pept        137260..137865
FT                   /codon_start=1
FT                   /gene_family="HOG000190104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762486"
FT                   /locus_tag="ABL137W"
FT                   /orf_name="AGOS_ABL137W"
FT                   /product="ABL137Wp"
FT                   /protein_id="AAS50634.1"
FT                   /db_xref="HOGENOM:HBG058297"
FT                   /db_xref="HOGENOM:HBG397062"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniParc:UPI000025257F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E10"
FT                   /transl_table=1
FT                   /translation="MVKFTYKDACTVGSALIVSATTFIMGVFFANQAYDYHLLFNANMT
FT                   QEHYDNALRHYQTLYFTAQPVLYIFGAIAIFGLLGSLIRIYKPNPELQLFEYGSLAMYV
FT                   LGVCVFLTNIKTGINSAHYGNWGEVTQNQGLAVIASSNIILLVVFVGVLVLQGGLWYSE
FT                   WEYEQRLETFMAEQEAENSAAPKEPAKGGKKSAKSKKE"
FT   CDS_pept        complement(138019..138930)
FT                   /codon_start=1
FT                   /gene_family="HOG000248157" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625556"
FT                   /locus_tag="ABL136C"
FT                   /orf_name="AGOS_ABL136C"
FT                   /product="ABL136Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="AAS50635.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG058298"
FT                   /db_xref="HOGENOM:HBG397061"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="UniParc:UPI0000252580"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E09"
FT                   /transl_table=1
FT                   /translation="MFSKSLAALCRIRCTDSVGIRSLTSSAALRATNSESSGSIFGSIT
FT                   KEVQHDERDSTKLTNRLAAQAGSAEGEAADGNDSVTLATDKTLQDYILARQRPVQSPAA
FT                   QLLSPLKRRLYAANCAQNGGFYKKDTVVKLPGSSVRYQVKLTRDELDALEPSVYVRSYR
FT                   IESSIKKATVLLRLLSGLDVKKALTQCHFSDKKVARDVAELLQRGIEDGKELGMDPNDL
FT                   YIAQIWAGSDGQFQKRPDFKGRGRQGVIVHPRVHIRCILKTKSITKKRLENERLLKELN
FT                   RKPWVQLASKPVRGSTGGVYKW"
FT   CDS_pept        complement(139219..140253)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778117"
FT                   /locus_tag="AGOS_ABL135C"
FT                   /product="ABL135Cp"
FT                   /protein_id="AAS50636.2"
FT                   /db_xref="HOGENOM:HBG058299"
FT                   /db_xref="UniParc:UPI0001DB26E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E08"
FT                   /transl_table=1
FT                   /translation="MGYNNTSSPIGSGHGSSGVEKASRPSSVQSTTQMGARHSESMNLS
FT                   VSWLSTDAWSAAEFATLEGQRNRTESSGFTSTSSTSARSDRWAQTEEAVGTPQMTFVVY
FT                   SQRYKLTASYTTLCTLIPTTTTLPYSEAATYSAPTTVITTDIAFYKGLVPGDDDKSAAR
FT                   VNGAQKRTIIGSVVGSVCGLLMCAMAAYYLLHLRRQRRKQYSVAREFTHELGRRLEYTT
FT                   DPDEPAERAPPGRGAQRPTTRGGNARGDRQLEKTADPFGDEYAGLGHGPEAAALPVSGD
FT                   AYFTSRYSYVSSMDETTTDQQSDNSYSSELDSIPIHLAPNERTDRQHMGAANTGSQSFL
FT                   KEVI"
FT   CDS_pept        complement(140659..141786)
FT                   /codon_start=1
FT                   /gene_family="HOG000193653" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762487"
FT                   /locus_tag="AGOS_ABL134C"
FT                   /product="ABL134Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50637.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058300"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000018D408"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E07"
FT                   /transl_table=1
FT                   /translation="MSDEESATASKVDMQAKALSDPTKKRKAEDEIEIDLTQPVPLSKK
FT                   QKRLLRRGKITLEQLSEKFNIDQKSIEEYKNEQKETAENDDAEPAAEEEPKPAPRKEKK
FT                   FGVWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFA
FT                   YVDFATSAQMDAVIGLSEAQLNGRNLLIKNAKSYDGRPAKNDLISMSKNPPSRILFVGN
FT                   LSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSCRA
FT                   IAGRPLRMEYGEDRSKRHVRSRPAPSLVDAEPHAPAPADPAPAPAPAPAPRAPRPRKPT
FT                   RNDHHSRPKSSVALASAQRASAAIVPSQGKKVKFD"
FT   CDS_pept        complement(142441..147741)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762488"
FT                   /locus_tag="AGOS_ABL133C"
FT                   /product="ABL133Cp"
FT                   /protein_id="AAS50638.2"
FT                   /db_xref="HOGENOM:HBG058301"
FT                   /db_xref="UniParc:UPI0001DB26E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E06"
FT                   /transl_table=1
FT                   /translation="MVDFTFTWPSGPKKVVITGDFDRWQGTVPLEKQPSGDFVVQLPIG
FT                   VVESDKFYFKFIVDGQWVTSDLYPKDSLTGAENNYVLLSSVGGGIGSRSAPGSAGAAAL
FT                   RAQPAPGSKKGKKKKKGKKRTRRNRSAGEASPAPGESPVPESYDEDGTSSDSSESEPRD
FT                   APHSAASAAAEKAAEAAAEVAAAVAAGAGAAMAVAAAAMHKVPHKLEMGIGPLMRDPSE
FT                   VAELHQVDGEALNKRLNAERSGQHAGTLDPRASEKLPDDPRDSVRDNINKALAELDSTR
FT                   GPAEDTTPLISANSTNPGKMVGLGLTEGIDTSGAIGTPASDSSTSLLPGTLPLDTPTAS
FT                   GKPKDRNVAPVPESTPLREDVTPAREDSSLPETNKPAIPLPYSGPSGKDATPAEDTLKP
FT                   SGNDQKKSRVPEIAVAGQTTSQNSSIPSSAKDTPAPEGSTPILPGSPLLPSTPEPSEKP
FT                   SVKGATPSALSQKPISRDSAPADGSKPSIEKATPVPEGSTPILPGSPLLPSTPALSDKP
FT                   SVKGATPSSPAQLVKKDVGSNDGSKSATEGSTPAPEGSTPILPGSPLLPGTPVPVGKSS
FT                   VKDATPSALSQKPISRDSAPGEESKPSTEKATPVPEGSTPVLPGSPLLPSTPVPSDKPF
FT                   VKGATPSSPAQSVKKDVGSNDGSKSATEYSTPTPEGSTPILPGSPLLPGTPVPVGKPSG
FT                   QSATPSALSQKPISRDSKPSEESKPSREKATPVPEGSTPVLPGSPLLPSTPVPSDKPSV
FT                   KGATPSSPAQLVKKDVGSNDGSKSATEYSTPAPEGSTPILPGSPLLPGTPVPVGKSSVK
FT                   DATPSALSQKPISRDSAPGEESKPSTEKATPVPEGSTPVLPGSPLLPSTPAPSDKPSVK
FT                   GVIPSGTAPVKKDAKTSDESKPATEYSTPVPEGSTPVLPGSPLLPGTPVPTNKTSTKDV
FT                   TPSALSQKPTSRDSAPADGSKPSIEKATPVPEGSTPVLPGSPLLPSTPVPSDKPSVKGA
FT                   TPSSPAQSVRKDIGSNDGSKSATEYSTPAPEGSTPILPGSPLLPGTPVPVGKSSVKDAT
FT                   PSALSQKPISRDSAPGEESKPSTEKATPVPEGSTPVLPGSPLLPSTPAPSDKPSVKGVI
FT                   PSGTTPVKKDAKTSDESKPATEYSTPAPEGSTPILPGSPLLPGTPVPAGKPSRKTATPR
FT                   SPAQPVKNDTKPSDKSTPATETSTPTPEGSTPILPGSPLLPHTPVASGKPSESPASVPK
FT                   KEDVTEKKDDVRSPAKHAATPVLSSPLAAPVPKGKPLVKTASVNQPSKEGSPGSEYTTP
FT                   LATSPVDVTHSLSGDSAPVKTPVGVTAIPVASKSVNPVDKVEKPVNKNLQPSKGTDTNN
FT                   TSATTTTGSTPILPGSPLIPSTPVLSGVKANENSPSVESSVPAASNTPSKAAPTDGQTS
FT                   VKTTTKPAITKEEPKPTPAVAKETPVSTSVAAVSVAKKENTQDVSERPSQAELPSKTRI
FT                   EPSTSVPVPVPVPAGVSQVTPASPGPRNPSRIDPENPPAQVPEEPEKRAAPAPAAQPSL
FT                   APRTAVPAPSEAHVTPVTNVPVSEQISSPKVTQPVVESSPATESEKVIKAPAVAAHEIF
FT                   PPHVVKLTPVSPKKKTSTGSLKKQIIAPREEEQPQPVHAVTGTAIELEEVPSTVELVEV
FT                   PPSEVPTTHSPIVVGIPLSNDKIVVAPVQIQGDITTQTSAPSTQYTDTYAAPVRQDVPL
FT                   ATTAGRSSVTQSRHSKDAASMATAPSTKQSFDAHNGRPSSKNSNSSPSRSSTEPKRRSG
FT                   FFARLKRFLR"
FT   CDS_pept        148138..149106
FT                   /codon_start=1
FT                   /gene_family="HOG000249463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778118"
FT                   /locus_tag="ABL132W"
FT                   /orf_name="AGOS_ABL132W"
FT                   /product="ABL132Wp"
FT                   /function="methyltransferase activity"
FT                   /protein_id="AAS50639.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG463539"
FT                   /db_xref="HOGENOM:HBG559580"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="UniParc:UPI0000252584"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E05"
FT                   /transl_table=1
FT                   /translation="MGVWAAVTWKGGEKSAGSRDLSSLQAPAAMRMGLSVLAGLRSSPC
FT                   VASRRALSAAAVRRSGDGGMTHFGSRTVPKDEKAKLVGNVFSSVASKYDVMNDVMSLGV
FT                   HRLWKSHFISKLDAGKRPNASEPLHFIDVAGGSGDIAFGLLDHAEAKFHDTESTMHVVD
FT                   INPDMLREGEKRAAEQGKYYNDPRVTFLVQNGETLEDIPTASKDVYTISFGIRNFTDIQ
FT                   KGLNTAHRVLKPGGIFYCLEFSKIENPVVDIAYQQWSKLLPVMGSMVANDYDSYQYLVE
FT                   SIQRFPSQDEFKGMIEKAGFASVGYENLTFGTCAIHWGIKV"
FT   CDS_pept        complement(149191..151788)
FT                   /codon_start=1
FT                   /gene_family="HOG000095282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762489"
FT                   /locus_tag="ABL131C"
FT                   /orf_name="AGOS_ABL131C"
FT                   /product="ABL131Cp"
FT                   /protein_id="AAS50640.1"
FT                   /db_xref="HOGENOM:HBG058302"
FT                   /db_xref="HOGENOM:HBG203519"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR007520"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="UniParc:UPI0000252585"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E04"
FT                   /transl_table=1
FT                   /translation="MRPGLQRQSTDNPSRGRARSTSPSLFFRSASASSLLRFRHGRTKE
FT                   QPPPEAEEDDIDNCAGACACADEEICDVLPSFQMYNALHRHIPRGNVNADQHDLPPSYQ
FT                   EAYNGSVGGISVSSSRVNLTTIQSLDGVQSDSCINLQALSAQQYSLQTPSHDEPIEDDL
FT                   ANQDDDNINIEKLYSLPKMVTPVEIDIRITKHPVKPHKKPEEESILREYTSGDIINGYV
FT                   VIKNRSAQPLKFEMFYVTLEGYATVIDRMKGKRTVKRFLRMVDISASWSYSSVESANGY
FT                   AYTQSYKDYDNCILGLSNTRVLEPGVKYKKFFTFKFPMQLLDVSCKHEQFSHCLVPPSF
FT                   GIDKYKSNGKYATIQTNPLLGYGHLGTKGSPILTNDLVSDTVSINYAVDAKIVGKDSKT
FT                   GKLNIMREKEYNLRFIPFGFCQPFGGEQDPLQQLEDLTNLIQDRLAALRRVFDRLEKKE
FT                   RIRSQDLRSTEAHGTIDEDIQLDPHDELDRKLRQLYVNNRLDAACTSLPLKDSKLIHPH
FT                   RKLLKSEFKYSYRTKHKSYKKKLFFSGFYSDNNRQSEAAKTGIILLEADQPKDGFPYLQ
FT                   PSLLKKTNMLANKNKHDQKNWNSLTARLTDRDKQTLENIEVRLQCIQANNSEQHSPPEI
FT                   TAVTTELVCLTAKSVNSIPIKLDAQLLLNKTKLKDITETFTAYLAEVKEYQSKFEENIV
FT                   QINELYNISRNTLSRRELAFGDFISAQLLHDIECLANLRVDVRNLHHVLKEQIRTLKNP
FT                   DDDLTLGEPKATLSSNILTATFSGSSVSSGSAQADLYRSQITRDWVPVEENQYVRNVNV
FT                   NLVLNQDIKETLVPTFESCLCCRMYCIRVNIKFEGQIGVASLDVPVRIRMLEA"
FT   CDS_pept        complement(152177..153118)
FT                   /codon_start=1
FT                   /gene_family="HOG000112045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082460"
FT                   /locus_tag="ABL130C"
FT                   /orf_name="AGOS_ABL130C"
FT                   /product="ABL130Cp"
FT                   /cellular_component="carboxy-terminal domain protein kinase
FT                   complex"
FT                   /protein_id="AAS50641.1"
FT                   /db_xref="GO:0032806"
FT                   /db_xref="HOGENOM:HBG058303"
FT                   /db_xref="HOGENOM:HBG203414"
FT                   /db_xref="InterPro:IPR021000"
FT                   /db_xref="UniParc:UPI0000252586"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E03"
FT                   /transl_table=1
FT                   /translation="MSSDPITLLHNGTARAMDSLEARLKFIEVIKSLHKTLNVSRDTSP
FT                   SSTQPAATDPVHFYLVHYEDHYEDFHSCLFEVTASMDSLDRLNVLIYWNRLVSSLWQRA
FT                   SKDINGQPNIAGRVVHDYLLKDLGRMLALVLPEQDWKALTNLPVATDVFLRVWRTVGSP
FT                   SPQDTEPLTCRRESFTLDPDLRAFIDRRSLDPAWHTPAQDAPDAMREALLLLVDRRAKA
FT                   IFLQEYYRAHGAVSVPASTSASTILHRMESDRERHKKSKEHLWFTDRDSSMLELAEFDA
FT                   LWQQHRKGMTRDDYQDVKQLQRIAQESYLYQI"
FT   CDS_pept        153759..154796
FT                   /codon_start=1
FT                   /gene_family="HOG000216678" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762490"
FT                   /locus_tag="ABL129W"
FT                   /orf_name="AGOS_ABL129W"
FT                   /product="ABL129Wp"
FT                   /protein_id="AAS50642.1"
FT                   /db_xref="HOGENOM:HBG492682"
FT                   /db_xref="HOGENOM:HBG560425"
FT                   /db_xref="HSSP:1AAR"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0000252587"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E02"
FT                   /transl_table=1
FT                   /translation="MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLI
FT                   YSGKILKDDQTVESYKIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSIS
FT                   AGQSGGFNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMN
FT                   EMLNNPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGGAG
FT                   AEQGTDFPAPGSAATPDAAAPAPNPLAAILGLQPGAANPLGAAPADRGLAMPPLDPAML
FT                   SSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDAL
FT                   LNGDV"
FT   CDS_pept        155132..156556
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625557"
FT                   /locus_tag="ABL128W"
FT                   /orf_name="AGOS_ABL128W"
FT                   /product="ABL128Wp"
FT                   /protein_id="AAS50643.1"
FT                   /db_xref="HOGENOM:HBG058304"
FT                   /db_xref="InterPro:IPR019473"
FT                   /db_xref="UniParc:UPI0000252588"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E01"
FT                   /transl_table=1
FT                   /translation="MTNGECNGIHNRAGAKEGIQLKKLPDLTEVTKSNPMQKLLAQAVG
FT                   LHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGC
FT                   GVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFK
FT                   DVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSE
FT                   KALLHMLGTATKKPRADDAQLPQIISDGQQENLLIYGPERRRLAPEPAPTRGFNIEDYA
FT                   RCRVELARRRVEEFEQQKLQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYI
FT                   GVLHAIPRLRRTKARELAAAYERERARQESMRNNTDLTQQQHGVLDLSALHDDPLLADL
FT                   DSSDSDDDRQPPSPRKPPDPTESDAPSPPTADTATPAPPSPLANPPVLDAAPEPLSVPP
FT                   PIEKLGSPDTNAASAS"
FT   CDS_pept        156834..159020
FT                   /codon_start=1
FT                   /gene_family="HOG000197682" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762491"
FT                   /locus_tag="AGOS_ABL127W"
FT                   /product="ABL127Wp"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50644.2"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG053858"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001DB26E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E00"
FT                   /transl_table=1
FT                   /translation="MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDV
FT                   ITAPGEEEAGKARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHD
FT                   VTYGGLCVQCGQAVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREA
FT                   RKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPK
FT                   PPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRIL
FT                   SRDENGSLTQKSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNF
FT                   LPIQQNSMLHLGRRNRKKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKL
FT                   PDTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAY
FT                   YDQLQRYNSGEDPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFG
FT                   ASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYEL
FT                   IVEEPVGEEYLENFKRDLAEAQKKVDPPAQDSRSSLLLLDGNGSWLDYDDDEMDEFLNE
FT                   ESDNEEDTEQMATASKAPRPNGFPSGGERPAAVQSQDKPELPEKESNGKRPYQPDDAVS
FT                   ASKVKLQRTDAFSEEAEEEDEDDLEAELLLELGQ"
FT   CDS_pept        159243..161117
FT                   /codon_start=1
FT                   /gene_family="HOG000268676" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625558"
FT                   /locus_tag="ABL126W"
FT                   /orf_name="AGOS_ABL126W"
FT                   /product="ABL126Wp"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50645.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG193285"
FT                   /db_xref="HOGENOM:HBG571743"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI000025258A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ9"
FT                   /transl_table=1
FT                   /translation="MKENTDAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELR
FT                   KRLLPRITFGTAGLRARMEAGFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRF
FT                   HSREFAEATIAAFLQLDYDIYYLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMI
FT                   TASHNPKMDNGYKVYYANGCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGK
FT                   LHDVRKEMLQKYKDSIQTMLVKQSNLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEE
FT                   DKDYIVVPEQKYPDPEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVA
FT                   VKYHGEWNQLTGNQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGF
FT                   LAVETLTGFKWLGNRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCY
FT                   EWKKVAKSSQEVLQECYEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSH
FT                   IGCEFEVEYLRDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARG
FT                   SGTEPKLKVYIESCAANHQRASHLSHLAWDVLKREWFRPTETGLQTNF"
FT   CDS_pept        161394..162404
FT                   /codon_start=1
FT                   /gene_family="HOG000066018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762492"
FT                   /locus_tag="ABL125W"
FT                   /orf_name="AGOS_ABL125W"
FT                   /product="ABL125Wp"
FT                   /function="homocysteine S-methyltransferase activity "
FT                   /protein_id="AAS50646.1"
FT                   /db_xref="GO:0008898"
FT                   /db_xref="HOGENOM:HBG166538"
FT                   /db_xref="HOGENOM:HBG204042"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniParc:UPI000025258B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ8"
FT                   /transl_table=1
FT                   /translation="MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPF
FT                   LDAAAWQQPDSRERAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNAL
FT                   LDRIVGFCRETVGDDKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNA
FT                   QPALDLIGFETIPNAHELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVA
FT                   AAAPLNPNFLGLGINCSSLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASP
FT                   HVVDWGAVVASYIRSGARIIGGCCRTIPNDIRQIADAVRTHARASSTDVPGHASP"
FT   CDS_pept        join(162768..162811,162872..164381)
FT                   /codon_start=1
FT                   /gene_family="HOG000167461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625559"
FT                   /locus_tag="AGOS_ABL124W"
FT                   /product="ABL124Wp"
FT                   /protein_id="AAS50647.2"
FT                   /db_xref="HOGENOM:HBG435756"
FT                   /db_xref="InterPro:IPR005109"
FT                   /db_xref="UniParc:UPI0001DB26E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ7"
FT                   /transl_table=1
FT                   /translation="MPIFKRSDKNLELPISQHSRYQPRLKGRFSLKMNYKLKHVAMFVW
FT                   VMICGTLVVRQLVGSGEREVILVDREVPMEEREVFVDVSDDERAAEWEPQVLDDPEYYD
FT                   YEFAAASAERLAKYDEGFEHYFVTRDGQISRDDPEFEEQMEELVSATVEQYDLRNYEGT
FT                   PNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSL
FT                   MEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYH
FT                   ENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSW
FT                   VYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNL
FT                   AKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGA
FT                   HFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRRS
FT                   "
FT   CDS_pept        complement(164774..166258)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762493"
FT                   /locus_tag="ABL123C"
FT                   /orf_name="AGOS_ABL123C"
FT                   /product="ABL123Cp"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50648.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG058305"
FT                   /db_xref="HSSP:1AVF"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000025258D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ6"
FT                   /transl_table=1
FT                   /translation="MSWAKLVLVCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRIV
FT                   SEIKTSADDSTGSTLLKYNRSGAETKKSAQCNSLTFRPNISLLKRDPLSRVHIIQATFG
FT                   GVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHG
FT                   PLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSK
FT                   LINKKSFSVLLSHIPSESRNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAI
FT                   KAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYFDDSISDG
FT                   KNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWIL
FT                   GEVFLQDLYTVFDIEGRQVGFANRNTKATLVHNEPQNYYEKNNSSLQMVSTSSDTTSSA
FT                   AATSLHVSSTSKNIAYTPRPHPLLEQLLSLIYILVL"
FT   CDS_pept        complement(167040..170171)
FT                   /codon_start=1
FT                   /gene_family="HOG000113719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762494"
FT                   /locus_tag="AGOS_ABL122C"
FT                   /product="ABL122Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50649.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG252923"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018835"
FT                   /db_xref="InterPro:IPR018885"
FT                   /db_xref="UniParc:UPI0001DB26EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ5"
FT                   /transl_table=1
FT                   /translation="MTNYQRLGPLGQAVPGPGAGGQPASSGPAQGPGTGPGQPARFFPG
FT                   AEGMSLAAGSMPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHSSH
FT                   SLHHAQSARSSFLYYPQPPMLKPIPPRRKKSVTLNHSEPYHINFKILPKGKDEYMTRSL
FT                   LLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNHSILLSFLTKATCLDFYNNLLQRF
FT                   SEFKTKLHSPKLSVSFVCQDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRL
FT                   KFPWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQL
FT                   NISRIQFVNVNGHHSKLSDEEAVAAANGLQQDSRTSSVSSISLSISNTADLAALFHSLD
FT                   LSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHH
FT                   GVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSD
FT                   GNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPRSKPEDICNVV
FT                   RGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPK
FT                   NIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVE
FT                   QINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRC
FT                   GNVNKNLAANKNSRFYKKIKKQSYSMKQGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSS
FT                   KNGGVGESQSLVGDQELAEGLGISLTSAQISPDTGHTHHYSDGVEEGDECDDDDAGYST
FT                   SGSSDIDIIVAPPDEFKRRESGTSSGKHKKKSKSTRRNQHSNAASSASYNQQYSLGSLD
FT                   HTSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYNSQTPTNANYKSRRRR
FT                   QAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNGNEQH"
FT   CDS_pept        complement(170815..174672)
FT                   /codon_start=1
FT                   /gene_family="HOG000111315" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778119"
FT                   /locus_tag="AGOS_ABL121C"
FT                   /product="ABL121Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50650.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058307"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB26EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ4"
FT                   /transl_table=1
FT                   /translation="MAGPRKEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPGGPEG
FT                   ATGGASPAAAPQSTTGTPLSSLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE
FT                   CKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPAT
FT                   SSSSANKKGDSDHTTLEDEQILQQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQN
FT                   LSPTQLRSNPYTRATLSPSHVAEADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDP
FT                   TSISFEQDQAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLARIGQM
FT                   HGFTSKQCLYTASVLASLKEITPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRG
FT                   SSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFD
FT                   RSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRE
FT                   RHERGDRLNNLMTYYDRAISHVIMNPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYE
FT                   LRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPR
FT                   LMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRG
FT                   MTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYLNKDTALKL
FT                   NNAIFMALYFLAKIMIHLPVVATKPIIDKPQPVVDTNIPGSQIDRSSSSYVLLQQATNT
FT                   FLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLE
FT                   ADKKLNMPGTISWHSLKLLDMAVNLILQPPNTKPEKQEKLLQKKINYYNKLIDSHLGPT
FT                   ASLPTPGQTAPRKPEPAHARPIPEKEKPPSSKRHRGDDNAAASMPPLLEKKVKLEAPAS
FT                   NMPTPPAPISALHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAVNAITEAFQLDP
FT                   ILQPTPFSNTDLPSFFGVDQYAAPPELQPFPAGYAAPDKVPQAAAQGPSATAGPPLSSK
FT                   DSLFKVPSNGDFLKDYYSGMSSAQLNSLFTAPDRRDVRPRAPQPDRAPSDGLQQQPGYG
FT                   FVVDASLGLAPLLAWSPRPADDLLLDDKGAKLASARSFTHVNKLSSIPTLMSTQPPPAS
FT                   APHAKLGQPAPPDQDDGILTIPPRDQRGPRRLWNSALNQARPAAALDDSISDLFRWQNS
FT                   G"
FT   CDS_pept        175098..175847
FT                   /codon_start=1
FT                   /gene_family="HOG000176611" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778120"
FT                   /locus_tag="ABL120W"
FT                   /orf_name="AGOS_ABL120W"
FT                   /product="ABL120Wp"
FT                   /protein_id="AAS50651.1"
FT                   /db_xref="HOGENOM:HBG191816"
FT                   /db_xref="HOGENOM:HBG627717"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI0000252590"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ3"
FT                   /transl_table=1
FT                   /translation="MFGSFFAVVKLYLLLLAVYCWSRRRLERHNTQVFERLVGGDSQHT
FT                   SLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQLRRAELQKALR
FT                   LLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGELVTDAKPLVLTFDERGVSGHRNHIG
FT                   CALAAARLGHKTLFLRSERNLLRKYSFFVLDVFRVVFGTPPPTVFVSTLAQYLHALVAM
FT                   VVAHRSQMVWFRWGWWMASRYVYANEY"
FT   CDS_pept        complement(175873..177486)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931082"
FT                   /locus_tag="AGOS_ABL119C"
FT                   /product="ABL119Cp"
FT                   /protein_id="AAS50652.2"
FT                   /db_xref="HOGENOM:HBG058308"
FT                   /db_xref="UniParc:UPI0001DB26EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ2"
FT                   /transl_table=1
FT                   /translation="MMVDFSPSRRRMGTQELSLKPQVETPGIKLLAVMFCRYHLIRQLK
FT                   QVQAASRTRYAHSVPQSRPTLKERLAALHEKQQLSLLPPDAVKRVSENNPAVLIDCDAR
FT                   TLLQLFLAALQTDPQKTTLSELLSQEEGFSVFIHRLLPTYTPSSDLKHLVSKDGTTALL
FT                   QKLYGFYREQFADAPIGRPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAK
FT                   LPRDTETIITLLQLHLGAKHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEETLLRL
FT                   LRLLQSDPQWKSVCSPDLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLLP
FT                   DGALVGAVVTAFAFKHQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGSQG
FT                   AALYDEAWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQ
FT                   PAVAPRDRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHIAARASSR
FT                   TDADDDDAGDGLYLTGAPLW"
FT   CDS_pept        177564..179078
FT                   /codon_start=1
FT                   /gene_family="HOG000248147" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762495"
FT                   /locus_tag="ABL118W"
FT                   /orf_name="AGOS_ABL118W"
FT                   /product="ABL118Wp"
FT                   /protein_id="AAS50653.1"
FT                   /db_xref="HOGENOM:HBG058309"
FT                   /db_xref="HOGENOM:HBG397568"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI0000252592"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ1"
FT                   /transl_table=1
FT                   /translation="MTLQEDTSLQSMMASERELNDQLERVSLVETNSSNSKVHAEPGSA
FT                   EKTSKKPKANGRPSAEEIEKIRAQRKAKKEAAGKQGGEDVGFIKRPLLVCNGDEAKGFV
FT                   FRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS
FT                   FWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDETLIDFDEEQSGEIERRTTTK
FT                   NVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGTYERARQCYIILSRMKVFLK
FT                   RLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPIIYEGRARTVIECSTSYKF
FT                   SSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRALVDAMQSLHNALDMRAIS
FT                   LYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEF
FT                   QKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELELLM"
FT   CDS_pept        complement(179093..180901)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931083"
FT                   /locus_tag="ABL117C"
FT                   /orf_name="AGOS_ABL117C"
FT                   /product="ABL117Cp"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /cellular_component="DNA-dependent protein kinase-DNA
FT                   ligase 4 complex"
FT                   /protein_id="AAS50654.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005958"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="HOGENOM:HBG059573"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR006165"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI0000252593"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DZ0"
FT                   /transl_table=1
FT                   /translation="MGERQDKSGGQSGHFVKPVTHDYIDRNQNIVLCIELSQTLCSPAG
FT                   SLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNGRRAEDGIVEAFPLRPLDANY
FT                   VRNISDCVADLEETGMVGQHFPFTATVPASLDVMLAASDRYFTEDTQNADNRIFLVTDV
FT                   DTPVEFTDPIRLEKVQARLLSLYRRRIDITTFFLHTEHAAFNDSSYAEILKTREWGIPG
FT                   APQSTSPLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVATTHERPGTRY
FT                   KYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAELRKMTRGCS
FT                   KYESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMFEKGKAAI
FT                   VWGQLKAGFHPTLFALIPSDGETCALRLVRIPFIEEVRCFPTLDGEDRLFHTREYELVK
FT                   TVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTLYHEQSQDAKRKMPELQYLPESDSTLH
FT                   KVQLVRDRIENSIIHDEPPIISEYINCWNIYYNHIIDKAVYEYGAPKRPLKYFTGDTLH
FT                   LEDALTPNQQRTQRNTAKNAKTRFNL"
FT   CDS_pept        join(complement(181976..182858),complement(181170..181921))
FT                   /codon_start=1
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931084"
FT                   /locus_tag="AGOS_ABL116C"
FT                   /product="ABL116Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50655.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB2700"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY9"
FT                   /transl_table=1
FT                   /translation="MGAQDLDKQSSNSAVAEIYYESNKYGHKGDLIECSNKGPMNYIDA
FT                   KNVHDDVELLAEIGYKQELKRHFSTLQIFGIAFSIMGLLPSIASVLPVALPGGSVSMVW
FT                   GWFIFGAFILAVGAAMAELASAIPTSGGLYYYTYYYAPPRLKACLSFLIGNGNSLALIA
FT                   GLCSIEYGLAEQILSIIAISSNSYLVSSRWLLYGIYCMGLLATVLLASIATFSVSLLQT
FT                   ASIVMNLALVALFIIVLPVGVAHNGRGFNSAKFMFTNFENHTGWPDWFQFFLCGSLPIV
FT                   WVIGAFDSTVHMSEEAKNATRSVPIGILSSISTCWALGFAIVVVIAACMGPDIDAILNG
FT                   EFNHPLAQILYNALGKGWALSVMVFIVVCQYLMGASILTASSRQIWAFARDDGLPFSSW
FT                   IKVVNTKLSSPLRATWASAFVALVIGLLTLAGPTASSALFSMAVAANYLAWMTPNLLRM
FT                   LFGKEIYRPGSFYMGKFWSPVINWTAILFQVFIILVMMFPSDTAGLRASTMNYTAIITG
FT                   FVWIGSIFYFLAYKHRTFIGPKSNLGR"
FT   tRNA            join(complement(183480..183520),complement(183436..183471))
FT                   /gene_name="tRNA-Tyr"
FT   CDS_pept        184385..184834
FT                   /codon_start=1
FT                   /gene_family="HOG000055227" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762496"
FT                   /locus_tag="ABL115W"
FT                   /orf_name="AGOS_ABL115W"
FT                   /product="ABL115Wp"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="AAS50656.1"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI0000252595"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY8"
FT                   /transl_table=1
FT                   /translation="MAKEKTSTSEDNYEARLPAVLSFAKPLASKKLNKKVLKTVKKASK
FT                   AKNVKRGVKEVVKALRKGEKGLVVIAGDISPPDVISHLPVLCEDQSVPYIFVPSKQDLG
FT                   SAGATKRPTSVVFIVPGSSKKKEGKAKEEEYRESYDEVVKEVKSL"
FT   CDS_pept        185148..186476
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762497"
FT                   /locus_tag="ABL114W"
FT                   /orf_name="AGOS_ABL114W"
FT                   /product="ABL114Wp"
FT                   /protein_id="AAS50657.1"
FT                   /db_xref="HOGENOM:HBG058310"
FT                   /db_xref="UniParc:UPI0000252596"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY7"
FT                   /transl_table=1
FT                   /translation="MQSRKRARGPLPQQGLQKKQKYAGEATANTQNIWKCLPRLSEHEM
FT                   DIDNAIKHSRLFIRLSLEEQKHLRTIITAINDVIDAEKYAFHTHSIELKNFHITDCCVL
FT                   LAFIMINLNKLRRGLGGTDYCSITKPFYLRCSVYIHRTCQVVQMPTANKKTTFRRQLVR
FT                   LPAVSAFKQVEFQSADLKDLMQGILQQVSAWRFRPSPTYLHRDFAAGLILQREQVAKEL
FT                   APMSVVTSLIDMGLVMPQNKAAIEQTQRALEEHGQRLLLHNEQVTVAAVDEAKPQTTDS
FT                   KPSRYSGLPTKGPNSRYQGAPARASPHGAFQDRKQNPGFLSMKDITEYCIATIKATMEI
FT                   VASKSAYQITRVYVKCPKSCVDVLYQKLADLRTESSCNIVVLNIQTVHESTSWFDTLNM
FT                   ERHTTTVPPPSTLRVISIGGIGENCKKALLLLQKFLEEYVLAS"
FT   CDS_pept        186739..188676
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778121"
FT                   /locus_tag="ABL113W"
FT                   /orf_name="AGOS_ABL113W"
FT                   /product="ABL113Wp"
FT                   /protein_id="AAS50658.1"
FT                   /db_xref="HOGENOM:HBG058311"
FT                   /db_xref="UniParc:UPI0000252597"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY6"
FT                   /transl_table=1
FT                   /translation="MSYEKKRKSFFFFGSSNSSSSRSSKAQTVQRSPVPAARAPTEKKV
FT                   RPFTTVDDPRLAKWQSPDQVISKSADPSTGKVISAAEVHGRASGGHERPVSCVVQTNDY
FT                   ILDKKFLRSLAELEKVSIDLDPELGSPSRKSDVTFDTARDSAPTHRRHISEVDELVDHL
FT                   DNFINRATDSPLASPLGGEDLDPMRRGFFAIDTKTSSQGNFSNLDSPIAAVSPLDLQLR
FT                   TNALEGAKSHTTGTNTTSSASNTHCHIDTEGDIESACDQFSYATSTVSAGEIQQVAYGS
FT                   MSGTIPLMTHLGSTDNGKSPYRNVSEKLVASPKQFRVVNEDKAHFYLNDTMEDESSVHT
FT                   TEPVYHDSISEFNEKFRYPSPQHGENAQSSVTSHSGFYTPPQRPQSTHEEPQLKSAFAG
FT                   FGQRKEPVVRSRKPLDKNVRLVSSYVEELRLKYFPTSNSLQPPPSLPIALKTRNNLELP
FT                   QNIKVRIRTSSKQIGIKHGKAKQKLLSLETANEDEEEQDIKVDHTKEFRALLGRERSAD
FT                   APGAVLEPPDDEVYGVNDLMAPLHDPMDDSFLRSGYKLKRSDTVTSYFTKNIARLRSGT
FT                   LEQEYSYSAQLPVTMTPISRSSYPMGDQDTVKHTSLRRSESPDFTTYSSNYTSGLKVAN
FT                   PDSDTDECNM"
FT   CDS_pept        188906..191821
FT                   /codon_start=1
FT                   /gene_family="HOG000207417" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762498"
FT                   /locus_tag="ABL112W"
FT                   /orf_name="AGOS_ABL112W"
FT                   /product="ABL112Wp"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="AAS50659.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG314776"
FT                   /db_xref="HOGENOM:HBG324649"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011710"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016460"
FT                   /db_xref="UniParc:UPI0000252598"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY5"
FT                   /transl_table=1
FT                   /translation="MSTSLEQPSYTLVYDTTPQSITYSASDFQKALEKGSDNDKIETMK
FT                   RILVAMLDGNSFPELLMHIIRFVMPSKNKKLKKLLYFYWEIVPKLDNEGKLKQEMILVC
FT                   NAIQHDLQHPNEYIRGNTLRFLMKLKEAELLEQMVPSVRACLDYRHAYVRKYAILAVYS
FT                   IYKVSDHLIPDAREIINSFLAAETDPVCKRNAFVALSELDREAALQYLQEHITTIDVLD
FT                   SLLQVAFIEFIRRDAIHTPSLKGQYVELLQELMVSTSSNEVVYEAGVALTVLTSASTVS
FT                   LQVASKLIDLAVKESDNNIKLIILNKIDEIQAKDPRSLEDLTLDVLRVLRNQDLDVRAK
FT                   ALDIALSLVTSRNVDDVVKLLKKELQSTVGDINDKSVEYRELLTKSIHKVAIRFVEVSA
FT                   NVVSLLLEFIGDLNSDGASGVISFTKEVIEKYPQLREEILEHLISALPSVNSARAYRGA
FT                   LWILAEHSQTEKDIQQAWKHIRDSIGELPIVQSEMKLLNKESDEDEEIPEDNVPKGPTV
FT                   LPDGTYVTESALTVQSTKQLSKEDKDSRPPLRRFILSGYFYAGSVLANTIVKLILRFEK
FT                   ISDNKSIINALKAEGLLILVSILRAGQSKLVEKQIDEDAQERIMIAISILMNHTDPEDT
FT                   SEDRKLLEMAYLDATKSSYKAQLSINRRKLDKKIANLVNESAEPVDKAVTFRQFAAANA
FT                   QHTPVDNIDNDLELACRGSSFVSKQEANSITSKLKKIVPLTGFSDPIYAECYITNHQFD
FT                   VILDVLLVNQTKETLKNLHAQFATLGDLKIICNPPSTNLVPHGFHRFSVTVKVSSADTG
FT                   IIFGNIVYDGGHGEDARYVILNDVHVATMDYIKPAVCDEASFRKMWNAFEWENKMVVKS
FT                   KLPTLHDYLNKLIEVTHMNVLTPEESFADPECRFLSCNLYSKSTFGEDALANLCIERDP
FT                   TSGSIIGEVRIRSKTQGLALTHGDSIAHMERSFNTIKLDTV"
FT   CDS_pept        complement(191982..192857)
FT                   /codon_start=1
FT                   /gene_family="HOG000172464" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778122"
FT                   /locus_tag="AGOS_ABL111C"
FT                   /product="ABL111Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50660.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058103"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniParc:UPI0001DB2701"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY4"
FT                   /transl_table=1
FT                   /translation="MMGCFARRAFSTSQYMEKAACSLVKPVHHLVKIDKSKLSPRFPEL
FT                   KYPKSDIRSPGFRPQETHQDRVREHYLNTLQDDLLLMNYEHNAEVKKGLKQREWDGSSP
FT                   FHVNRAPRKPKGSVRQHPDIKPVNWENVPEIESVVINCYVNQAKENPFLAIGAAMQLQQ
FT                   ITGRKPTSLYAKKDMPSFKVRRGTHMGAMIELKGRPMSQFLSTLTEIVLPRIREYKGIS
FT                   NKSGNGFGGISFGLTKDDVKYFPELAASPDLWPNTFGMHININTSAQTDSRARTLLSGF
FT                   GLPFHGHERL"
FT   CDS_pept        193088..194617
FT                   /codon_start=1
FT                   /gene_family="HOG000248676" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625560"
FT                   /locus_tag="ABL110W"
FT                   /orf_name="AGOS_ABL110W"
FT                   /product="ABL110Wp"
FT                   /biological_process="poly(A)+ mRNA export from nucleus "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS50661.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0016973"
FT                   /db_xref="HOGENOM:HBG123670"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="UniParc:UPI000025259A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY3"
FT                   /transl_table=1
FT                   /translation="MRFAVEELLDRDEPQEDVLGYGNCEPDGVQLWMPRKEGDKPDTVS
FT                   LLVTLRAQLERMHISEKMPKLRMGGGVFVRPKVTSRVAAATTVHKDTRTSAAAPVHTMA
FT                   TAAEMLQPLRNKMEDLERTNRAEVERVVALKKKAEEERGRLEQQQRERAAREEQERRRR
FT                   EEEEQLRKIAREKQAAEAAAQREQAEKERLRQEAEARKEAEAEEAKRRRGAVNFQEVED
FT                   EYRRHMERIRTIKSDIVEPVKKDAELRKLLAQHKRKINPKFGQLTNSSTHLMELLRDMV
FT                   GLIDATRSNMIAYRWILNFIAKAIVSQAETETRVKPETAVPLATLTLHLLCRYPELHEL
FT                   LLARVVKKCPFVIGYTCNTDTEEGRIRMGWKRNSDGKWEDETTYDERMGGMMTLYSVIS
FT                   RSPLPAEFITVREHPIGIAHSWKMLARLGNQDPALLTNTHFVLLGSWWDAAASHLLLHY
FT                   GKQARKLLQVVADDLTTAVSDRKYVGAARLRILLEEWHQTGSIKSFPEMAA"
FT   CDS_pept        194702..195370
FT                   /codon_start=1
FT                   /gene_family="HOG000260803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931085"
FT                   /gene_name="FMN1"
FT                   /locus_tag="ABL109W"
FT                   /product="Riboflavin kinase"
FT                   /EC_number="2.7.1.26"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="riboflavin kinase activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="AAS50662.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008531"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG269635"
FT                   /db_xref="HOGENOM:HBG735449"
FT                   /db_xref="HSSP:1N08"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="UniParc:UPI000025259B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DY2"
FT                   /transl_table=1
FT                   /translation="MPCISAYVIYSQVEKLPFSMNFISQHSVFTLKDCCEMARRPVDIP
FT                   IPASPVQPFPILTEYVDIVAGFGRGSAELGIPTANVPIEQLPSEVNEMATGVYFGWARL
FT                   RPNMDQEAQVHHRNDGSEVIYNFGSKLSETERGVFPIVLSVGWNPFYNNSKKTVELHIL
FT                   NDFEEDFYGAKIKFSFLGYIRPELNYTTKEALIEDIHTDIKIASEVLHTEPYSSLKNQL
FT                   "
FT   CDS_pept        complement(195538..197175)
FT                   /codon_start=1
FT                   /gene_family="HOG000115713" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762499"
FT                   /locus_tag="AGOS_ABL108C"
FT                   /product="ABL108Cp"
FT                   /function="binding"
FT                   /protein_id="AAS50663.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058104"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001DB2702"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DY1"
FT                   /transl_table=1
FT                   /translation="MLQSFELDTDSKLHERLLKVSKFPKTLAYWEELLNYLLQLASPLN
FT                   KSIDRQLCKLIRYAYESMLLQFPYLENYHVDYALFEFKLGSTAKMHKIFQKALDIFNQR
FT                   SILLWVEYLKLCNEVVMSDKALFKKYETAERYIGLHFYAGEFWEMYLEQIRQRCKLPHR
FT                   YVTILRKVIEIPLYDYSVFYSLWLQCIQDVKDLRQLKWFAPCSELWKKLKINVCLTSRR
FT                   GPELQEAKAQLRKVTKELYMVVQYQVMEIYNLFEGKLVTHTYTSPSTLIPHEEITTWTK
FT                   YLDYTATLRIYPLTSLNFQRAATVLAHYDVVWLKWANWHAEREGDYVSAQNVLVKGLQL
FT                   SNRKARILSRLAVVMIRNGEYSELNTIYDDLITLYQGKLDALDLQSFLDYVQIKVFLTQ
FT                   PISQSRYKSANDDFLISEELMEIILKRLSSEDEAGHRILLPLLNQMYQRVPRDLLEKKL
FT                   FQRIISSNWSQFLSSGYFWYEYCHMVWFDTGRSYLERRKYITKEIWPQAARYRNDGICN
FT                   ALQQFAASYSPDDLAILSELFDSNSKSE"
FT   CDS_pept        complement(197433..198413)
FT                   /codon_start=1
FT                   /gene_family="HOG000228587" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762500"
FT                   /gene_name="HEM3"
FT                   /locus_tag="ABL107C"
FT                   /product="Porphobilinogen deaminase "
FT                   /EC_number="2.5.1.61"
FT                   /function="hydroxymethylbilane synthase activity "
FT                   /biological_process="heme biosynthetic process "
FT                   /biological_process="peptidyl-pyrromethane cofactor linkage"
FT                   /protein_id="AAS50664.1"
FT                   /db_xref="GO:0004418"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="GO:0018160"
FT                   /db_xref="HOGENOM:HBG127626"
FT                   /db_xref="HOGENOM:HBG624842"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniParc:UPI000025259D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DY0"
FT                   /transl_table=1
FT                   /translation="MGEETLRIAGRRSKLAVIQSESVKEIVQREFPNYTCTVLAKQTLG
FT                   DQVQSKPLYAFGGKALWTKELEDLLYEEDLDQRIDMIVHSLKDMPTQLPEGFELGAITK
FT                   RVDPSDCLVMAAGSPYKTLGDLPNGSVVGTSSIRRSAQLRRRYPHLVFASVRGNIQTRL
FT                   KKLDDPENECKCIILATAGLVRLGLESRITQRFDSTIMLHAVGQGALGIETRTGDERLQ
FT                   AILAKVADRNSTICCLAERSLMRTLEGGCSVPIGVYSTFDEETSMLTLDGLVVSVDGAD
FT                   AAEATVSYKIKSDKEDAIACGQLLAAKLLEAGAKKILDAIHLPEA"
FT   CDS_pept        complement(199323..201383)
FT                   /codon_start=1
FT                   /gene_family="HOG000173778" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762501"
FT                   /gene_name="LYS4"
FT                   /locus_tag="ABL106C"
FT                   /product="Homoaconitase, mitochondrial "
FT                   /EC_number="4.2.1.36"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="homoaconitate hydratase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="lysine biosynthetic process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50665.2"
FT                   /db_xref="GO:0004409"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG025113"
FT                   /db_xref="HOGENOM:HBG328003"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004418"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI0001DB2703"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DX9"
FT                   /transl_table=1
FT                   /translation="MRVVRCVRRFSASRAVSGQNTTEKIVQAHAVGLRPGHRVASGDYV
FT                   SIRPAHCMSHDNSWPVALKFMGLGATRVHDARQVVCTLDHDVQNRSEKNLAKYRNIELF
FT                   AAQQGVDFYPARRGIGHQIMVEEGYAFPLGLTVASDSHSNTYGGVGALGTPVVRTDAAA
FT                   IWATGQTWWQVPPVARVELTGELPAGVSGKDAIVALCGVFGRDEVLNHAVEFAGPGVAR
FT                   LTVEQRLTVANMTTEWGALSGLFPVDGVLLDWYREQVARAPAGHARLTAARVDALAERA
FT                   AAMQPDTDARYAKQLTLDLSSLTHYVSGPNSVKVARPIAELAPQQLRIDKAYLLSCTNG
FT                   RLEDLEAAAAVLRADGSVRQVAPGVEFYIAAASAEVEAQARARGTWDVLLSAGCIPLPS
FT                   GCGPCIGLGKGLLEAGEVGISATNRNFRGRMGSKDAEAYLASPAVVAASAVLGRIAAPC
FT                   EVLGLSPPAAPAVRASVAQCGAPAAADGAAAAVEVLPGFPRAITGELVLCDADNINTDG
FT                   IYPGKYTYEDDIPRETMARVCMENYDLDFQHNVHAGDIVVGGYNFGTGSSREQAATALL
FT                   AKGVPLVVAGSFSNTFSRNAINNALLTLELPALLQLLRERYADAPSQATRRTGVFLTWD
FT                   VAAATVTVTVGSPTGERVLHQRVGEFSANLQEIIVKGGLEGWVKHALAQSA"
FT   mat_peptide     complement(199326..201332)
FT                   /gene_name="LYS4"
FT                   /locus_tag="ABL106C"
FT                   /product="Homoaconitase, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DX9 "
FT   transit_peptide complement(201333..201383)
FT                   /gene_name="LYS4"
FT                   /locus_tag="ABL106C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DX9 "
FT   CDS_pept        201739..202575
FT                   /codon_start=1
FT                   /gene_family="HOG000248018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762502"
FT                   /locus_tag="ABL105W"
FT                   /orf_name="AGOS_ABL105W"
FT                   /product="ABL105Wp"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="AAS50666.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="HOGENOM:HBG058105"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="UniParc:UPI000025259F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX8"
FT                   /transl_table=1
FT                   /translation="MGHCDLLLWRNPVETGKVFGGLLVALLVLKKVNLVTFFLRVLYTT
FT                   LFLSSAVEFASKFVLGQGLVTKYGVQECPNVAGMLRPKLEAALARLPAYQTQVRRLVFA
FT                   ASPQQTFKAAGLLYVLHILVSFFSVWTLALLSVVGAFTLPVVYHKYQREIDDAVHQGLA
FT                   LAKAKSAEAQKMASETAAPYIKQIDEKFGPVSHYFIPKTPSSSGPAAQKPAAPSTASSS
FT                   KGSVVEPSQGASSAASFPSVPSAKIPESATKEVEEEDIDIEQLKQEMKGNKEASAL"
FT   CDS_pept        complement(202806..204476)
FT                   /codon_start=1
FT                   /gene_family="HOG000221020" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762503"
FT                   /gene_name="HEM1"
FT                   /locus_tag="ABL104C"
FT                   /product="5-aminolevulinate synthase, mitochondrial "
FT                   /EC_number="2.3.1.37"
FT                   /function="5-aminolevulinate synthase activity "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="heme biosynthetic process "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="AAS50667.1"
FT                   /db_xref="GO:0003870"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG344231"
FT                   /db_xref="HOGENOM:HBG649839"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00002525A0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DX7"
FT                   /transl_table=1
FT                   /translation="MDSLARQSAKICPFVSRVTSSMQQVQVLHKTNMSAMAQQCPVMRR
FT                   AMAARGYVTASPPAGAAAADVGEARPITPVLERGTQERTFDYDGLFETELQKKRLDSSY
FT                   RFFNNINRLAKEYPMAHRLEEEDKVTVWCSNDYLTYSRNEKVMETMKRTIDKYGAGAGG
FT                   TRNIAGHNRHAMRLEAELAALHKKEGALVFSSCFVANDAVLSLLGQKMPNMVIFSDEMN
FT                   HASMIMGIKHANVQKHIFRHNDLQHLEELLAMYPKSQPKLIAFESVYSMSGSVADIRKI
FT                   CDLAEKYGALTFLDEVHSVGLYGPHGAGVAEHLDFEAHRKAGLASPAQTTVLDRVDMIT
FT                   ATLGKSFGSVGGYLAASEKLVDFVRSYAPGFIFTSSLPPAVMAGSAAAVFDQRSSLHLR
FT                   QLQQKHTSYVKTGLGDLGIPVQPNPSHIVPVLVGNPDLAKRASDILMEKHRIYVQAINF
FT                   PTVPRGTERLRITPTPGHTNDLSDVLLDAMDDVWKTLQLPRVSDWAAHGGLLGVGEPDY
FT                   VPEANLWTEEQMSLTNDDLHPSVFSPVEKFLEVSSGIKA"
FT   CDS_pept        join(204921..204947,205004..206050)
FT                   /codon_start=1
FT                   /gene_family="HOG000141734" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762504"
FT                   /locus_tag="AGOS_ABL103W"
FT                   /product="ABL103Wp"
FT                   /protein_id="AAS50668.2"
FT                   /db_xref="HOGENOM:HBG058106"
FT                   /db_xref="UniParc:UPI0001DB2704"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX6"
FT                   /transl_table=1
FT                   /translation="MNSSGFMLFQHQNSLDASFANLNFGDGSAVGQGEAAGNSFMGGNG
FT                   HPGNSVVSAPSPMASYAQQREPQREQKQTPKQQREQKQVAKHFHGHHHQHSKGSTSSLE
FT                   QAMGGGTSYWNTDSSATSSIVSIDPGVAAGGSTAGTLTTASIMDGHTAKSSSGFSTTFA
FT                   TTSSQQSNPSHGSLESMESLRLELQLKETQIESLEDEITKLKSIFNQGLTFKQQEQQLQ
FT                   KRKLHQHALDLDHMPVEIPANLEIIFNKLATSLKRKDEELEDTRKRLESIMTAIALNPS
FT                   NSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHIELELLKKVNRDLQ
FT                   RKVEQLEKQLANSGNGK"
FT   CDS_pept        complement(206440..207561)
FT                   /codon_start=1
FT                   /gene_family="HOG000220501" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762505"
FT                   /locus_tag="ABL102C"
FT                   /orf_name="AGOS_ABL102C"
FT                   /product="Phospho-2-dehydro-3-deoxyheptonate aldolase "
FT                   /EC_number="2.5.1.54"
FT                   /function="3-deoxy-7-phosphoheptulonate synthase activity "
FT                   /biological_process="aromatic amino acid family
FT                   biosynthetic process"
FT                   /protein_id="AAS50669.1"
FT                   /db_xref="GO:0003849"
FT                   /db_xref="GO:0009073"
FT                   /db_xref="HOGENOM:HBG000409"
FT                   /db_xref="HOGENOM:HBG670536"
FT                   /db_xref="HSSP:1KFL"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00002525A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX5"
FT                   /transl_table=1
FT                   /translation="MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAII
FT                   VRAREGVVQVLSGRDDRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYL
FT                   EKPRTTVGWKGLINDPDIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSD
FT                   CFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTK
FT                   PGVTAIVGTEGNEDTFIILRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDC
FT                   SHGNSNKDYRNQPKVAQDIYEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGC
FT                   SITDACIGWDQTVEVLELLAKGVINKRAVMSTN"
FT   CDS_pept        complement(207883..209349)
FT                   /codon_start=1
FT                   /gene_family="HOG000248490" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625561"
FT                   /locus_tag="ABL101C"
FT                   /orf_name="AGOS_ABL101C"
FT                   /product="ABL101Cp"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50670.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG058108"
FT                   /db_xref="HOGENOM:HBG395743"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00002525A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX4"
FT                   /transl_table=1
FT                   /translation="MFERLKLRFRRCRRLRANRLADVPYPNPTLNSAIIFQNRHNHGVN
FT                   LGSLFVLEKWIFESMFQCGGETEHAGIRKMMDAIGYEATAERLRKHYENYMAHIDWDWL
FT                   QSIGVTAVRLPVGYWHINNGMYTAGFVFDDVRLVYMSARPWDYVRALIHDASRRNIGVL
FT                   IDMHGLPGGANSEHHSGEGVDASFFKSGRNMDTVCNTMIPFIVQDLRGFHNVVGLQVVN
FT                   EAVYDYAAEGQKYYYERAVNAVRANSVCLPVVISDGWSPDQWSKWINDRGLSNDIVIDT
FT                   HVYRCYSDDDKSKSVQQLTDDLKDTVRLDRDAADFVVGEFSCVLDADSWAKTSGDRDQL
FT                   IKNFGHEQVRVFNSNANVGWFFWTYQFQHGDGGEWGFVPMVHHGNLPSRPRLSIPDVEN
FT                   RIRQMVSNHVSFWRDKGGDRMEHWRFEEAVRRTAADILAFDRFDHSRIGRVHYWRSVRR
FT                   AQYIRERGDSDLMWEWDQGFDQAISEFNKF"
FT   tRNA            complement(209727..209798)
FT                   /gene_name="tRNA-Asp"
FT   CDS_pept        209878..212595
FT                   /codon_start=1
FT                   /gene_family="HOG000246836" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762506"
FT                   /locus_tag="ABL100W"
FT                   /orf_name="AGOS_ABL100W"
FT                   /product="ABL100Wp"
FT                   /function="binding"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50671.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058109"
FT                   /db_xref="HOGENOM:HBG204135"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR010491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00002525A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX3"
FT                   /transl_table=1
FT                   /translation="MCENQGLETPLSSLTTAERTAMSRSRPSFLDQEPPPGYVAGIGRG
FT                   AIGFASKAESAQSSYRRPSRLNEGHASGNRESGLQQEAALEQFKDHDEDKEADEIYAAL
FT                   DIRLTKKTAKQPQRSADSDKVKNTQDYFVDLKRQLAGLTESDWMSIPDAGDLTRRNKRQ
FT                   RSEYQQQLKTYAAPDSLLPGARVDLMKLTEEREKLLGHQLDANFQPDTQKQVASTEQYL
FT                   AELESSTSTAELEAPSQDVTKARKMLAAYRRSDPKQPQGWIASAKLEERVNRFHSAKAI
FT                   IDQGCQECPRDEDIWLENIRLNSSDVNYCKIIVAQAIQFNSKSERLWLTAIELEGENFN
FT                   KLRVVRKALRNIPKSEKLWILAVRLEPDTKEVVKILSKATQILPTSPQLWKLLIKNQGP
FT                   DEIRTTIQEARKSMPHNVDLCILEADIKLQATTDESKKLQLLSESIKSVSSDNKPLTFN
FT                   QWLVYITNAELDACSPKTIMALVGACFTEFATEVQVTEVLAMLQTVKSESKVTKLSVCR
FT                   CLALRDPSKLTFWSYYIDLCRNEGECSHLYETWETLLKGVTMVKKYPAILLMYSKEIWK
FT                   MENDEVRALSILDKGIAIKPDHLAFWNAKLKLLLTMRDYETAESTLMHMKDSICFTQAA
FT                   GRDRLIRDYVIFLCFRGNHDGAVGFLNSMLSKDPENPQLYLLLSRVYSETSHLTKALDL
FT                   LSSAVKKLPSSDKLWIQLAYLQEHDLNTIKARSTLELGQLKNSSSIALYEARAELEDRL
FT                   GNREHARLLVQEGIRKFPKSPELWVLNIRFLARKSLRKTMFQDALKNTDSHGTVLVEIG
FT                   KLFYIEKQYEMALKWFERASETFPRLGDGWAWYYQTLSKLGKDTSGVLRSAEEREPDSG
FT                   KLWDHVCEKNKTLYALPSDIIRLCRSEIERGAWQ"
FT   CDS_pept        212861..215263
FT                   /codon_start=1
FT                   /gene_family="HOG000113422" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762507"
FT                   /locus_tag="ABL099W"
FT                   /orf_name="AGOS_ABL099W"
FT                   /product="ABL099Wp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50672.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058110"
FT                   /db_xref="HOGENOM:HBG203131"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00002525A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX2"
FT                   /transl_table=1
FT                   /translation="MIKEAERDIDLTAAVKNNPSNAYDMSKQTRSSTKLLNMSDTAASG
FT                   SGKSADSNTPQKFGSDPEPGYSGSATDLQLLSSPELVLDELSNSFRVAGIVSAGARTIS
FT                   AASSVDHVNMATNAPPEEGRDNKYDEVSAINSSNDLQLSLLGNNEYYEVPRPSGNRKVY
FT                   SQLPSPPDTKASIKKASAVGDPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNR
FT                   ECKYILNARNKKRAAAKKQQPEYNVNDYRTTLEKPVPSAQFQLNSFTNSLPISNHPAVN
FT                   TPDEAIIYSDVNLLLQNFNDIVNMKLNDSLFNCGTLNDDSLHDLDLSTTFHTSAEIPKV
FT                   LLSDYGDTSVEFNTSLESFHLGPFHEKYLTVFYHDCLNTIAPFFEGQTNPLRDILLSFA
FT                   KTEPYLLSAILAVGASARYRKFGCEDDEKAYCNYLSQCLSLLDDHYSEESKLMSKIAPI
FT                   MLTVILLAWDSVYTMNSQWRSHLKGVTDLLRKTDSIPSTKVLNVVKCWFKVIETFAGIS
FT                   TVIGGALLDDGELDAIFDPYNNAYLAALKQLSIMTPLHEFNLLRGHKEDFDLVIKEVFK
FT                   ALNSIRASDKGDTFKKEGIMGKSFDYLQWSSMIPPAMRERLSYLRIQKILTDIDSQLSY
FT                   KFIDNSGIIPISNCSHPENSHIVDNAIDTVVLNDGKTIAISWYDISHQTQVLSFLLIVL
FT                   LKLLGIPKQSIVIQDVVRRITGFFSFLDSPDPPKNLRSCYCNFAILIAGLNSIEQETQD
FT                   IIRKYYRAFGGQSHTLMKYNLERLEQVWRLQGTEDASSIEDKDIITW"
FT   CDS_pept        215674..216741
FT                   /codon_start=1
FT                   /gene_family="HOG000141784" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625562"
FT                   /locus_tag="ABL098W"
FT                   /orf_name="AGOS_ABL098W"
FT                   /product="ABL098Wp"
FT                   /protein_id="AAS50673.1"
FT                   /db_xref="HOGENOM:HBG058111"
FT                   /db_xref="HOGENOM:HBG204134"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniParc:UPI00002525A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX1"
FT                   /transl_table=1
FT                   /translation="MLQMITPSPTGTMSTMAPAVTEYFRDPNAMLSEGVTYSMETRELY
FT                   WVDIYHARIHRVLDVDNPEQSHSTYDINPATYGAASAYPGSADTAERVGCVFPGLGKGG
FT                   RLLFAAKRGIAELDLDSGSWRYLYLYSESGLNKAWDRLRSNDGSIAPNGAEIYVGLMAD
FT                   FSVGGPDTSNAPEGCVLRIHLEGWRCQMVLDGIHIPNAINWSADGSQFYLTDSLAFTIW
FT                   ACPVVDGSPQLLKRTPFYCTKNTGNDSHTSPEPDGGFVDCFTGHTFVAVWSTGKVQELD
FT                   NAGRLVAAYTLPTPRVSSCCAGPAGELLVSTAHAGDFKTGAHSDGVGGSIFRVVIPGRR
FT                   VAQAASPRLAEASFK"
FT   CDS_pept        complement(216751..217110)
FT                   /codon_start=1
FT                   /gene_family="HOG000065961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082461"
FT                   /locus_tag="ABL097C"
FT                   /orf_name="AGOS_ABL097C"
FT                   /product="ABL097Cp"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50674.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG058112"
FT                   /db_xref="HOGENOM:HBG203129"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="UniParc:UPI00002525A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DX0"
FT                   /transl_table=1
FT                   /translation="MSALDQFVMEDVAKHCPNEFMQYHKCISMNHEDPSQCDFRQRDLA
FT                   VCIKQKVPVVQDIMKHCSAQMQRYEQCIRDHMESRTINENCLGLMAEMRSCAERQTAGK
FT                   ARPINELGGRGDERV"
FT   CDS_pept        217163..218503
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762508"
FT                   /locus_tag="AGOS_ABL096W"
FT                   /product="ABL096Wp"
FT                   /protein_id="AAS50675.2"
FT                   /db_xref="HOGENOM:HBG058113"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB2705"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW9"
FT                   /transl_table=1
FT                   /translation="MATDNGPATGTLRKIRTTSGKTRQHPLVPQEVCERMNHRWLDYAL
FT                   GQGELVPPERTVQFKAPVVYHHERTPADVYSVGVSALAVDQHTGQFFVSCGTDGSVSLW
FT                   QFHGRVVGNGVLRNRRLHYVRGTVSEEPAPRRSADARHNVRQVNNIRMYMQRAPAAAPD
FT                   TPRVGVQASVDCVFYGQDNGMFVTAGRNGTVRLWDTESCRPLHEVQLPHAAHQLHARGS
FT                   LLLCALADPHPRVLDLRHPRGEGMQLRAGARARPGANALCARFLADAADDPRFVAAGDH
FT                   AGGLAVWDLRMANRRVAAVPGAHPGFVNALATLHVPAHVATLATAGADGRCRLWTWANG
FT                   ALRLRRPLGPSDAARNRLASRTASRLLCHRGHCFLSSDQGDLLVYSCADGRLVAKLAHA
FT                   DTFPAAPASARFQALAIQPRLAAGTGTRLLLGSDALSGALADYELAL"
FT   CDS_pept        218935..222000
FT                   /codon_start=1
FT                   /gene_family="HOG000112890" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762509"
FT                   /locus_tag="ABL095W"
FT                   /orf_name="AGOS_ABL095W"
FT                   /product="ABL095Wp"
FT                   /protein_id="AAS50676.1"
FT                   /db_xref="HOGENOM:HBG058114"
FT                   /db_xref="HOGENOM:HBG203127"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI00002525A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW8"
FT                   /transl_table=1
FT                   /translation="MSRNLADYFGQGGPITPRRGPREDYVGPSVSMAVEAEDDDKFEKA
FT                   TFNLKRTRSMGLLDEYISPTRRLLEQDEAALEPEGEATWVAQASPQLPPLAVSHLEGSK
FT                   SPPEPDTDSYMLPLDDIDVHHEPNRHVDYLSHDWDECDISQSWKYIILKKRQKGEQDLV
FT                   NAARLENASWRTWAKARNNLRTVSPEVVNWSKDSDVTWLYGPILRDSGHAQTLTRNAVA
FT                   DMEELVYGSDDENSKRVSKKKSGGSTGPPQRPGPKPILKKRTVSEIIEENSLWRLTVAR
FT                   QHRKQIADANSIMDGYGHNYQHDDYDALAARVNSQYYTGTISNDYSRNGKRNHGTESEG
FT                   PSSPLADKVDNHPLTKESSSRKVPPYKKDEEKQTEHHLTQEKMDQGSHAQKDQKEFYIG
FT                   RHQEHGHGDLPDHTLQEYGRRLKEPVLLPLHDKGQTSGQDATGDELPARQAPQQTQAPA
FT                   ERHDLASLKDMAPIAPVLASILTSTNSEREKVKDRHIHFNDRVEQCVAVNHYTDDDYDD
FT                   DNEYEEDGYDYEYDDYDDSAPTARVYSSQYDDESTDHYGSSGEEEEEEDGLFISATGRK
FT                   TTENVPPIQTDASSYGSSTVGHGSRCQMHLIIKMLPATTLNYGSDDEYYDGGDYYRGNA
FT                   VSHNVNTYRGYDYVYDYNSVYTADTSNFLAFNNCDIVDVPEDLQTPVDEEGAPKFRYES
FT                   PEETKDREQEPTEISNENIEVIPVPSSISSKISYHVTEFSSNSDMSDDSLSEQSGVSLS
FT                   NGCTISTGKVDDENDSLALKRTPSLGKSQNSSLHDLQYNKPTFPASFSFITGNAVPSRV
FT                   VPQPHEQQLQQQQHQQHQQHQQHQVHHQQSTNKPTLVKRSSSKSFIFDDSDTEDSEPDS
FT                   IVPPPQISHSLSNDSNTKSPYSIPTRNTSASTSPKNIPPPNFGSLGSGNSHASLNHVAI
FT                   PGYISPRNGSMQSVISEEKLIPATKTVSHTSTSAEETSRNLDLDSVNKTFGDCRIGSPD
FT                   SSEFAYKTERGQQQSSTKMMEMASKYLNSWKR"
FT   CDS_pept        222466..223239
FT                   /codon_start=1
FT                   /gene_family="HOG000000830" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625563"
FT                   /locus_tag="ABL094W"
FT                   /orf_name="AGOS_ABL094W"
FT                   /product="ABL094Wp"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="AAS50677.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="HOGENOM:HBG058115"
FT                   /db_xref="HOGENOM:HBG202179"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00002525AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW7"
FT                   /transl_table=1
FT                   /translation="MSRVAQLDSLALDSELHQGIWSEFQSQFKPVKYIDEWQLLLHTLI
FT                   YHFSTHTSVAGVSTYGSQLSGVTYRTSKSTLFLVTVLVRYIHKKLSTLLVRREGYAKLY
FT                   RVAAKWYHCYDLANFLSFLARPLFLSPIHRLFGIRCVRALDDPNFYLSTVYSGLEFQNR
FT                   QLMWNALLELLNANFFNSHFFSKRSLVKNARPTGPEECAKCRDVPNNPYSTSCCGATYC
FT                   YVCVLISLDIKFCNNCGNRGDFSAIPLYAPPRLTE"
FT   CDS_pept        223625..226459
FT                   /codon_start=1
FT                   /gene_family="HOG000065963" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762510"
FT                   /locus_tag="AGOS_ABL093W"
FT                   /product="ABL093Wp"
FT                   /protein_id="AAS50678.2"
FT                   /db_xref="HOGENOM:HBG058116"
FT                   /db_xref="UniParc:UPI0001DB2706"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW6"
FT                   /transl_table=1
FT                   /translation="MVKVNVSNASSQSSQDNSCVGDAKADQCKEPDGGERTEEKSTLNG
FT                   SPRHNSVKSLSVEASSLNDDLLSVVSSSKLRYGAAATVGRSTSVTRPSFESFSLRPSLD
FT                   PSSVFIAGARNNISTMLDIETASPTGSGVNYSPLGQNSIFEIVMNTRRKGWLRAPTVQD
FT                   IPPVPLSKDMPEGDWKTRLGSYVSRISDGYTTFQNTNTLASMNRSHQLKKLERYDRTES
FT                   AVSADEEDTEEDAFSSSKMLEDIPSVYFNEDFQLDNPRVFHKVVEDINLQLDSLTIASQ
FT                   SQRAAAYKDLQERLNFYLDTIENILIVDISKSSHKFLDALEDVGTIKDEAQSVLTKLDQ
FT                   LKTELETEDRERLQKRLRLSQKLTRIRNIERLEQGLLQLHVVLKQIEECRRLYDAGEYT
FT                   PCLKHITSVELLISGNIGNDELAQEWTHGWPYSLQDLSRIPSLAPKREYLSNVRIEIGG
FT                   KLSLALVDLLLSDLRAYATNQTVKGTLNRLQSQTKGGRTYWDIELAFREKVTDIIQRLI
FT                   KCEELTSAFQLYQDKFIVELKSIIKKHLPKDQPSSENSLNDGDSVAEPTRPPTPSNTGT
FT                   ASTGSKLSRLIREQTPAEFQEMLTNIITEESNALRRLSRHQKLLLDVSLTELASDSSQY
FT                   DMIMLLDIRRSINEGIRIIQLRLGKVIAVRRDFTSQLPPRQFIRFYMVCALFIQECESL
FT                   SGDLLTKYLADVLMMQVRNYISTFAMSNMEQLQHSIDSDRWIPYIVDTTDQSDVNDIVS
FT                   CTDIDPLNWVHARDLAIESSPAASPSPPVSQSSSLTSPSAPSPSFTSTTGHKRSVVVGD
FT                   KTFVASESLIICLRMLSALLLLSLNLPSNHLSLLEKAVLDLLRCFNIRAMSSAASTNDK
FT                   KPSSATKNLSIMGESLDCLSEMIGLVQGFYQRLEALHKDFQALPPHTYAVLAQQFRRSS
FT                   DKLYQAHAPPPPPI"
FT   CDS_pept        227494..229290
FT                   /codon_start=1
FT                   /gene_family="HOG000001032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778123"
FT                   /locus_tag="ABL092W"
FT                   /orf_name="AGOS_ABL092W"
FT                   /product="ABL092Wp"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50679.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG123850"
FT                   /db_xref="HOGENOM:HBG204132"
FT                   /db_xref="HSSP:1A5J"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00002525AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW5"
FT                   /transl_table=1
FT                   /translation="MSDTQGHHHGHTGGHEFVEEAVFKYVSGPISGESDSSTVAVRSGS
FT                   GPSSTGSTAATGGSGRRHSGIGVEGLRVKDKDKEMDWYLKHNDEEELHGRGEDSSAAAA
FT                   AVAAAAVAAALGERGKRRGSDELEALKKSKRQKAKAKKLKSQLGAVDPELASLDSTDND
FT                   HLVRKAIMDVDHISQHPDIQQYLNTEDEETEKDKDKDDELGLAPAYEDSEQKIALKKAE
FT                   VLPKILDPDSSDRDIGNLIREAVKKAAHIINLQTQSTGKSFDETEEEALEQFVQDYQVI
FT                   KGMTRRQICERIWSNERRKDDFWTNICRVLPYRTRSSIYKHVRRKYHIFEQRGKWTPEE
FT                   DAELARWCMEKEGQWSNIGKVLGRMPEDCRDRWRNYIKCGASRASNKWSPEEEEKLKSV
FT                   ITEILESAPKNHLDGVDDKDEYEGTDDNRSMGRAVSPSSKSLAHELELVRGDRVSLGDS
FT                   AGEKDQGSPGLGVKAGSPRDVINWTIVSERMGGQRSRIQCRYKWNKLLKKEAMNKIKTI
FT                   SDEDKTWLLLKLKDLGFTEDSQVDWEELAALMPGRRWTGTELKLCYEKLRTSVRQYKKK
FT                   PISEICRELVDYHDGKAILSKT"
FT   CDS_pept        join(complement(230201..230245),complement(229537..229962))
FT                   /codon_start=1
FT                   /gene_family="HOG000231341" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625564"
FT                   /locus_tag="ABL091C"
FT                   /orf_name="AGOS_ABL091C"
FT                   /product="ABL091Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50680.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG232265"
FT                   /db_xref="HOGENOM:HBG750455"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019978"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="UniParc:UPI00002525AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW4"
FT                   /transl_table=1
FT                   /translation="MSTELTVQAERAFQKQPHIFTNPKAKANRRTKRWYKNAGLGFKTP
FT                   KTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTKMHRTIIIRRDYLHYVPKYNRYEKRH
FT                   KNVPVHVSPAFRVQLGDIVTVGQCRPISKTVRFNVLKVASAANKNNKQFTKF"
FT   CDS_pept        230729..231733
FT                   /codon_start=1
FT                   /gene_family="HOG000294672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931086"
FT                   /locus_tag="ABL090W"
FT                   /orf_name="AGOS_ABL090W"
FT                   /product="ABL090Wp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50681.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002525AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW3"
FT                   /transl_table=1
FT                   /translation="MSDIPTEQKVVLIRETGGPEVLRYEEDYPVPEVRGSDILIKNRYA
FT                   GVNFIETYFRTGLYPCEKPYVLGREAVGVVAAIGADVRRFKVGDRVACLSSGTFAQYTA
FT                   VSEKSNVLKLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKPQVGEIVLVYAAAGGVGQ
FT                   LLIQLLHARSVRVIAVASTDEKLQIAKSRGAEFLINSSREDIVAKVLEFTDGEGVGASY
FT                   DSVGKDTFETTLQSVKRKGTIVSFGNASGAVPPFSIQRLTPKNLKILRPQLYGYLATRE
FT                   EWEYYSSKLLHLIRSKKLIINITNLSPLEEFKRLTQLLESRQTTGKLLLAIPD"
FT   CDS_pept        232107..233912
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931087"
FT                   /locus_tag="AGOS_ABL089W"
FT                   /product="ABL089Wp"
FT                   /protein_id="AAS50682.2"
FT                   /db_xref="HOGENOM:HBG058117"
FT                   /db_xref="UniParc:UPI0001DB271B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW2"
FT                   /transl_table=1
FT                   /translation="MSIVMDKNLSFNSEQLLNVTTEEEEGNGEGFPGICGHHSSTLTER
FT                   TMNLVAVSTAAASSLSANLITTPSSPPVVHRESQKKRKKARRLLRKWKQTVKQKLHIAN
FT                   YDTNGAYTNNQSTATSMSELKDALSCYYKFKSDESKIEEMFETMMFKNNGQSPPITRDQ
FT                   ELRELVPFEIIGEQKLADLKKKLDVFSNCLSALDDDKPWNQSSGFNSPNDLKAPRSAIG
FT                   GSGSPPDLVSGISTLDSAEPPESLDKPSCCQLLSGDDCCINESADSTPHVGLTTGSSKA
FT                   SSIVEKIASFVRTPKTSETSPMDSVRLSSPLDSEFEVQRLVIPTFRMNAGKNMDVSHIV
FT                   ENLKSGTITENDLLYLASMYAAQEVGFMDKSFYDDQGNEADNESATSDDLEKERQTITT
FT                   DERDYYKNNHESPDSVKFDRFSYLVIYNASKKCDSSGLKKRSTRNNSGSIIQGTTAVDS
FT                   GYEGDDDEPHSPNITESDGSLCKSILKSKNNDKEYLESQRAVKCDKVSVDEFLEFFEQY
FT                   ENERRDGEHMLTSARDKQLCNYYSNEYFPEISCQSNPVKATTEFTRSKLATEHNIGREL
FT                   MDVKSEVDSYNCYNDCSSVIGVEAN"
FT   CDS_pept        complement(234083..235462)
FT                   /codon_start=1
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625565"
FT                   /locus_tag="ABL088C"
FT                   /orf_name="AGOS_ABL088C"
FT                   /product="ABL088Cp"
FT                   /function="ATP binding"
FT                   /function="serine-tRNA ligase activity"
FT                   /biological_process="seryl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50683.1"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006434"
FT                   /db_xref="HOGENOM:HBG053760"
FT                   /db_xref="HOGENOM:HBG629391"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniParc:UPI00002525B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW1"
FT                   /transl_table=1
FT                   /translation="MLDITLFIEEKGGNPDLIKKSQQARNAPVEIVDEIISDYKEWVKT
FT                   RFQLDELNKAFNKVQKEIGQKFKNKEDASELLAQKERMTEEKKQLIEQEQEQDKALRDK
FT                   VNRVGNIVHPSVVVSNDEANNELVRTWRPEGLSEVGTTASCTGQPAKLSHHEVLLRLDG
FT                   YDPERGVKISGHRGYFFRNYGVFLNQALINYGLSFLAAKGYCPLQAPVMMNKEVMAKTA
FT                   QLSQFDEELYKVMDGEDEKYLIATSEQPISAYHSGEWFEKPQEQLPIRYVGYSSCFRRE
FT                   AGAHGKDAWGVFRVHAFEKIEQFCITEPEKSWEEFDSMIANSEEFYQSLGIPYRIVGIV
FT                   SGELNNAAAKKYDLEAWFPYQQEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVH
FT                   CLNSTLAATQRALCCLLENYQTEDGLVVPEVLRKYIPGEPEFIPYSKELPKNSTSNKRK
FT                   N"
FT   CDS_pept        236044..236907
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762511"
FT                   /locus_tag="ABL087W"
FT                   /orf_name="AGOS_ABL087W"
FT                   /product="ABL087Wp"
FT                   /protein_id="AAS50684.1"
FT                   /db_xref="HOGENOM:HBG058118"
FT                   /db_xref="UniParc:UPI00002525B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DW0"
FT                   /transl_table=1
FT                   /translation="MTSAVNILLDAIYIVVTYVLPLILTFHTTYESNELSRHIAKGYSD
FT                   MEALQFKGSQVIKSEDYLRQLEEVMHINLKICALSLSKCMMRTQISIYWCVYWLSVTVL
FT                   EQFLYPCLRRKMLYASININAASWRTIQTMVTLALLIHTYEHPVERGKPLRERNKDRFW
FT                   SIQSMLMKVHDCCLNWVSAALDRANVSCTPAQISALVEKGNRILAVEQHKYFDRGLALE
FT                   ALTKPHTGEKTVLVMDTQMSYDIVSTSECNSILSASSASSYSSAAVDHTRHGRGRTNTT
FT                   QPTFSK"
FT   CDS_pept        complement(236962..237726)
FT                   /codon_start=1
FT                   /gene_family="HOG000214596" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15762512"
FT                   /gene_name="MGM101"
FT                   /locus_tag="ABL086C"
FT                   /product="Mitochondrial genome maintenance protein MGM101 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="mitochondrial genome maintenance "
FT                   /cellular_component="mitochondrial chromosome"
FT                   /protein_id="AAS50685.1"
FT                   /db_xref="GO:0000002"
FT                   /db_xref="GO:0000262"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG192030"
FT                   /db_xref="HOGENOM:HBG448424"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniParc:UPI00002525B2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DV9"
FT                   /transl_table=1
FT                   /translation="MIRFCSARLIQRGLHTAVAKPVMATSTAASRAAASKMAGAQAETG
FT                   VVGSRLVPGYGRTLTRALGGQVLEADTEGGGHVMTEGSVDWRRSFHGLGAKPFAAPVQE
FT                   ELARALEPLDIEIKPDGLLYLPEIKYRRILNRAFGAGGWGLAPRSDTIVTAKLVTREYA
FT                   LVCHGQLVSVARGEQDYFIDTGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKKFKK
FT                   EYCMERFVEHLTTKKKKKIWLRKDREVEYPYK"
FT   mat_peptide     complement(236965..237630)
FT                   /gene_name="MGM101"
FT                   /locus_tag="ABL086C"
FT                   /product="Mitochondrial genome maintenance protein MGM101 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DV9 "
FT   transit_peptide complement(237631..237726)
FT                   /gene_name="MGM101"
FT                   /locus_tag="ABL086C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DV9 "
FT   CDS_pept        237995..240268
FT                   /codon_start=1
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625566"
FT                   /locus_tag="AGOS_ABL085W"
FT                   /product="ABL085Wp"
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50686.2"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI0001DB271C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV8"
FT                   /transl_table=1
FT                   /translation="MASKKSQKAASVERDDSAAKRGKAEGRYEYMGERWLQRPAPDSNL
FT                   KYKYYGYMVTAIAFAVRFHKLYHPSEVVFDEVHFGKFASYYLERTYFFDVHPPFSKMLI
FT                   AFVGWLVGYDGAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAI
FT                   TCAFGALLVAVDNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWL
FT                   YATGLSLSFVISTKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLV
FT                   CFPFAVYLFWFYVHFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHYYDIVTFQHR
FT                   DTGALLHSHNAYYPLRYEDGRVSSQGQQVTGYSHEDINNQWEILPTKELSSRTGQPVLL
FT                   DDVLRLRHIATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDG
FT                   GHTVKSKTSMFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNGNKKVTDPANIWTVNSIL
FT                   NLSEERKVYIPKKVTKMPFFSKWLELQRSMFEHNNKLSSEHPFASQPESWPGSLSGVSF
FT                   WTNDTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLGKLAREKIYGPL
FT                   CFLYIGWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWEVIFTDNRALTTRKDESE
FT                   PAAPHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYGDRTLTPEEVIKRQWFDIKL
FT                   HFAK"
FT   CDS_pept        complement(240348..241364)
FT                   /codon_start=1
FT                   /gene_family="HOG000264717" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762513"
FT                   /locus_tag="AGOS_ABL084C"
FT                   /product="ABL084Cp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS50687.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG098963"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI0001DB271D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV7"
FT                   /transl_table=1
FT                   /translation="MSTVDWDGTRQILLRTPADVQKGFSFIEIVNAVDGLSYDYQSNPA
FT                   FKEHVYEFHTHSGVPIGYILQFVVQEMRLVASTEFDRLFACSDAERYVKFKETDFETRN
FT                   EQLETLAQQLRSRSSLSCLKGWRNEKYAVYVEHLPYVLIERALSSVFGIITYGVHMNGY
FT                   LRDASTGELLIWVPRRSYKKATWPGMLDNVVAGGLGHPHGVYDTLLKESMEEAALPEEV
FT                   IRNGARAVGVVSYFYHKPGGTYSTEADFITGEIEYLYDIQLPVDVIPKPNDDEVNNFTL
FT                   MTLQQVVDALIRGDFKPNCGLIMLDFLVRHGYVNSDNEPHYLEIVTKMHRHLPFPTL"
FT   CDS_pept        241545..242690
FT                   /codon_start=1
FT                   /gene_family="HOG000248436" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082462"
FT                   /locus_tag="ABL083W"
FT                   /orf_name="AGOS_ABL083W"
FT                   /product="ABL083Wp"
FT                   /function="manganese ion binding"
FT                   /function="pyrophosphatase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50688.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016462"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG058119"
FT                   /db_xref="HOGENOM:HBG396317"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="UniParc:UPI00002525B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV6"
FT                   /transl_table=1
FT                   /translation="MSNSIAQFLTFLRNQYVKNLSQGVPLRIVCGNESADLDSVASAIA
FT                   YAYFSYAWKPTEPVVPIISIPHHDLKLRKDVEMVLEHIGVSDKSLFFLEDLQKWKMDHG
FT                   LTIDGVLVDHNELQGPCKDLIDEVVGVIDHHEDQRIYYEQVKKTNGPYIVAPTGSCSSH
FT                   VVNYWNGILGSSDQSQLTDALTLCMSAIMMDTSKLKHKVEDSDMQAYAICKSVLTNMNE
FT                   DAYYKRMKAAKNDVDGFSLDEILRKDYKELVFPSRSADLRVGVPTVVRSFEWMREKFGD
FT                   NGTTKLWHSFLLEHKLDFLVVLTIKKANEGLKRELAIMANSCDRAQQVEFLIQSLTPEL
FT                   QLSKTSVFSPGSLVIETCDQRMLSASRKQIVPLLKRTVAEL"
FT   CDS_pept        complement(242685..243719)
FT                   /codon_start=1
FT                   /gene_family="HOG000144425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762514"
FT                   /locus_tag="ABL082C"
FT                   /orf_name="AGOS_ABL082C"
FT                   /product="ABL082Cp"
FT                   /protein_id="AAS50689.1"
FT                   /db_xref="HOGENOM:HBG058120"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniParc:UPI00002525B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV5"
FT                   /transl_table=1
FT                   /translation="MQYLAEYLPRIGVMLIVVAGEAGEVELGKLGGHRLTVTVNGAAEV
FT                   IELPCEVDPLARPRIRHSEGAFEVRLKAVNGTEGRGADFTMLAAEDGWGRKDLARAELR
FT                   CAACDGLLVTGEACRRVSAMPSEFWTELMDYWHCHKPADESAGAQQYLTKYNALLPADG
FT                   ELLVGDTFVTVGEGLLSEKLAMSGTAVLCKACRAPLGAVTREKLLRLHKWNLVQVRSDG
FT                   SRKKYRQASAVVAGLLSALNSHAARVVHLRAERGSQIALWVFNVGLDVSTADGLIRCGL
FT                   KILYTDDVESVTHAPSGRQHIESMTMPDACFDDFVKRLETTNATLPLRCGKMGNWNVSY
FT                   ISML"
FT   CDS_pept        243852..248783
FT                   /codon_start=1
FT                   /gene_family="HOG000112902" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931088"
FT                   /gene_name="HIR3"
FT                   /locus_tag="ABL081W"
FT                   /product="Histone transcription regulator 3 homolog "
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50690.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058121"
FT                   /db_xref="HOGENOM:HBG202270"
FT                   /db_xref="UniParc:UPI0001DB271E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DV4"
FT                   /transl_table=1
FT                   /translation="MSLFTALNSTPHDALLEAEEHSRELQVEESFRVFQSALFHLKAKR
FT                   FDDAEAKFEQLFNIEVLKPDHWGLYRYSSPTLDLLRYLAYRNRGVFYYQYVREHAEELD
FT                   KDDIVDYILKVVENLLQALQHSDGDAAVTGLLLQVFRGFKSKRLQRWILEYELTKQPEE
FT                   MLLLGRGRALLPDTRGLVEEYRRVLRDVRSEPVTEFAARVLTLVKTDSLEVQPLPPVLD
FT                   KIEQLKDEDDAMMKQLAEYEVNLEELSWECIAESFRSLVPKYKYTNFFSKAPDPYSEAG
FT                   DPIECIKFVHNDKPIEQEVMEQLSVQNEREPFAATQAATEAPTLEKEGSENGGRTESKR
FT                   DSELPSDSQRPAQRSSKRFKERSTETNEAELLRPHQDFAALFYSCTGILEVRLEIELSH
FT                   LNPEAIPSTYPAYMPMLDFYECLNSWTSKHTEFLNQSETKGTSKNKGKGEDSFQLTSLL
FT                   RSSMFTEENRPTISLTELPYKEVAEFISTVNSNRLHFHAVRLLLLQVLLTVRPDGSCLI
FT                   TDTFWSPILYDTIESFVLSLESNIYDLVYSQSEKYKGLGLSFCEVLMNSLGGIYTEIHA
FT                   KKISGGKYGELEAQKNKLEKKIDRWVLLLDQLVFEGKLKFRYLWSKFCYLQCISDVTDD
FT                   RIIHSLDYITHELRNSSMDIDISYANYEHTPRLNMETVQSQLSKIKMMRKFTMVNQMDV
FT                   DRNDSSNEDQIEALSRVLVGTSLLDTPEDRSMSEFVNQAPFLLKIKLWRIVLHHYLAVK
FT                   DQSNFQICYFKVLHVLYERLCSKEYSDQSQLQRQQTLLSTLSLMRSFTSLFIELLSGAN
FT                   EWVINDTSQASEYFKLLIDVFILLYPLTYFETLSQKSATTVSFFKKAAKSSVILKDMFV
FT                   DISCLLVLYFTGACTQKEVVNGVEVATEFIHALHLLIGGFTFCDAANGNFLNLAEHFFC
FT                   SVEGSSSFIPLKQILLCKYRLSLGGDANSFEDHGAKPQVLEMHNAVRLAKYLIRFEYQN
FT                   KNPYLISTNRSNLKQVIENVIDVIGKIPYAENHILARNVYYFEQYLEAPVTAKIIQEAL
FT                   QGCISIELTKPRDNLQEIVDLGLYYISGVQLLNLYKVRKKTLQARPSELDSIIETLKAD
FT                   ILYKTNRFETWFLLGKCYSYVVEDDLIWTSDRLVVASKKATTASIQRKAILCYLMALNL
FT                   CQLSVDDPSLSEAQKMENAFIKREIYEVLALELLNAYFKPMEGLPFQRDIAPALVLTET
FT                   GELVEPKNSPQPSISSANIYRATLLVFTNADEMYKDSQDALQNWLNPHYIANLRFKHER
FT                   EDFITDGFDIIIRACNLAMKASTSNDNIIEPHYSLVIKCYKSVKHGWLRPEDALKHLLN
FT                   DNSFLAQEANFYSHNPENSVQDFYRKIITLLRRLLALDKRKWHHRPTYRIARILFDDFN
FT                   DVDGAIQEMGVLMALKSVNKNLVNIWKPEYERPGKHFVYTYQYVMFYLKLLSHKNDYIS
FT                   LGHAARKMRRFGSGMVNGSLATDKAVEMFINGARAALGINEKEHAELLLPTLNYQAFNR
FT                   YSDELIASFNKENYSYEVLESLAISYQLKKGSSGIAFDGVCLSIYFKYLYLPWVEEHEA
FT                   AEATQSMVKFVEINKNVNPTENETASPQPAAEPQKSTTKQVSSRKRVSKKDAFDKISQI
FT                   VDKIT"
FT   CDS_pept        248991..250061
FT                   /codon_start=1
FT                   /gene_family="HOG000024037" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931089"
FT                   /locus_tag="ABL080W"
FT                   /orf_name="AGOS_ABL080W"
FT                   /product="ABL080Wp"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS50691.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG252503"
FT                   /db_xref="HOGENOM:HBG477935"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="UniParc:UPI00002525B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV3"
FT                   /transl_table=1
FT                   /translation="MLTNVLPTGTGLVGNAFLEQLLSIKQSICYNIIYVARSRAALISK
FT                   DYSPLNLGSSWKSALENADEKPLELNALVGYLQKSPQKVILVDNTSSSDIADFYPNFVG
FT                   AGISIATPNKKAFSSDLKLWNGLFSDEEGHGLVYHEATVGAGLPIIGTLRDMIKTNDKV
FT                   EKIEGIFSGTLSYIFNEFSTIAPNSVKFSEVVKVAKSLGYTEPDPRDDLNGMDVARKVT
FT                   ILARIAGFEVQSPSSFPVQSLIPDELTSVNSVDEFMSRLPDYDEQLTLLKDAAARENKV
FT                   LRFVGKVDFPNNVVSVGIEKYDFSHPFASLKGSDNVISIKTSRYSQPLIVQGAGAGASV
FT                   TAAGVLGDVIKIAERL"
FT   CDS_pept        complement(250122..254726)
FT                   /codon_start=1
FT                   /gene_family="HOG000093241" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625567"
FT                   /gene_name="IML1"
FT                   /locus_tag="ABL079C"
FT                   /product="Vacuolar membrane-associated protein IML1 "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS50692.2"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG058122"
FT                   /db_xref="HOGENOM:HBG395415"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022046"
FT                   /db_xref="UniParc:UPI0001DB271F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DV2"
FT                   /transl_table=1
FT                   /translation="MQSNLLQFSNLRTGNLRLASTNRGSANGGGSSTMESGTSGAGSSS
FT                   NKQVNMVIENNTLTIGGTEGKRAFGRRLQMDTSGLKVKSKVDQEELESAMKTPISGIPF
FT                   FNQSSRRSYQFELSFHNTPVSDDCHVLIDVSQLPGAREGDLAELRTYHRSPGTRDKKVY
FT                   FKIKSLDVEARRRSATTGLSILTGQLRYLLDLPSRSPVWVKLKSKNEHQADLVELHVKD
FT                   CHVNRGDMWCISSTLLDTCVFTGQRVTYINALRLIVKAIYRNGKKVISGYVGNNTKVIF
FT                   ASESARIIFLIQITEEMWHFEQNGEKTFHKVVNSLFPRILKRWKDIGTYHTITIVFCAS
FT                   VDESGQSFRNIPPGVRLKNTKDYFRIVVDRVNILYWDEIMKTLRKEFMQIIGDLRNTQT
FT                   DDGGGPIRWSFTPVIKSNILETINFATTLLADQFRVPDLKHTVTHVIIISPGTGLYDVN
FT                   YDLLKVTCRKLLSLEIAVDLICLSRAPLHIVPLFRYIDYQGELCHSAPTWLSISFWDDN
FT                   KKSQEWHPRCKIYDVQMMGVTERRDSEEVTLNYMNSALHTTSVTDFMDQYDKEVFDADK
FT                   CYPLSNENRESTPLEDTSNIESTVLPKSGHEVQSIVWKPPRSSKPLVEPTTVQSVIVSL
FT                   HQPGTINNSSEDDLTDTSSSNSSPEANESLALASLKNMTQISRGLTKRIVSKLIPDIKS
FT                   KRSRHSIMATGNEHPRNDTYEDIEDIRKVDCHSTGTNITFLKPTFRSMDAEHYNPPDTV
FT                   SSHGSAGTDSRRESLMFEKKSVLLDDFAKKKSNVNKYIKEKSLVDSLIHLDNPSVCFSG
FT                   EVATMLIPDRWKDVYPKYVAKKYTKWRSFTTPAELPITTVHFPSLSDFESNFIFRNHSV
FT                   SLNIDREVYGQTTFDLLRDMIYIRLLAGFQICTSELLKKVEATGSNEIHEQEIAKVLSK
FT                   DNYMVAIYYMIIDNEVHRIKCGYNGTIDVQRFLRKNENKMMDTIAKYTPLVRTRYEHSY
FT                   RPCKMDPLRISRTSLRWNQVDQILAGYYDSMMDSSKIGFRSKFVILPADIPPNTFSSTV
FT                   NGRKETLSAEEIRLEGLRKLISSISKSRLRTNPEKATKASRKEEILPEVHFYTGSLFEY
FT                   LADHHDNLEHVDSPAKDAQSADLSKFNRDAELSRLAYELQHGEKPIKLTNRKWHFKNHS
FT                   SCFVGLEMVNWLIENFSDIDTRDEAVIYGQQLLTDGLFHHVDRRHGFLDGHYFYRISDP
FT                   FVDIKIEKGSAESPLNSDPITINRRVSASTIISSKQNSSGMIQSKNGDSELLDRQSVND
FT                   EGKTIVISTAIDIDLDPAGNSHKLETCTVHYDQVHNPDHCFHIRIEWLTATPKLLDDLV
FT                   TNWGRLCERYGLRLVEIPWHELCTIPSFDPTHSFIEATLAINPWTDPEFMDAEIFASQK
FT                   YFYHVHLLESFGFLLDNRASRILQNERVSFNVVYSWGKPSFKYAQFIHNTGAYMAEIRE
FT                   NGDLFLAPNNLYLSRNGIGNSSGSLHLGPKSAIYSEKVMLDFKHVCEDYKKLRSVFWEA
FT                   RDKWQQTRNTLEEY"
FT   CDS_pept        complement(254945..255790)
FT                   /codon_start=1
FT                   /gene_family="HOG000165630" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625568"
FT                   /locus_tag="ABL078C"
FT                   /orf_name="AGOS_ABL078C"
FT                   /product="ABL078Cp"
FT                   /protein_id="AAS50693.1"
FT                   /db_xref="HOGENOM:HBG211782"
FT                   /db_xref="HOGENOM:HBG738415"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR007198"
FT                   /db_xref="UniParc:UPI00002525BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV1"
FT                   /transl_table=1
FT                   /translation="MQLYICHRDRDQTQVPSAGGSVKEAIRMVLEATVLVVDNSEYSRN
FT                   GDFPKTRFEAQIDAVEFIFQAKRSSNPENTVGLISAAGSSPRVLSTFTAEFGKILAGLH
FT                   DTTVGGSIHLSTAIQIAALTLKHRQNKVQHQRIVVFVCSPISDEREELVRLAKKLKKNH
FT                   IAVDIVNFGEEAANTAILEEFVAAVNNSQEDNSHLLTVSPGPRLLYEHIASSPIVLEEG
FT                   ATAPGMGAFGGDDYMDFAVDPSMDPELAMALRLSMEEEQARQERLRQEQDAKGKSEEQH
FT                   "
FT   CDS_pept        256308..260621
FT                   /codon_start=1
FT                   /gene_family="HOG000167149" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762515"
FT                   /locus_tag="AGOS_ABL077W"
FT                   /product="ABL077Wp"
FT                   /function="FMN binding"
FT                   /function="heme binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50694.2"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG460127"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI0001DB2720"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DV0"
FT                   /transl_table=1
FT                   /translation="MLALKENLLSVGSAPDNWGDWTLAAALVRGAADGTVFYTARAKAS
FT                   RPLVAVAAEQQGVHAIRLLAANDPFCAVTAEAGDSVPATVFTDLATVITGAPHLATVKT
FT                   PIVVHIETLAEEYAAIPGFKDLGSVILVSSSPSQLLRAASTATKLAQASQRPVLHFYTS
FT                   DLNGFGEVDVGTADGTFDSTIEDAPERILDSLQSRLVSRGTPSTLILNLSAYGEQFAQY
FT                   LPDDVALYDITVYKPFEFSQVLRELPVSVKNIAVVQGSTGGSKSNGFEPILLDVFSDFN
FT                   LLVDRGIKNIVVSGIGRLQYFAHTLEKIVSNSRSLSPSTDLYISDVKHAVHSGIAEEFI
FT                   KKAISLENAYLSVLQQVFEPNLQLLNQFNDSAINSLRPEYGFGKFLQQNRARRQLMKMV
FT                   ERSLDCSLYEYEGPSVVEGLAAWISYNKRALDSSLLKEANILARDVHELLQKNSNSEVA
FT                   KSILASAPTLDSFSFSSSWLIGSDAWSYDLGNSGVHHAITSRENINILLIDSEPYGSLS
FT                   KNSARKKDVGLYAMNFGTAYVASVAVYSSYTQLLTAVVEASRFPGPSIVLAYLPYNSEQ
FT                   DSPLTILKETKRAVESGYWPLYRYNPTASNEEDTFKLDSSVLRRQLQEFLDRENKLTLL
FT                   AKRYPDLSSNIVQSQSDIITAKQQRKSKEAYDQLLQGLSGPPLSVYYASDGGNAASLAK
FT                   ILAKKATTRGLKSFALSMDDIVLEDLPREQNVVFITSTGGQGEFPQDGKAFWEELKSAT
FT                   DLDLASVKFSVFGLGDSQYWPRKEDERYYNKPGKDLYNKLLLFSGQTLIPLGLGDDQDP
FT                   DGYRTGYEKWESELWAALGVSDIITGEEPKLITNEDIKLASNFLRGTIAEALVDDSTGS
FT                   IPSTDQQLTKFHGIYMQDDRDIRDVRKAQGLEPYYIFMIRARLPGGIARPEQYLALDKI
FT                   AASFGNNTIKLTTRATFQLHGVVKRNLKSSIRAMNSTLLDTLAACGDVNRNVMVSALPA
FT                   NARVHEQVANVAAEISEELLPNTTAYHEIWLEGPDRNDASPEWQAIWEGMKSGPKKKVL
FT                   VGGNALQDIEPIYGPTYLPRKFKVNIAVPPYNDVDVWACDVGLIAIIDETTSNLVGFNV
FT                   YVGGGMGTTHNNKKTYPRLGSSFGFAPKEDITSVVEKILLVQRDHGDRTNRKHARLKYT
FT                   IDDMGIDIYRQKVEELWGDKFAPERSYKIESNIDYFGWVKDETGMNHFTAFIENGRIED
FT                   SSKLSHKTGLRKVAEYMKQSGSGHFRLTGNQHIVISAIPDQHLDAIKGILKAYKLDNYS
FT                   FSGLRLASSACVAFPTCGLAMAESERYLPQLISRLEESLEEYGLRHDSVVMRMSGCPNG
FT                   CSRPWVAEVACVGKAPGTYNLLLGGGYYGQRLNKLYRSSLKEAEILSILRPLFKRWSLE
FT                   REESEHFGDFLIRVGVIKPTLEGRKFHDDLPDGAI"
FT   CDS_pept        260864..261778
FT                   /codon_start=1
FT                   /gene_family="HOG000066115" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625569"
FT                   /gene_name="AIM18"
FT                   /gene_synonym="FMP22"
FT                   /locus_tag="ABL076W"
FT                   /product="Altered inheritance of mitochondria protein 18,
FT                   mitochondrial"
FT                   /function="intramolecular lyase activity"
FT                   /biological_process="cellular modified amino acid
FT                   biosynthetic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50695.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016872"
FT                   /db_xref="GO:0042398"
FT                   /db_xref="HOGENOM:HBG124395"
FT                   /db_xref="HOGENOM:HBG396892"
FT                   /db_xref="InterPro:IPR003466"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniParc:UPI00002525BC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DU9"
FT                   /transl_table=1
FT                   /translation="MLNKRISNLATILRFIALPRARNIIAPQEYIANSVPVAITRRAAR
FT                   NTFVFSVALTPFVLYSAFHNDSAESDFPELVEVYPGVRPFPAVLGPPELPLQTNYKLLG
FT                   HGVRAVTFLSFKVYALGIYAAVDDLPLIPRTLSAEYLSTLDTEKVDAPAKEQLYKAMQD
FT                   HEKSRAVVNDLLGKGLRLVAKITPIRNTDFTHLKDGLVKSILNHPAARHEGETLANGLE
FT                   ELRAAFTRRGSVPKDDDLVLELQATGALQLYHRDAKTGQTTTLGKVTEPLIGRYLFSQY
FT                   LSGKAPLSKDTKDSVTRKIISMV"
FT   transit_peptide 260864..260989
FT                   /gene_name="AIM18"
FT                   /locus_tag="ABL076W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DU9 "
FT   mat_peptide     260990..261775
FT                   /gene_name="AIM18"
FT                   /locus_tag="ABL076W"
FT                   /product="Altered inheritance of mitochondria protein 18,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DU9 "
FT   CDS_pept        262000..263283
FT                   /codon_start=1
FT                   /gene_family="HOG000066090" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15762516"
FT                   /locus_tag="ABL075W"
FT                   /orf_name="AGOS_ABL075W"
FT                   /product="ABL075Wp"
FT                   /protein_id="AAS50696.1"
FT                   /db_xref="HOGENOM:HBG124037"
FT                   /db_xref="InterPro:IPR018870"
FT                   /db_xref="UniParc:UPI00002525BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU8"
FT                   /transl_table=1
FT                   /translation="MPDNTSSLLHFTTAVEQSPDYTPTDDELLQVCHVFAAGTPISKEE
FT                   LHKAAQYLAYYSMSERVKQSTIDQCIQIFKEIMTDELLDHLIQQLQPMLLRTNNSRTTA
FT                   AGRFKKETATKLKPQLGFGIENENAVSAWKRSGGLRSIPLFYVVLSVLKHESISSNLWW
FT                   ISPGILNLLDESDDIEKVKLPAVKLLRRFLECTIDVSDAVHFSFAATGLFAVYQPILVG
FT                   LCHQIPPIIEARQSQIIWNTAYPTILALYRVQYANEGPEYKAELGQIFSELVLQLALPK
FT                   VSMDHLELTNTLLDYTIQTLELLGAFSVRYLQRSIYVLGEYIVRNPFLTLFPPLVEKTL
FT                   DTLAKLAEVCPPERVCAHRYDFLACLLITYEKCSTEDVLPDSTLDRIHRLAQLLRAAGC
FT                   DFARDRVTLLERNPDFERVLDRIEQRYK"
FT   CDS_pept        complement(263313..263576)
FT                   /codon_start=1
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778124"
FT                   /gene_name="TIM8"
FT                   /locus_tag="ABL074C"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM8"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="AAS50697.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00002525BE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DU7"
FT                   /transl_table=1
FT                   /translation="MSGISPTELQNLDEPSKKEIMGFLETENSKQKVQMSIHQFTNLCF
FT                   KNCIHSVQSADLSAQENQCLKDCVNRFLDTNIRIVKGLQSIQ"
FT   CDS_pept        263837..264571
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763562"
FT                   /locus_tag="AGOS_ABL073W"
FT                   /product="ABL073Wp"
FT                   /protein_id="AAS50698.2"
FT                   /db_xref="HOGENOM:HBG124044"
FT                   /db_xref="UniParc:UPI0001DB2721"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU6"
FT                   /transl_table=1
FT                   /translation="MDKDVSRGQEDITNGPLDQDQTGVADPLEQQLRQELENKRFFLEQ
FT                   AERALQNLDIEALEAEGNVNAEAWNKLLETQLFIPERSDPLGIAVAIDGETKAVNSGAG
FT                   AVLSRQIEELEEMVQDQRKLCDDMQALNSILKKRVNASFVQEEATETPCSSEEVEQIKD
FT                   SFLSEFLVPDLCRDASDWPATNTAMEDVLRRLVKLDPQLRLTDFAPHCMGLYRMLSKAN
FT                   VIQEIFTDGHDNPYIRLYNLLE"
FT   CDS_pept        complement(264577..266871)
FT                   /codon_start=1
FT                   /gene_family="HOG000154134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763563"
FT                   /gene_name="RIX1"
FT                   /locus_tag="ABL072C"
FT                   /product="Pre-rRNA-processing protein RIX1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50699.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058123"
FT                   /db_xref="HOGENOM:HBG203822"
FT                   /db_xref="UniParc:UPI0001DB2722"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DU5"
FT                   /transl_table=1
FT                   /translation="MTSQVVPLSTFVQHLESCEGYEFRTMIKMLASPAYAKQQLLKDEL
FT                   SVFMAKVLKLLRSKDDYQVWKGCHIATVFCTYNPVVLCSFGGELMGILYRALEDATKYY
FT                   GDSVQTEQRKVMVRALVKTLDTLMDLIRGKPSLTREALTPHLSAIIPMLISFGRCEPNL
FT                   SLPVIKKLLSKHSTTFRPHVGKLKQLLTELYGHYQSLDPVTRKVVCDTAAYLHLTQKPG
FT                   NNANEHQAHHKSFPDEHWRAGLFSVLSQFGPVVRLWGEILDIGSDENLARLLETLPRDT
FT                   ANDTSPLLPALTVDINKPVTLWHISARLEQLTDMVESFIRLPTLFPTRIPLGELVKVSE
FT                   ILLSLTTNYLPLKRGLRRDAALTGSIRSALPETQLQGIRLLRCLSDHIGKNLITYMPAI
FT                   LSSMELFIPLKDKKTSIDYQKCVDLQNGLLQLTALMNSIAQHLGHKVEEMSLAIKLVDI
FT                   CAYIIEHKQNLDSAFSSTSGTAKAAGGAKKKEYKAKTGSMSDLFSHPHKFLHPVPLENY
FT                   TVVNTYYNMALTHWKLPSTQQAKITKYCIYYSLSFKEKLGYIPQTFIELLNTIVLFPGK
FT                   DRFSILPIAVHLLKETGDPVFDVLCNPKLPLEMIQIRRQPTSSEDDTATSEAEEYAAPA
FT                   DQDDEHLSDDEHTTVDDGVATNAVMGLNNLVSSETLRSEQDSALETQHPEQARTSNLVP
FT                   DEASEGREDARIFKKRSSSDEQDPPSKRTRAVAAQTPVPAAVPVDNGEPESDDGSDFEI
FT                   PEIELSDADEE"
FT   CDS_pept        267098..269089
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763564"
FT                   /locus_tag="ABL071W"
FT                   /orf_name="AGOS_ABL071W"
FT                   /product="ABL071Wp"
FT                   /protein_id="AAS50700.1"
FT                   /db_xref="HOGENOM:HBG058125"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="UniParc:UPI00002525C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU4"
FT                   /transl_table=1
FT                   /translation="MSSPRKLSLEQRLSLATKATQKRRLKKSSPALTAGSDATGEDSIS
FT                   SPVDEREGQKPSRPANDTSSAEASVAHAHNGIPAPFTEVFPNGLEGKDMETVLAELAPH
FT                   FQRLRAMSPTTRIDAQPHREISTDSSLLLLVKEKDARIEELLEEQQETSAKERRATQAL
FT                   SKMEKKYNKQVAESAALEQKLRKQASENVLLKEEKDKAKAELKACRADYQQMKDACSAA
FT                   DSRYASLTHEQEALQCQLEDCEKEVLAARTGFETSKANWEKKEKELNARYNSLRKSSND
FT                   EITRLEGVMERLRLEAEDSRDIRVRKQDDNPVHAESEYQSLLRQLEDQQRQAVISRENW
FT                   SSIEYSMNQKIEELQTQLEEIQSSCAVLETRLGAADEERRRLVMELDRLGRENAKLKEA
FT                   SGILELDYKKATNNLKKLEEDHRLLAEKYKIQKLNLESRLGGKREVLQDKESLGENLLL
FT                   PTSAEIKDAFQSLNGQQGMSAQSIATGHYESGLSSNYDFDMPVDETLSQTAEISGDDLP
FT                   EDSTSDARKTTTDFRSTISADQAGISAQMHVNAHIVNKLGAEVRRLELEISTLKAFNNT
FT                   LEEEKARAEDDILKLLEENHTVHHLKTTNEALTTKVADYSNRQDTILQLLGEKTERVEE
FT                   LENDVEDLKQMLRMQAQQLADMQERLRI"
FT   CDS_pept        complement(269197..269826)
FT                   /codon_start=1
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931362"
FT                   /locus_tag="AGOS_ABL070C"
FT                   /product="ABL070Cp"
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="AAS50701.2"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG507301"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI0001DB2723"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU3"
FT                   /transl_table=1
FT                   /translation="MSASDKMYMSYNNIHKLCQQVAGQIMERGDRPDVIIAITGGGMIP
FT                   ARIIRSFLKVKGQKNIPIQAIGLSLYEDLGLEDGTESIGKEVIRTQWLDFGALDKHFDS
FT                   LIGKKVLIVDEVDDTRTTLHYAVTELEKEVKEQQLKLNRMDEETIFSIFVLHNKDKPKK
FT                   AELPASIMATGRYLAAETVPDRWLCYPWEAIDIEEHTRLSIEQGNN"
FT   CDS_pept        complement(270103..271728)
FT                   /codon_start=1
FT                   /gene_family="HOG000000891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763565"
FT                   /locus_tag="AGOS_ABL069C"
FT                   /product="ABL069Cp"
FT                   /protein_id="AAS50702.2"
FT                   /db_xref="HOGENOM:HBG058126"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB272E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU2"
FT                   /transl_table=1
FT                   /translation="MTASEDTKLLASFSPDATRFAFQANASQKNFIDIYPLDPERNYTV
FT                   NSSSVNRIDFEATDLNLTDVVFQSWCLANSGQDISTKTKRRRGTGEDDEEQELSSTESF
FT                   LINVFQQGKIVVFSPNGQDILNIIQNKRELLGIDTIGTSLWILDDDKTVKHFTCTSTKP
FT                   IKTFHLVDGKDEDILDFGLLNFPDVLLISVIVEDIVYIIDPTKRRPSTVAKLEVPGCRT
FT                   CKVLDDEHVVVAGANSISVIKFKEQSIIHTWELGAKKIDIVDGNIVALGEDGNISVFNA
FT                   QNPNDVLTVRVENNSIIEFGGIGDRNLVVAWLNVNEPNFEIITSAQLASGQNIVLQQAP
FT                   QPLLTNHAPDTQVPEQEAAEREKPPSKKTSKTEQDDTSQALIHALATTLDEKVVTELLI
FT                   SNTWSEDRIKEFVHMHLLPSRSNELFVIVSQLLASDVWAESSAIRWWFKWLLRLRAPHL
FT                   DALQPRGNKEIKALRANLKASSDSLPILLSMQGALEMLRAQAKLRQELSQVALEDADDA
FT                   EYGSEITYANGEADDFVDALDYKK"
FT   CDS_pept        complement(271947..275072)
FT                   /codon_start=1
FT                   /gene_family="HOG000248078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763566"
FT                   /locus_tag="AGOS_ABL068C"
FT                   /product="ABL068Cp"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="AAS50703.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG059555"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB272F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU1"
FT                   /transl_table=1
FT                   /translation="MDLSILLQCFSGTLSHDAAVRSNAEKRLKEYSGHIGFLGACLDIM
FT                   GSSEVSENIKLSASLYFKNKITYGWSGKGHGKNELLEYTVDPDERPVVRELLVKALTNC
FT                   SQQAPSCMRVLQLALAEIVSVEYPAGRWDGLLEASFGSLASGDMHAAHVGLLCAMEVFR
FT                   TYRWKENDERQELEMLIMRYFPDLLHYANALLYSEEKHNEIVGNMLKLVLKIYKFVTYN
FT                   DLPFTLQRSENFIPWANFHVSVIQSQLPEHVMALAVDDRRAHPWVRAKKWAYANMYRLF
FT                   QRYASESLSKKFEYTEFKMLYVEQFLPQLLQLHFQQIERWGAGELWLSKESLYYILEFI
FT                   EQTVVQKSTWPIVDPHYATILEHVIFPLLCPSEETLESFEVDPQEYVHRNLEAWDADYS
FT                   PDVAAVSLLVTAVKKRSKTTLEPTVQFVSQMLQHNTVSFADMTLEQAVKVESCLRIVSS
FT                   ILDRLFHAKSPYTSEMEGFLTRFVFPLFHSKYGFLRARVCEVCSKLDSNMLKQKETLQT
FT                   IYQGVVKCFNEEPGSLPVQLLAALALQAFINIPDFHSSLSAIVVPTMQKLLQLSSEFES
FT                   DTISGVMQQFVESFATELQPFGVELMNNLVQQFLKLAIEFHEASNFDINGFSTGELPDE
FT                   SDKHMAALGILSTTISILLSFENSGDIVKNLEQSFYPAAEFILKNYIEDFYREACEFVE
FT                   NSTFLLREITPISWKILELIGECNEKEGSMVSFYLEDFMLAINNYIIYGKNELKQNSFY
FT                   STILFKIYAKAITVEDNGFTELKQLYDLSQKMVLSLGETTSKEYVNQFLTDAVNSIISE
FT                   KDSLEKCIAFGVTTFGVILSCLLYFPYDTLQFLHSKNVSLLYFQIWFDNYIPSYKRVYD
FT                   IKLSLMALLSMLSHLSVEQFASCGLEPVLKKMGSTISGLFERYPVAIKELKDKRAEFTS
FT                   DADFGEGLIDSDWDDEIGEDGLENEQNYLEMLRNETDVVKFINGEPSCLEEDMDDLEED
FT                   PLSGSVLDDINVYAIFQTVFSTLQQNDSTKYQLVLENMSQDEQMHLAHITSL"
FT   CDS_pept        complement(275273..275926)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625835"
FT                   /locus_tag="AGOS_ABL067C"
FT                   /product="ABL067Cp"
FT                   /protein_id="AAS50704.2"
FT                   /db_xref="HOGENOM:HBG058127"
FT                   /db_xref="UniParc:UPI0001DB2730"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DU0"
FT                   /transl_table=1
FT                   /translation="MSSGSALIGFTLRRLSACATIRTPLLGVDIVRLAALLVTAGVITM
FT                   WLWFCGQCSASCTLFLLLAAYRLWEEGYLPVWQPAPALPLPPPTTTKARTCEGNSAHAS
FT                   EVRRALLQFRRESAVPLVDIQAKRPRSPRLPASTCTAPAHRTRAKRVRDRCADSSTFRL
FT                   QADTAPRAAAARSVHVQPCFGVQLLCIPPSFSDSACKATLSNVRASAQPFIYRH"
FT   CDS_pept        complement(276108..277808)
FT                   /codon_start=1
FT                   /gene_family="HOG000181687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763567"
FT                   /locus_tag="ABL066C"
FT                   /orf_name="AGOS_ABL066C"
FT                   /product="ABL066Cp"
FT                   /biological_process="mitochondrion organization "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50705.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0007005"
FT                   /db_xref="HOGENOM:HBG056390"
FT                   /db_xref="HOGENOM:HBG737392"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniParc:UPI00002525C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT9"
FT                   /transl_table=1
FT                   /translation="MGLPLIIRTSAARHCRYVGIARLGLPRWTPFKAVFPALGCQPVRR
FT                   TLAGPARGPEEHEQTLRAARAAKRDQLLAQTPSSWERLRIRIKWALARSTKPFNSDDIS
FT                   AFVSWILVSHALLIILGTTTFASLVIYLMNTVLAQEYVATQVGNFLTKNTALTVVFENA
FT                   IVPDWSSGKITFNKVFVSRRPKQLQGFSKGSQHEAVERAKLALSERLLVSGEEFDDGNY
FT                   TQFDLTIDQVEISLNFGKWINGKGILDEVTINGLRGVVDRTHVMWKDGDDPRKYLNVHQ
FT                   PGDFEISTFRMNDVLFTLYQPGRFRPFQVSVFNCELPQLRKHWLFFDILNAHSMSGTYD
FT                   NAMFMIHRRYKEDQSSESPLWRKFTRMRVDNLNVDHLNAGMKGPFGWITSGKVDMIGDI
FT                   LLPEEGLDGSDLSDMLAIIGDRLLKEARRHSDILPFQMPDPGDIDPHNYFVMDFFLRLH
FT                   NVRAEVPLFTPELSYINNALIRPIVGYINSKRSYIPIQCRVVKNLADFEGSWTIYDSKL
FT                   MDDLSAEVYDAFADYVADQERKNLRMKRVGFWSLHIIIQLILMSLGAIA"
FT   CDS_pept        278526..281291
FT                   /codon_start=1
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931363"
FT                   /gene_name="TIF32"
FT                   /locus_tag="ABL065W"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit A"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50706.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG028011"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00002525C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DT8"
FT                   /transl_table=1
FT                   /translation="MAPPVLRPENALKRADELISVGEPQAALQSLLDYITSRRIRFADP
FT                   AAIEPIVFKFLELGVELKRGKVIKDGLYQYRKHVQSSTEGLKSVGAVSRRFIDLIEKKM
FT                   SSEQAKANAEESTEEDLEGGVTPENLLISVYEQDQSVGGFNDEAVTSWLRFTWESYRTV
FT                   LDLLRNNSQLEITYSGVVNRAMQFCLKYNRKNEFKRLADMLRQHLDAANYQQQKSKQYT
FT                   VDLSDPDTLQRYLDQRILQVNVSVKLGLWHEAFRSIEDVHHLLSMSTRDPKPSVLANYY
FT                   QNMAKVFFVSSNYLLNSVALQKFYDLYQQNPKATDEDFKFYASQLVLSALSIQQDDLPV
FT                   VGYDPLARLAGFLNLESKPTRSQVIEAVSDSKIFSRADEPVKKLYELLNSDFDVNTLKE
FT                   SLASLLPELNSKSYFTQYVEPLKSFTIRKAFISASKQFGSIKLDELFEHTSLPSPFDLS
FT                   PLDLEKSLLQAAMNDYVSFSIDHDAGVVSFMEDPFELLGGSTATNADDEQRNDDGYEET
FT                   HVEEEPEPILTRNSAVRTQLIELAKALKETEGFPHASYVDKVRMARNELIRQNNAIIAS
FT                   EKEAAEERARQLEYEKQSASGVPLTAEQVVEERQRRMKEEKEAAEARMEAEARRRAEEK
FT                   RERELAAINEKTMLKMIEDINAKGLIFIDPKEAKNMTLEKFKKLTVELVSKDKKDLDER
FT                   MSHAFKRVDHIERAYRKLEAPLWEKDAQKQKERDLESYNKLKQMMVEKAKKDHEENLRI
FT                   HDRLVKIYPSYLHFREKVIAAQKSQIEALRAENAAKLEAAKNARLQEVRQQRYNELIAR
FT                   RKEELAAKEHDDRQRMLQDRLTKERKERERVNKEKDEAARKQREIEEAVERTIKRNVSA
FT                   TPAPPVRSAPPARAAPPPRASNEQVASPAPQPEKKLTYAEKMKLRRAGRA"
FT   CDS_pept        281605..282195
FT                   /codon_start=1
FT                   /gene_family="HOG000199421" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763568"
FT                   /locus_tag="ABL064W"
FT                   /orf_name="AGOS_ABL064W"
FT                   /product="ABL064Wp"
FT                   /function="glycolipid binding"
FT                   /function="glycolipid transporter activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50707.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017089"
FT                   /db_xref="GO:0051861"
FT                   /db_xref="HOGENOM:HBG380993"
FT                   /db_xref="HOGENOM:HBG713459"
FT                   /db_xref="InterPro:IPR014830"
FT                   /db_xref="UniParc:UPI00002525C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT7"
FT                   /transl_table=1
FT                   /translation="MSTFFDQFKTSFTNAPVDSSGNISTTEFLEASEGLVKLFDLLGNT
FT                   AFTVVQKDLTGNITKLRNRQLSHPGESATLQELVIAERAQGSKTASEGLLWLTRGLQFT
FT                   AQALRETLDHPELELSKTFTDAYGKTLTKHHGMLVRPVFKLAMKACPYRKDFFAKLGSD
FT                   QEKVDTQLKQWLAALEKIVEILLQFLAQTCKDL"
FT   CDS_pept        join(complement(283781..283841),complement(282554..283713))
FT                   /codon_start=1
FT                   /gene_family="HOG000093252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763569"
FT                   /locus_tag="AGOS_ABL063C"
FT                   /product="ABL063Cp"
FT                   /protein_id="AAS50708.2"
FT                   /db_xref="HOGENOM:HBG429547"
FT                   /db_xref="UniParc:UPI0001DB2731"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT6"
FT                   /transl_table=1
FT                   /translation="MQYKTGLTSVLVLAAGVSAQSNSCSVSSGATATAQADLDKYSSCK
FT                   KLSGDLVISGKQLSNGALANVEEIDGSLSIIDSSTIVNFSADKLRKIKDSLKLMDLPSL
FT                   EAASFGALEEVSMVQFQALPVVNNIVTSKLKTANDIVISNTNLRSIKEFTSLGAVQKFD
FT                   VNNNRYLRSIDASIKTVGNSLALSSNDKIENITFNNLVWANNITLYSVRDISMKALVAV
FT                   NHSLAVESCPMKSLELSNLTKVGGDVTFANNEHLTKIDLSKVEEITGALVIADNEKLDR
FT                   INGFKSVKSIGGSLTVNGSFSELDLSELGSVRGGVSVNSKAKNFSCNPLDDLHKAKNIQ
FT                   GKYQCSTGKSDDSSSSSGSSGSSSGGKGDSGSSTKGSPATSKDIGAHLTPGASLMGAFA
FT                   AVAIALL"
FT   CDS_pept        complement(283946..284428)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931364"
FT                   /locus_tag="ABL062C"
FT                   /orf_name="AGOS_ABL062C"
FT                   /product="ABL062Cp"
FT                   /protein_id="AAS50709.1"
FT                   /db_xref="HOGENOM:HBG058128"
FT                   /db_xref="UniParc:UPI00002525CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT5"
FT                   /transl_table=1
FT                   /translation="MLITKSLFWLPGGPAAAEPPPDSLYFLSKSILYWPAWCINRRGGA
FT                   ARQPVPDPANRFVLPLRLAVPTPAPSYLCKSPACNSTIARSDVCLHLASLPFSARCACI
FT                   SPRREWLAPRGLRPAFPPKAERKNFVSSREYRAASHGHICWLARFFYLKKAVKATG"
FT   CDS_pept        complement(284547..284738)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082735"
FT                   /locus_tag="AGOS_ABL061CA"
FT                   /product="ABL061C-Ap"
FT                   /protein_id="ABL67021.1"
FT                   /db_xref="UniParc:UPI0000EA236B"
FT                   /db_xref="UniProtKB/TrEMBL:A0ZVR3"
FT                   /transl_table=1
FT                   /translation="MKFTNYAIALTAAAYASAQATTHDSNHTANTTSHHSTNAAGALNG
FT                   VLPSVAGAAIAGALAFLV"
FT   CDS_pept        complement(285219..286403)
FT                   /codon_start=1
FT                   /gene_family="HOG000159915" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI18931365"
FT                   /locus_tag="ABL061C"
FT                   /orf_name="AGOS_ABL061C"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme "
FT                   /EC_number="4.1.1.50"
FT                   /function="adenosylmethionine decarboxylase activity "
FT                   /biological_process="spermidine biosynthetic process "
FT                   /biological_process="spermine biosynthetic process "
FT                   /protein_id="AAS50710.1"
FT                   /db_xref="GO:0004014"
FT                   /db_xref="GO:0006597"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG436692"
FT                   /db_xref="HOGENOM:HBG610629"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="InterPro:IPR018167"
FT                   /db_xref="UniParc:UPI00002525CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E84"
FT                   /transl_table=1
FT                   /translation="MPATSLDLSDHSYLDSALSATLDSTDAFEGPEKLLEVWFYPSVSA
FT                   LPNAKGLRSISLDEWCSMLELVKCEVLSSKKTAHMDAFLLSESSMFVFEHKLTLKTCGT
FT                   TTTLLCLPRLLAMVESHLGWVMKSPGSDKFHPYKVFYSRRCFMFPSKQHPIHRNWGDEV
FT                   DYLNQFFLGGKSYVIGRSDQNDHWNLYITETNKTLASGLTSDERDETLEILMTGLDSGS
FT                   ARQFVADRTQSPSEEGLAACNAPGHVYGLEITKATGLDCVYDNQKSVPFVHDAFAFMPC
FT                   GYSSNIIMDDKYYYTLHVTPEDGWSYASFESNVPVQDVSCGRQTQHDIVCRILDVFRPT
FT                   DFCMTFFAKDLLSDRILQLMHLLDSLPNYVKRDKVIHELDEYQLIYLRYQRPAQ"
FT   ncRNA           complement(286717..286792)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR86"
FT                   /product="AgSNR86"
FT   CDS_pept        complement(286811..287419)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763570"
FT                   /locus_tag="ABL060C"
FT                   /orf_name="AGOS_ABL060C"
FT                   /product="ABL060Cp"
FT                   /protein_id="AAS50711.1"
FT                   /db_xref="HOGENOM:HBG058130"
FT                   /db_xref="UniParc:UPI00002525CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E83"
FT                   /transl_table=1
FT                   /translation="MAMPYSLPCVCIGKFFMYKSRQPISSKLLFSKRPLTRSPSQGYIA
FT                   LRAPTAAGSFVRFRTSFVLQTSSAVFPGGIATAPRILMDIRPPGPPYAVPQPVCHVPRA
FT                   IEPWVKFFAQPVATSSGPRILRFHRCGRFLLVRGAGSGSRVACMTSVTAGYRRRSDVSP
FT                   TGPAAAADCSCCRARKRAATQRMVCWLVGQGFLPPGSGA"
FT   CDS_pept        287637..288251
FT                   /codon_start=1
FT                   /gene_family="HOG000200535" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625836"
FT                   /locus_tag="ABL059W"
FT                   /orf_name="AGOS_ABL059W"
FT                   /product="ABL059Wp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50712.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG519863"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="HSSP:1B7F"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00002525CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75E82"
FT                   /transl_table=1
FT                   /translation="MDQNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQ
FT                   EHQGFAFVELFSEADCDFAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKN
FT                   LDSTIDAVQLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNNQIV
FT                   ANQIISIDYAFKEGKAGEKHGDPVERLLDEEAQKHGVVKLT"
FT   CDS_pept        complement(288372..293018)
FT                   /codon_start=1
FT                   /gene_family="HOG000141962" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763571"
FT                   /locus_tag="AGOS_ABL058C"
FT                   /product="ABL058Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50713.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058131"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI0001DB2732"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT4"
FT                   /transl_table=1
FT                   /translation="MSFAVNTFQKYSNDFGLGSNGVKVTLNYFDALPPQDLLMSLPSGL
FT                   QLTLKSLLKRDDTTKERALNEIQELISTQASAEQFKDDIFCLCWSQIYAKLVTNSSKSI
FT                   RAGTHDFTARLIRLLHKKGAKFLKDWIPLLLVGCYDIDTSVGSSARSALLQCFNNSDEK
FT                   LAALWKVFYKQILACAQQILVVENVGSISDERYVSPEDADMRYSRLAASGVFLLVQLLK
FT                   NMNDEQGEEDTWYEILSSEALWKLMSLANLRSMKLYQVLLQLQRILLENGYLLGHKDVL
FT                   KLTGKRYFKTLAQVNTRNLLQISPLLPEVLETTLLWNSYKDGQIWAYDKSFKDRILNLL
FT                   KLGPGNSSAAYFDYLSKLFRVCEFLNAEETKLSILHKHALVFSERRILTKTSEEQLSRF
FT                   CSCYYQIVREIDSEVARDQMRDDSQKLISNISLQKHSNLVEAFAQITSPDSISTDLCSL
FT                   LPLGTDKEHPSTTYADNLLALLLHNGLQKVDILKELARSSLESIENGEVAVNYSFRIFQ
FT                   LFIKNNILSLHQEVQKFIGILPSTIDPSFIEQPTNIMSSYSRSQFLQQMGEEEAVELFS
FT                   DYVFAIAQLDIPMNSKLTHLNNLDIAILEKLRKEPSETLADFMTNFIGTYDFSTDLIFS
FT                   SNLLDQHVLKRLYEKALEHRKLDVFSSYLTRVPLTIYEEFLCGTDFLSNYNIWYSAAAA
FT                   QQVLKSLIPMVKRNGSFARKVTQEIVVHGASDYKHIPTELLIKFASELFESNSDIWSYL
FT                   SPHIMLKDLKTIVPYIDYRLSLVSPLGVGIHALDIPNESTFECSSARSIISYALFLDKF
FT                   LTNHPQLCDDDCRIFLALMSELTLDFNCFSTDPIDQFPGFTNSLFTGKTYDFNFADIVH
FT                   AIIAGESHIAILNKLASRDVSDSSAVYNCRILKRMLLNSIDYTTLNQFNEQVRIEKFIS
FT                   GIIRNTSSSAMDYLYATTIISACSKFSAESPMFVKLRTMLVAELIGKNSTDLVNGSWRL
FT                   LILLDNILQVETSIMHSDSFQPITPQRLVMFVRTIFQWLDSDVCFEESFSVVRLCLLHL
FT                   LISMLQINSIRSLGSSLTDLCIRILADSLGFCHLEETLYLDELRFYVLKLHLEIIRWTK
FT                   EDKNTKDLWEHSAKDLNSELVELCLINYEKTPENHPHILFCSLLSSSVDQIPESYLQSY
FT                   FDKFMEYLLSSLGTISSVRVVVTTLRKLIIAQQQELVIEYELQKSNLGDGDNTPTSTCK
FT                   IPPILVSALFADLPEEYLEYEEPMKVIKPLWYWYLVVSYFKNISYNIRHQYIDQLKANN
FT                   EIDRFFYFVSEQLDMQDTKFWDSVSPHEITEYQIHATGDSPYKDDILKESKLLLVSLLY
FT                   DLFNNVGAMTSAWWLNIKDRALRSKIDAFVTRYVSPILIDQELEQVSSKIPVLTAQDEN
FT                   LSIRINKITKEIKARYFIDDQNLEISFKLPCNYPLTNIQVQEGTRVGVSEQKWKSWILS
FT                   TQRVITGMNGSVVDSLELFTKNVRLQFADFEECAICYSILHVVDRKLPSKVCPTCSNRF
FT                   HGACLYKWFKSSGNNTCPLCRGEIPFRR"
FT   tRNA            complement(293129..293201)
FT                   /gene_name="tRNA-Ala"
FT   CDS_pept        293562..294266
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778389"
FT                   /locus_tag="ABL057W"
FT                   /orf_name="AGOS_ABL057W"
FT                   /product="ABL057Wp"
FT                   /protein_id="AAS50714.1"
FT                   /db_xref="HOGENOM:HBG347478"
FT                   /db_xref="HOGENOM:HBG749677"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR017447"
FT                   /db_xref="UniParc:UPI00002525CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT3"
FT                   /transl_table=1
FT                   /translation="MSKTITPEVHWAQRSHETDEDKNYVLLTLVIPDCEEPKLKLESTS
FT                   LEFSARSPGHTGEKDGHTYQLHIDFFKEIDPEKSQHRVANGQGYYLKLVKKELGKEYWP
FT                   RLTKEKLKYHYIKTDFDKWVDEDEQEEVPQAEEFGGMPFGGGMGGMGGMGGMGGMEGLE
FT                   ALQGLGGMGGMGGMGGMGGMGGMGGDAQAQLQQLMQQSGGFGGMDEEDEEEEDVEAEEE
FT                   TKDAAGTADKSA"
FT   CDS_pept        complement(294406..295296)
FT                   /codon_start=1
FT                   /gene_family="HOG000283048" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625837"
FT                   /locus_tag="ABL056C"
FT                   /orf_name="AGOS_ABL056C"
FT                   /product="ABL056Cp"
FT                   /function="carbohydrate binding"
FT                   /function="isomerase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50715.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG401999"
FT                   /db_xref="HOGENOM:HBG737737"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI00002525D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT2"
FT                   /transl_table=1
FT                   /translation="MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLS
FT                   DAAKLDGSKPVRGGIPLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQ
FT                   FGLGPELANEELTALWPFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLK
FT                   IDDVEDTMVSNLKNFKTYDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGR
FT                   PIHSVSRGNLPDVVVWNPWIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWS
FT                   GYQLLSKDTLKYQAV"
FT   CDS_pept        complement(295520..297130)
FT                   /codon_start=1
FT                   /gene_family="HOG000113229" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625838"
FT                   /locus_tag="ABL055C"
FT                   /orf_name="AGOS_ABL055C"
FT                   /product="ABL055Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50716.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123845"
FT                   /db_xref="HOGENOM:HBG202419"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016240"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00002525D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT1"
FT                   /transl_table=1
FT                   /translation="MSDKKLYDASNCVSEHMVLRKELYGEDYVGGERTVGTVITDAPVS
FT                   RSSLRSGDNSNELPTPTNSTFPVDVRNVSFKDLELHIPKKRAGNKWYPASELPPHKSRM
FT                   ERDFSNLPSTMEMDARGSRGNRVTSDYFSEGTASFPADVNGNRARVVSLPGIESEGDQQ
FT                   GSACVTHNNGEPTVLQDATGGSDAAATRNGMAEDKLTGFILPNLNSQLSWRLVKLVGSG
FT                   NFSDVYLYENTSASSTEEKFQQVAVKVTRYPAELQNPQARTATKYKEMLSRLESSLTRE
FT                   LAVLRSLDYPCIVKLYGINDCSFLESRRPLIDHINEPSLPSCKMIMSYCFGGDVLDVAK
FT                   RGLLPDWLLQRVFTELAHAVLYLHENLVIHRDLKLENVLLKYPLEQLLSMREDFSCNFI
FT                   ELADFGLCKRIRQNELCTTRCGSEDYISPEVLMGLPYDGRLCDTWALGVILYALLEDRL
FT                   PFDPLPLQGWRGNRPRSTAHRIARYEWRWLRLINNNHHAKVIVEKCLVTRQHRWSIKDI
FT                   TEADFVRTLAPKLKYLHRH"
FT   CDS_pept        complement(297705..298784)
FT                   /codon_start=1
FT                   /gene_family="HOG000224893" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082736"
FT                   /locus_tag="ABL054C"
FT                   /orf_name="AGOS_ABL054C"
FT                   /product="ABL054Cp"
FT                   /function="DNA binding"
FT                   /function="deoxyribonuclease IV (phage-T4-induced) activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50717.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008833"
FT                   /db_xref="HOGENOM:HBG298136"
FT                   /db_xref="HOGENOM:HBG565018"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniParc:UPI00002525D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DT0"
FT                   /transl_table=1
FT                   /translation="MGFVRCTASRYKFGAHVSGAGGISNSVVNAHRIGCNAFAMFLKSP
FT                   KQWVSKAYSAEEIKRFHDNCEELGYNPRTDVLPHGLYFINLANPDREKAEKAYGAFLDD
FT                   LQRCEQLGIGLYNFHPGSALKGEYDAQLRQLAMYINRAISETKFVKIVLENMAGHGNII
FT                   GSKLEDLRTVIDLVEQKDRVGVCVDTCHTFAAGYDIRSRAAFDSFWDKFRTTLGMQYLA
FT                   SMHINDSKAPLAANADRHELLGQGFLGLEAFRLIARSDFLQNIPIILETPQKEDDGYGE
FT                   EIKMLEWLEGVDDEAALQQEYKDKCAELQQRGAKSRQEFAAKFEKKKAKAEKATGSRKR
FT                   AAGQADIVSQMGRKAARKG"
FT   CDS_pept        299216..300532
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763572"
FT                   /locus_tag="ABL053W"
FT                   /orf_name="AGOS_ABL053W"
FT                   /product="ABL053Wp"
FT                   /protein_id="AAS50718.1"
FT                   /db_xref="HOGENOM:HBG058132"
FT                   /db_xref="UniParc:UPI00002525D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DS9"
FT                   /transl_table=1
FT                   /translation="MIISNKSDNESAAFTASIGQRGVAETLRGAAELAAKTDAEARVLG
FT                   GLDGVGGPLLNAASRVPRISFLLCDTDTGAVAAEPVPPQSALVAPQGAFSFTSPKLAKF
FT                   QECASPVVTVNRGFRYTIKEEEDLTSERKARKNFKLPEDIVFTGGFLRNTMLRYYDTEV
FT                   LRSSDKKYVPGQDGDQFAQTLKDVRQAEVLFENQSVEGLTPFLEAKAGSLGPEIRDFRT
FT                   IIALQRRQVEHQVSLQFGINPDQVEDKSDVFHFSIISRKCEHDDPAVNITSGWMHLIAT
FT                   YELALLLEFIFGDIDENIWANDELLSAEVANDPKKRYQSRMRSRYKGAIFITVYASRKL
FT                   NKNTPGFLEGNSSGEEEVAMDACAVGRKKAKIKIKRKTLRLKAAIYDQMLSYRIGVTGQ
FT                   PSHSLVKVDKLKWIIERSVEAYSWVNPSKAPAGGYKRLF"
FT   CDS_pept        complement(300587..301723)
FT                   /codon_start=1
FT                   /gene_family="HOG000193853" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763573"
FT                   /gene_name="FEN1"
FT                   /locus_tag="ABL052C"
FT                   /product="Flap endonuclease 1 "
FT                   /EC_number="3.1.-.-"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="exonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="nucleoplasm"
FT                   /protein_id="AAS50719.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0004527"
FT                   /db_xref="GO:0005654"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG008275"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniParc:UPI0001DB2733"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DS8"
FT                   /transl_table=1
FT                   /translation="MGIKGLNSIIQQQVPSAIRPREMKQFFGRRVAIDASMSLYQFLIA
FT                   VRQADGVQLASADGETTSHLMGMFYRTLRMVDHGLKPCYVFDGKPPVLKAHELDKRTER
FT                   RKETEQKLAELTEQAEIMKHERRLVKVEQWHVAEAKKLLGLMGIPYVDAPGEAEAQCAE
FT                   LAKKGKVFAAASEDMDTLCYRTPYLLRHLTFSEARKEPIHEIDTELVLQGLGLSQEQLV
FT                   DLGIMLGCDYCESIKGVGPVTALKLIKEHGSLENIVEFISSGGNAKWKVPENWPYKEAR
FT                   ALFLQPDVLDAEGVSLKWEEPKEEELIAFMCKEKGFNEDRIKSGIQKLRKGLKGGVQGR
FT                   LDSFFKVKPKTTEQLAASARKAQAAKKTNQKGKVLKRR"
FT   CDS_pept        302204..303418
FT                   /codon_start=1
FT                   /gene_family="HOG000142340" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763574"
FT                   /locus_tag="AGOS_ABL051W"
FT                   /product="ABL051Wp"
FT                   /function="DNA binding"
FT                   /biological_process="chromatin remodeling"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50720.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="HOGENOM:HBG058133"
FT                   /db_xref="InterPro:IPR006774"
FT                   /db_xref="UniParc:UPI0001DB2734"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR8"
FT                   /transl_table=1
FT                   /translation="MSLYEYKHPIINKKLASTDERKSFPTLESWYDVVNDYEFQARCPI
FT                   ILKNSHRNKHFTFACHLKTCPFKVLLSYSGGAGGAHVGSVGAQSDKDVDDEKKVSVEDD
FT                   VTAAIAAAVAAVANTGGGTGEESVKGPFTVTKIEPYHNHPLESNLSLFKFVLTKIPKIL
FT                   QNDLKFDSILETLCNEDDNTVAKFRVSQYVDESGILEIIKERYGLTDQELDKKLLAQIA
FT                   RRITTYKARFVLKRKKQGPYAIAQSHGMSGEDDDDVSVPEHVHHHVHHVHASEVAAAAA
FT                   AVNEVNKHSLEDADEHPRKKVRSNKISNAVKMGTRSTLVTDHSQHETSTAGVGEDDVGD
FT                   DGVHHSHHKEMSPHDEMAEQLRLLSSHLKEVEAQEHGNVDVDVDPEIKKDDLADENIQP
FT                   ELRGQ"
FT   CDS_pept        303680..305440
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763575"
FT                   /gene_name="ATP25"
FT                   /locus_tag="ABL050W"
FT                   /product="ATPase synthesis protein 25, mitochondrial "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50721.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG058134"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniParc:UPI0001DB2735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DR7"
FT                   /transl_table=1
FT                   /translation="MLRAGRYSKASSVLRAVGGKRPSVCMASRVLTRLYSNGKEDDQVA
FT                   SSSSPSSKPWYLQGTGKPEIDVTSPFVGKIKLPATPVPDTVVNVTEYMRDKLGVTDITC
FT                   FNTHEAHRPCVKNGYVILGCVKSTRHGARSMIELMRFLKTEYGVLPQKEGGISVQELRK
FT                   RQKRLQRKGNLTSASAELAGESDWYLIDSKLYDGNGSGVFVHLLTKEKREDLNLEGLYC
FT                   TSEERGLYQKKVLSPSNDHLPNDDDDNVLAGLKRLALQNSRRYYSSTSSATADYARSSL
FT                   QGGSNMENSDAPLFSLVDSLAQLPETEELDPQEWIRSLDAKWAFIDLTEKHWQARWLMY
FT                   RLLYVNRLHALQRAQDGDSANLDHLKRDLTFCYKTLLEYFTLKQAMNGRLNKEELVGML
FT                   DIMLTQKELNGGYSKLVKHNRVLQQLLDHYKFHEPELFRDEQITIRTLKLMVSSQAKLN
FT                   VLSEFVRFLRDTGYTNRNVAIKCIEILAEAKEWRELKTFMFRDTTAALLSDPMVWAHFL
FT                   RSILAHGEPLLWRSLIDDGSILWLVRCGVDVRACEELHSALLELFQRAGYDAVKADSLL
FT                   RDYIQDGACS"
FT   transit_peptide 303680..303784
FT                   /gene_name="ATP25"
FT                   /locus_tag="ABL050W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DR7 "
FT   mat_peptide     303785..305437
FT                   /gene_name="ATP25"
FT                   /locus_tag="ABL050W"
FT                   /product="ATPase synthesis protein 25, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DR7 "
FT   CDS_pept        complement(305441..306367)
FT                   /codon_start=1
FT                   /gene_family="HOG000247843" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931366"
FT                   /locus_tag="AGOS_ABL049C"
FT                   /product="ABL049Cp"
FT                   /protein_id="AAS50722.2"
FT                   /db_xref="HOGENOM:HBG023828"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="UniParc:UPI0001DB2736"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR6"
FT                   /transl_table=1
FT                   /translation="MPLVLLTGFPSSGKTTYARQLEALLQAKCASSPELAKYTVVYHSD
FT                   ETLGIQHDDYKTSQGEKSARSKIMSVVKRDLSRNAIVIVDSLNYIKGFRYQLHCEVKHA
FT                   MTTYCLVHCLAAYEKLVQWNTQQDTPWDAALLEALIQRYEEPNPATRWDSPLFAVLSGE
FT                   DKLEAIADDVYKALFPQLYRDCADRETEKLLQGLTPNSATILKPAAHVNLVQVLDSETQ
FT                   AVVKTIMQHLQSNVVSGNIRVIVSETKDINDPSCCYVELQSDRVGMAQLQRIRRQFVQM
FT                   NKLRNIEKERIIPLFTEFLNKNLRSDL"
FT   CDS_pept        306462..307514
FT                   /codon_start=1
FT                   /gene_family="HOG000173971" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931367"
FT                   /locus_tag="ABL048W"
FT                   /orf_name="AGOS_ABL048W"
FT                   /product="ABL048Wp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50723.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG058135"
FT                   /db_xref="HOGENOM:HBG397932"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="UniParc:UPI00002525D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR5"
FT                   /transl_table=1
FT                   /translation="MFKPSARCLLAARVFTPRAVFPDYHIPLSNFQGHQRKAMLRIEQL
FT                   APQLNLLLEVRDSTAPLSTHNVLFDQLVATHRLDRIILYTKRDVCAAPTPAALHRWHAE
FT                   TGDDYMLLDARSAADAAALLAAVRARYDAAAAAPGALPLGYRLLVAGMPNVGKSTLVNR
FT                   LRASGTARRAKVAATGAHPGVTRATSECVRIADHRAGVFMHDTPGVALPARASSVRRML
FT                   ALALAGCVGPAVVDPVIQADYLLYLLNLQGLAPSYAAYSPPTNDIAALLAAVCTRHRLR
FT                   SETAAALHWLAIRPPGLCLDPELLLPPDAFSYKDHVTAAARVSLLPPRCHTRRAGRSAA
FT                   RARNSNVLFR"
FT   CDS_pept        308062..309354
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763576"
FT                   /locus_tag="AGOS_ABL047W"
FT                   /product="ABL047Wp"
FT                   /function="DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50724.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG058136"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniParc:UPI0001DB2737"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR4"
FT                   /transl_table=1
FT                   /translation="MAKPVPIQPGPVHGGVAIAPNMGARKAGGGGLTIRTSRHWVLPPR
FT                   PKPGRKPSYAAAGAVEAERKKSGGRRSTKAVLRKEIQQLRLENVKLKKELERLVASLQE
FT                   LKRRFTSVGLPETPAADIATPVSLGATPEASKKRVYIEDSTDAFLKFEDEEGGEVPALT
FT                   TACMAQSLSLGSRASFTDEEDFGSTPSSLFSSDLQNLSAGVVCSALAQHVAHSPRAMHS
FT                   GSPSSSTSSTLSKSVPAGAGIEAGPAPALMALETLTFLDNYERSEFYSKHTSTLLSRTS
FT                   TAATPEEQSQLMLPLLSVGEEPPLQAIREEDDLVRDPAADTASFQLSAEDEQETDGTSI
FT                   LNFLKTHMAEQEVATEKQRYEPPVLPAQDLDRWTGYNDPLQLMEKRDLGQFIAPSLEEL
FT                   MEEQDDCDRDSKLLGPLNYDAEPVGGDSYGD"
FT   CDS_pept        complement(309728..311008)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082737"
FT                   /locus_tag="ABL046C"
FT                   /orf_name="AGOS_ABL046C"
FT                   /product="ABL046Cp"
FT                   /protein_id="AAS50725.1"
FT                   /db_xref="HOGENOM:HBG058137"
FT                   /db_xref="UniParc:UPI00002525DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR3"
FT                   /transl_table=1
FT                   /translation="MAFDIQLFLGLPVDIRKAIYRRLDNRFTCLDPTDINGVNIQWGLN
FT                   RSAQKRDWGLQEIPFRPYVDHYNYIPNFVLLWRQYMPWLRYDSVVLDYLRINQLYDGGL
FT                   ASLHWILIGPDPCIAIFDNDDDVLQVWFSLAEFRSWILGALQHPETAYCGEIDVVGNAS
FT                   RMYGALKIDTGVVLDIQQLFGRLNTTGHLDTVGEVVLTQEEFLSQGEIGKHINYSVSQL
FT                   DSLRYLRTLKIRSDLLFHKFVNLRGARDNPGHTIGYNVRKRLRQLHLVGLRDEIAVCDL
FT                   SKWDSCVAVKIENFSGSLDLDGVIMPRHLQRLILKNVRSVRWWRFREIHEITLDPNTFT
FT                   KKQGFVGTIHGPDQDRVEVRQINRAVMSQDTYFHFDSLLRARFQNLNYISLHNVSEEIT
FT                   GIIVPHRLYCNGRISIAGCVVKGVVVI"
FT   CDS_pept        311151..312290
FT                   /codon_start=1
FT                   /gene_family="HOG000001079" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931368"
FT                   /gene_name="SLD2"
FT                   /locus_tag="ABL045W"
FT                   /product="DNA replication regulator SLD2 "
FT                   /biological_process="DNA replication"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50726.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG058138"
FT                   /db_xref="HOGENOM:HBG202304"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="UniParc:UPI00002525DB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DR2"
FT                   /transl_table=1
FT                   /translation="MSRTSAGELDVLKVQLKTWERQFLEENGRSPIKEDIKAHPEIRRK
FT                   YKEYTSLKKLLSKGNAAVTGQKHGSPSRATHPTPQKHIDAEIELGPTPQIYGKVVSLFE
FT                   MHISPLKKVPVRQLDADSSETCISPDLHSQDVAQSELLTDISCQAKRQLDFSVTPHASP
FT                   VKAVQPLLLNAPDLRFEAIPHARTKYGPNSPVKFDGDVTLTLSQTPLQAKLAQASEGYS
FT                   PSPLIKRPAKPLSQLAKEYEDIVEELKEVDHAAAVRNLGGLLQQEEENTQEAEAAEPSA
FT                   TRSDRKRRKNKVRPALVTLEEEIPQGNLHEQLVKLRQKALDKFNGNDPNDSSDEEKKTS
FT                   ATSAKPAKARKRKYNTVSDNFRRLKLPTKNTRNGRWRRR"
FT   CDS_pept        complement(312396..313952)
FT                   /codon_start=1
FT                   /gene_family="HOG000185028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763577"
FT                   /locus_tag="ABL044C"
FT                   /orf_name="AGOS_ABL044C"
FT                   /product="ABL044Cp"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50727.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG012349"
FT                   /db_xref="HOGENOM:HBG396404"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00002525DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR1"
FT                   /transl_table=1
FT                   /translation="MSSAVPRVTPLKNPVLPLQTTPEQRYWRQYSSTQLVKEHNAVTHI
FT                   EFNPQHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAGDATGL
FT                   VSVYDSYNPRNLLVSIKASTHPAHVTKFHPLDKQTLVTATDDRVVRVWDISHAYEPTLE
FT                   LLGASDYVRSVCFVPGAPHMVVSGCYDGVVRLHDTRTRSAQPVTQLNHGMSVEDIVAIS
FT                   PTQLVSCGGSKFKVWDLTGNKLLHERGNFAKTVTCLDYVNMPDGGAMNSCLLASSLDGH
FT                   VKVFDPLDGYRVKFGWKFSSAVLSCAISPGDAQGNKHLVAGLSSGLLAIRTNKKTREPK
FT                   GDSDAQDTETAIMGKERKSNNFQRMMRGSEYKGDQEHIIHNDKPRQQPRLRLFEKKLNQ
FT                   FKWAEALDSAFVPGMAKELTLTVLQELRKRGKIRVALYDRDETSLEPLLNWCLKGLEDT
FT                   RSAPVVADWIAVVLEMYATIIERSPVLEEMVVALRNKVRQEIHKCKEAQKIQGMLQILT
FT                   N"
FT   CDS_pept        314691..316511
FT                   /codon_start=1
FT                   /gene_family="HOG000162559" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763578"
FT                   /locus_tag="ABL043W"
FT                   /orf_name="AGOS_ABL043W"
FT                   /product="ABL043Wp"
FT                   /protein_id="AAS50728.1"
FT                   /db_xref="HOGENOM:HBG035072"
FT                   /db_xref="HOGENOM:HBG330599"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00002525DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DR0"
FT                   /transl_table=1
FT                   /translation="MAAIQLEKTLVPLPSTRRNFGTHLSYDRHTNRIAYGSGKSAIVKS
FT                   LDSDIVVQFTGHGSANVTVVRFSPVAGSQYVVSGDDAGRIMVWSYFEDEEKGQVETKLR
FT                   SEFQVLAGAVADISWDFEGRRLCVVGAGRDRYGAFISWDTGNSLGEVTGHALNVNACHI
FT                   RQARPMRAATVSDDGSMVFYKGPPFQFSCSDHTHHANGKFVRDVRFSPAKGAYLVSVGS
FT                   DRKIVLYDGDSGEFIKYIGEDSEECGGFFSLAWVDDGDKSNRIVTASADGVVRLWDVEA
FT                   NRLLKRWELGTEVAQQQVGVVVTRDSNIISVSLDGTLNVFSIESDKPIKTIEGHKKGIT
FT                   ALKTNPLVTASYDGRVLEWSAEGTAAVAAMHSNSVTSINNVGGRTCTVSWDGTLKVDNE
FT                   EKHKFPDDPKASVAFEGMVALITNNKRLVLVKSESGLVVQETALSRSPCVVTMAKSHVA
FT                   VGYEDSNIIDVFLVSDFATRFELALTIRGTPSALSFSPTEQYLAVGDVMGKILLFNVEQ
FT                   RTVVTSRWSFHTGKITSMDWRPDEDDENYIATAALDTHLFIYSVKKPMRVIKMLNAHKD
FT                   GINMLGWEDPDHLITGGQDACIKRWRVSFS"
FT   CDS_pept        316933..318366
FT                   /codon_start=1
FT                   /gene_family="HOG000141761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763579"
FT                   /locus_tag="ABL042W"
FT                   /orf_name="AGOS_ABL042W"
FT                   /product="ABL042Wp"
FT                   /protein_id="AAS50729.1"
FT                   /db_xref="HOGENOM:HBG123702"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI00002525DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ9"
FT                   /transl_table=1
FT                   /translation="MSREAKAPKVTFKDMHDEEGEDHSTSGQYGLKANYEADGGNNDKE
FT                   NDGDREYEDDEEEEDEEEEDGDDSRQDTSGNDENGDGNERGAESGRRHMGQRADDGVVI
FT                   PNRPQGEVRMTLIDPKNMPRTPTRGRPPKRKFGRSASPDLSKAGPGFTTSIPGNSKRPR
FT                   LPYPVDERGNPLPVINDEYTLPDDPEGERKITRDGDLLGGRQFLVRTFTLTGRGQTKYM
FT                   LSTEPARAVGFRDSYLFFQYHPNLYKLVISQDERNDLIDRGVIPYSYRSRAIALVTARS
FT                   VYKEFGAHIIVDGKNITDDYYATKLRAEGKLVEGTYAREPISKNGTRSDGWDYPQSNIN
FT                   PARNAVEFFDKKNHNIAPGSNISATNWLYQHAAACSRFNSDLFYDRERVLLIENLGLRD
FT                   PYTNTLHLPQSTQSSKVLAFRKLRPETDQIIYSTHIHDSDVARRKTGLADVPPELFEDI
FT                   VSDEVKEAILKQQEFERTN"
FT   CDS_pept        318720..321176
FT                   /codon_start=1
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763580"
FT                   /locus_tag="AGOS_ABL041W"
FT                   /product="ABL041Wp"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50730.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI0001DB2750"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ8"
FT                   /transl_table=1
FT                   /translation="MSSVLTYQLLRTLKGDRPLSVVRSSWRAIVANNHAVVYRQKVRAL
FT                   HTSPAAWNQNKSSKDGNDKDFGDDELKALKDELFKQIEEANKRTGSEKDAKQKEIAEQM
FT                   RRMEEVVKRQLERAKKEAAEKDAKATAGESGADNGKGPEGQRQEPDANNPFNDPKVMTI
FT                   NINLFKVGLVLTLIAFIMSKLGPGSGERELTWQEFRKELLCKGYVAKLIASRSNVVKVV
FT                   LNENGMHQLQNRDTSYYFTIGSVENFERKLREAQDELGIAEDFRIPVIYISEKRWMQLA
FT                   VQLLPTAMMIGGLYWLNKRFMSSASGGPGGIFNAGKSKARRYNKDTDVKVKFKDVAGCD
FT                   EAKEEIMEFVSFLKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAGEAGVPFFSVS
FT                   GSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSGANDERENTL
FT                   NQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSGRQEIFKVH
FT                   LSKIKLAGDIADLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEHFEQAIER
FT                   VIGGVERKSKLLSPQEKKIVAYHEAGHAICGWFLEFADPLLKVSIIPRGQGTLGYAQYL
FT                   PNDVHLLSEQQLLDRMTMTLGGRVSEELHFSSVTGGAYDDFKRVTSTATAMVTELGMSK
FT                   ELGLVNYTPKSEHDLTKPFSEETAAIVDSEVYNLIQYCHDRCEKLLREKSEELEKVAQL
FT                   LMKQEVLTREDMIRLLGKRPFPERNDAFDKYLNESETRRLKEQEEKGDDDKKRDDAEPN
FT                   GEKPSE"
FT   CDS_pept        321555..323258
FT                   /codon_start=1
FT                   /gene_family="HOG000141762" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778390"
FT                   /locus_tag="ABL040W"
FT                   /orf_name="AGOS_ABL040W"
FT                   /product="ABL040Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS50731.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058139"
FT                   /db_xref="HOGENOM:HBG203420"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00002525E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ7"
FT                   /transl_table=1
FT                   /translation="MDESESQLRGTLLPHDSLEYGTNSDKTLTETQRCQEHNRSLPKAP
FT                   ILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSD
FT                   IVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTT
FT                   KERGMYQGYANVIFGAGQVLGAPVGGLIMETFNWRIIFAAQVVAIMICMILAYRNINLK
FT                   LLHIPPFHQRFTRKNLSRIDLFGSSMLSCSLVSFLMLFSSGVSRSLWFLLTLVSLTLFC
FT                   INERYIATERLLPNGILRGHFGLSALLIVVSSFMMFAELYRMPVYLQLIQDISVSRSGI
FT                   FLLFASVSSSGASLFTGWLLRTTKQDLGKLVYKIALASSFIQLVGMMLALFTTSVTEPS
FT                   QAVHAGWAVFSPRSAGQMHYFKSDSIAWRVLLTVALMCSSFAYASLLVSILVSIVDTTE
FT                   KSQQATMIGVFYLWRSIGNTLGASVPLSVYEFEVARKLWDYMEAQGLRDTYLDLLHDSS
FT                   ILRQRFRNHTLAALLQIYRSCFQVSYLPSICVCILGILAATRLTQRAAHK"
FT   CDS_pept        complement(323259..324020)
FT                   /codon_start=1
FT                   /gene_family="HOG000000754" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625839"
FT                   /locus_tag="AGOS_ABL039C"
FT                   /product="ABL039Cp"
FT                   /protein_id="AAS50732.2"
FT                   /db_xref="HOGENOM:HBG123710"
FT                   /db_xref="UniParc:UPI0001DB2751"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ6"
FT                   /transl_table=1
FT                   /translation="MRLCLIDNNQTVCEVWRRWLDGVGDVKVWRGGLEAVAAWDCGVTR
FT                   GVVSPGNSLGYLRGGFDLGLRELLGGAMFEDWVRGQLGRSYRPLGACAVLHVPERFSAG
FT                   GVRYLLHVPTMVAPTAPVFDAARPVATGVQPVFDAVWGVLQALPAEVEELLLPGIGTGY
FT                   AGIPASIAAVSMAFAIRLHLVREQLSAELVAVMIMCFLGCQYEPFMPEHCRREYVSLGL
FT                   PWERLLSFDVLQDSLDEILPRALRRPAVGNT"
FT   CDS_pept        324574..325905
FT                   /codon_start=1
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763581"
FT                   /locus_tag="AGOS_ABL038W"
FT                   /product="ABL038Wp"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="AAS50733.2"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001DB2752"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ5"
FT                   /transl_table=1
FT                   /translation="MTQTNQVRASTKGVLGMTRNVVGAFTANWRCRRQHQALGRVPEAM
FT                   PDQILGLTERFNQDRNPHKVNLTVGIYKDDNGEVTSFPSVARAQRMVEGQRGGRLAYLP
FT                   IAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLSGTGALSLASLFLSNFISKTI
FT                   WVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVDSWLAQLERAAADRPYPQCILLHA
FT                   CCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQGLESGDLRADAYLLRMCLEHRWD
FT                   NGLYVCHSFAKNMGLYGERVGSLSVVHPLGQFQAKAATDSQLKCIIRASYSSPPSYGSR
FT                   VATTVLSVPEIKQQWHEDVHGMCNRLWSVRCMLHEKLRWPKLIDSTSQHGMFYYTGIGP
FT                   DAVDTLREKYSVYLTKDGRLSLAGINTGNVDYVARALRNVSTYP"
FT   CDS_pept        complement(326116..328086)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763582"
FT                   /locus_tag="AGOS_ABL037C"
FT                   /product="ABL037Cp"
FT                   /protein_id="AAS50734.2"
FT                   /db_xref="HOGENOM:HBG058140"
FT                   /db_xref="UniParc:UPI0001DB2753"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ4"
FT                   /transl_table=1
FT                   /translation="MLRKQTPGRARPADVEAVAAVSALGKVMNQDGTALDHSKVRKRES
FT                   MLPTRGRSGRGGVRRASAESAGRRTRSEDGKAARSARERHMEDEFNAFGGRATAGVAKE
FT                   VPARGGADDGPVMTTKYVPSPRGLVKVTVPVSAGSSAHSSLRKSASIHTGMNMRHGSGS
FT                   RRASMTSAGSDAARRQAKSTAESSSARTRSNKPKPRPSGDSHSPSPTTRAPVTPRRTTV
FT                   KDLVAPPLPEEPEDSVSTSGKGESIVPLNEKEEEQDEQPFDSEANARSSPKTPKQGGHV
FT                   PALEVSQHGFQTPVPDGPTMAEYLQSADPILSAGATQRQRELEEAEAASTTPDGDRLKI
FT                   GKSPSPMKSAMKNSPSAGTSKYNRPPLDTSSAADGAYLSLTTAENTRLNAQLSDDKMRK
FT                   SPTLRQPKRRVSVHSPKTPSAASADRSSKVLRQFSLSKPQGRTLAMNKNNSGEKQAQSP
FT                   TSPKSNQKKVDPSVLYPREPPKKKSSFERERPQHKNLGFKNLSLRSEASNEFMYQGTLE
FT                   GEIHQSPGQHVGHETPKKALLSVTAEGWKSRFSDSDSENDSPPFSSNASGSTQPSSHRD
FT                   SSLAHHGGFGLFKHKDHHGHKPKHSLGASLASAKPHEPQKARLAPTSNRGSNTLSAERP
FT                   LKNHNSFSGKLKKLFGKKHAT"
FT   CDS_pept        complement(328585..330705)
FT                   /codon_start=1
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763583"
FT                   /locus_tag="AGOS_ABL036C"
FT                   /product="ABL036Cp"
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50735.2"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="HOGENOM:HBG409912"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI0001DB2754"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ3"
FT                   /transl_table=1
FT                   /translation="MCGIFGYCNYLVEKSRGEIIDTLVEGLQRLEYRGYDSTGIAIDGD
FT                   GADETFIFKQIGKVSALEREIAERAPARDVRFVSHCGIAHTRWATHGQPRQVNCHPHRS
FT                   DARNEFVVVHNGIITNFRELKTLLRNKGYEFESDTDTEVIAKLFKHLYDTNLENGHELD
FT                   FHELTKQVLLELEGSYGLLCRSSRYPCEVIATRKGSPLLVGVKSERKLKVDFVDVEFPD
FT                   NEKQPDVPIPAVLNGHKAGADCEKLLPIAASETGLRHSQSRAFLSEDGVPNPVEFFLSS
FT                   DAASVIKHTKKVLFLEDDDIAHIYDGELHIHRSRREVGASATRSIQTLEMELAQIMKGP
FT                   YDHFMQKEIFEQPESTLNTMRGRIDFENNTVMLGGLKSWLPAIRSARRLTMIACGTSYH
FT                   SCLATRAIFEELSEIPVSIELASDFLDRRCPVFRDDVCIFVSQSGETADTMLALNYCIE
FT                   RGALTVGIVNSVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMLALSLSDDRV
FT                   SRIERRKEIIQGLKEIPRQIKQVLQLEKQIKHLCETELCNQKSLLLLGRGYQFASALEG
FT                   ALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKG
FT                   RPIIICNENDEVWTRKAQNSNLLTLEVPLTVDCLQGLLNIIPLQLTAYWLAVNNGIDVD
FT                   FPRNLAKSVTVE"
FT   CDS_pept        complement(331090..332583)
FT                   /codon_start=1
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763584"
FT                   /locus_tag="AGOS_ABL035C"
FT                   /product="ABL035Cp"
FT                   /function="aminopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="AAS50736.2"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG011112"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniParc:UPI0001DB2755"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ2"
FT                   /transl_table=1
FT                   /translation="MSELKEQVMATQEALRAIQESLKQLQIAPGADDASGADEEDGLEK
FT                   WARRFVDFTYKNPTTHHVVAHYAGRLEAAGFRRLDERDEWELPAEGRFFTVRNGTSLAA
FT                   FVVGRDWKATDGVGVIATHCDALAAKVRPVSARPAVDGYELLGVAPYAGALSPVWLDRD
FT                   LGIGGRVLVREADSDRVRSRLVDSTPHPVARISTLAPHFGAVATGPLDPETQMVPVIGY
FT                   GGADAEASAAERAAPLFGKHPLPLLRYVARLAGVEVAQLVQLDLDLFDVQRGSLGGLRN
FT                   DFLFAPRLDDRLCSFAAMEALLAAPAPAPAAFDAVVFFDNEEIGSRTRQGAAGGLLGAI
FT                   AARVLRARGADPAALPTLFANSVVLSADVTHLLNPSFCDQYLDGHKPVPNAGLALALDE
FT                   NGHMATDSVGTAFAHDLAAAAGAPLQYFHIRNGARSGGTVGPILSAATGARTIDLGIPQ
FT                   LSMHSIRAAAGSRDLGLAIRFFAGFLADWRAVYDRFRGL"
FT   CDS_pept        333444..337721
FT                   /codon_start=1
FT                   /gene_family="HOG000112964" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931369"
FT                   /locus_tag="ABL034W"
FT                   /orf_name="AGOS_ABL034W"
FT                   /product="ABL034Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50737.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123809"
FT                   /db_xref="HOGENOM:HBG202307"
FT                   /db_xref="HSSP:1A06"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020671"
FT                   /db_xref="UniParc:UPI00002525E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ1"
FT                   /transl_table=1
FT                   /translation="MTAGHRDERPDREGGSERDEHLNRVVQSVSDATKRLSQISNSSTA
FT                   HTKTGKRKNRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQV
FT                   TALPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPE
FT                   QEAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLE
FT                   TSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGR
FT                   YQMPSNVSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLEKPEER
FT                   PKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQQRQS
FT                   VEPTSVPSNMASTNGSGAFARASNNDQSVINAPKVTQKSQFSINSLLVSPKKTREGYVA
FT                   SSSRVFKHSVSRRSLHVSPSPMKSSTSCRSLKSSSSKRLQSPNPKAITQPVKVTSPQPR
FT                   RRTLHNSASKRSLYSLTSISKRSLNLNEFLQEANEVKTPKLPSMPLQDQPRSEAPKTPT
FT                   KTTYGADSHGGEKPTFISVLHDCPTVDSEGMVFKSSSGTPMIAANAPIIQPAFIFGVGA
FT                   FPGTKQPSSNSLSKPSLNSQSSPKQAQEATANSMRETIRDRQTLVVEKRVPSKTESVPP
FT                   AFPRVRPIMERKHGSDLTLVRDTRSVAKEKRSSLSLDPRRTAPEPPRGIETLLRRYSLK
FT                   NSIKSRSSLKKKRDSGAWSITDKTIFQDLGQVPEDEEQEKDSEEKGNDTFISTTETSDT
FT                   PSSKFKVTTSTPIKKDDATAISAENAAVGTEQSGSEDEATNFDSNAHSYPISTDLKTED
FT                   DLTPIKPQGQTDLLRMPSSFMNSSNTFANLNNFISNIDKEYSPENSDSGRIEKDEPAGK
FT                   AQPEQITVKKRQRTLAPGGYLSPSIPRMESENSLNQELGSRISDLSDLSFANDMPTYTN
FT                   TAHAVSISPGTRNVCSFSPLEPRSPQDVSNNGKMRSNLHIPLRQLSEDMCDKTITTQEG
FT                   ESVNIFEDAPEEEGSLTTSTSGSVPNIHQKAISIDTMNTSCALVPVSHVRTSIHMNGDS
FT                   SVLDWSTSDGILSKARPLPTSNHVRKKSGNRLSNNLTLSKSMMSMFKNLDQINVTDIQD
FT                   PMPVSDLLSKGVDPIEPIEPLKNDQVTLKAESIGAESDSINMDLADRKHVTIFHDNVSD
FT                   KNFKSTRMENSDKGSLGSGAPQATHLFHTGNKDMKSHETLLSPITETPAAALSATSLTR
FT                   KESISSDGKSVKDETKKSGKGNWFMRLIMSFTKPKKTVIQEHMTVLPFDDVNIITLQQF
FT                   SYQGVEYEIRQMERRKDKQKVEYDCRLLDGDFKFKINIYGENSAATKVSVKQKGRSDEL
FT                   AFTKLNTDIEALIKAKENAANVK"
FT   CDS_pept        complement(337878..338999)
FT                   /codon_start=1
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625840"
FT                   /locus_tag="ABL033C"
FT                   /orf_name="AGOS_ABL033C"
FT                   /product="ABL033Cp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50738.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002525E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DQ0"
FT                   /transl_table=1
FT                   /translation="MLRLLNPRSTQTVSRATRLVIRLSSTAIPTTQKAVVFYEHGGELK
FT                   YTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPKLPLVGGHEGAGVVVAKGAN
FT                   VTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLSGYTHDGTFQQYATADAIHAA
FT                   HIPPGTDLAKVAPILCAGITVYKALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYR
FT                   VVGIDGGNEKEALFRSLGGETFVDFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQS
FT                   VEYVRPTGTVVLVGLPPDATVKSDVLTHVLKSINIKGSYVGNRADTKEAIEFFTRGLVQ
FT                   SPIKIIGLSQLEEAYKAMEEGTSIGRYVVDTSR"
FT   CDS_pept        complement(339538..340284)
FT                   /codon_start=1
FT                   /gene_family="HOG000231076" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778391"
FT                   /locus_tag="ABL032C"
FT                   /orf_name="AGOS_ABL032C"
FT                   /product="ABL032Cp"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="AAS50739.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG051096"
FT                   /db_xref="HOGENOM:HBG447430"
FT                   /db_xref="InterPro:IPR007144"
FT                   /db_xref="UniParc:UPI00002525E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP9"
FT                   /transl_table=1
FT                   /translation="MAKLVHNVQKKQHRERSQVSERARFGFLEKHKDYTKRAQNFHKKQ
FT                   ATLKVLRSKAKERNPDEYYHAMHSRKVDSNGVLVKSRHANGEDPSLTMDQVKLLKTQDS
FT                   NYVRTMRQSELNKASRLSQQLMFKASGQHTVFVEDEDSMRHFTPEQYFDTTSEMLQRRE
FT                   NRLTKDQLARTPLEPSSSIMPSESLQKKKVKKIKMVAQHLDREKKLQQVYQRMDLQREL
FT                   MKKGSKKKVADSSGAVSFKWKKQRKR"
FT   CDS_pept        340469..341302
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763585"
FT                   /locus_tag="AGOS_ABL031W"
FT                   /product="ABL031Wp"
FT                   /protein_id="AAS50740.2"
FT                   /db_xref="HOGENOM:HBG058142"
FT                   /db_xref="UniParc:UPI0001DB2756"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP8"
FT                   /transl_table=1
FT                   /translation="MVSELSLPEFEAGLSASLTCKRNFACFATFAGEIIGALRGSRLRV
FT                   QLLEDFSTIGKDSVLSGELQVLVLATMQELPPREQNEVARWLRALRKVHPGLVCIATIG
FT                   AHENGGPGMTNFLRRQFWFATRGPKRACGALRLPKRAAFTVHPAVHRYVLDVLVHIRMH
FT                   RLLDHSQAGGASSSSAEDVLDLCRWLCSANHPEKTFVTPDDVQQACAWYFPMHLDVIRL
FT                   PQQEASVLYGTSMKFAEDLLIGLRTFLKKTGTVDNPLLLETLIVQEVLGKVVPAI"
FT   tRNA            341436..341508
FT                   /gene_name="tRNA-Lys"
FT   CDS_pept        341678..343486
FT                   /codon_start=1
FT                   /gene_family="HOG000066046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625841"
FT                   /locus_tag="AGOS_ABL030W"
FT                   /product="ABL030Wp"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /protein_id="AAS50741.3"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="HOGENOM:HBG058143"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI0001DB2757"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP7"
FT                   /transl_table=1
FT                   /translation="MSQECTTFLIDYSASMLESTAKFEAYLEYALFDKAQRSRKTDYTH
FT                   VVLANCAMEKNPNNVKNMFEVFAPSAPITLSSVVKICERLKAMRELDPLDTKQSNVFEA
FT                   LLAIGMQVNDKFNKRKMLKQVMVVTDDLDGLNVDSEDLEVVQANLDLRLILVYCAEQFP
FT                   DNFSKTKWGQLLALKDGSRMFTLYEVLGTIERITHQPVKPVRVFHGQLRLGADMRNLAG
FT                   CQQDPHCLCINVEGYPATKAVVSMSRKQVQKTEDGKYLPLQSVIEYEIHEPTEEDNEEY
FT                   HVVPVPKEHVTKAYRYGADYVVLPELLEHERLYTTTPGLDIRGFIDTGKVLRHHLCSES
FT                   VYIMADSREGTAADYVTFAALVDAMIAAEKFAIARYVQKKDSEVQMCLLCPLLVEPSTK
FT                   KRPADDDAAEAKRALVLCRLPFAEDERSSDFPPLVKQEPADVMLDTTMAAFIDSMDMDA
FT                   AAPPASWCSSSNVRSFDSFMKDSTLPLPDDPSLAETISDPACIPAIALHHQKHVLLEYF
FT                   HQRFILRLNNGFSVADLRDSLRSKVSPWATAETSELAARIKDTCAVKLVERPPEATAGA
FT                   YVDEEQDEASEVPPLEALLALGKRNP"
FT   CDS_pept        343861..345567
FT                   /codon_start=1
FT                   /gene_family="HOG000009550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763586"
FT                   /locus_tag="ABL029W"
FT                   /orf_name="AGOS_ABL029W"
FT                   /product="ABL029Wp"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS50742.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG009334"
FT                   /db_xref="HOGENOM:HBG286308"
FT                   /db_xref="HSSP:1KFI"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI00002525EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP6"
FT                   /transl_table=1
FT                   /translation="MSITIESVPTKAFADQKPGTSGLRKKTKVFEQTEHYTENFIQAIM
FT                   ESIPEGSENAVLVIGGDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGLLSTPAASHIIR
FT                   TYHDKVTGGIILTASHNPGGPDNDFGIKYNLANGAPAPEKVTNSMFERSRNLTHYKITR
FT                   GMPKLDLGKIGENQQYGNLLVDVIDPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVL
FT                   FDALNGITGPYGKAIFVDELGLSEDSLQNFVPKPDFGGLHPDPNLTYAHTLVSRVDREN
FT                   IAFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYASEIPYFIKNGIHGLARSFPTSG
FT                   AIDLVAKEKNLDCYEVPTGWKFFCNLFDSKKLSICGEESFGTGSDHVREKDGLWAIVAW
FT                   LNVLAIYHRRHPDREPSIKTIQEEFWAKYGRTFFTRYDFEECDTEDANKVIELLRTFAE
FT                   NPAVVGQPFPAWHEVSVSAAGDFSYTDLDGSVSEHQGLYIKLSNGTRYVVRLSGTGSSG
FT                   ATIRLYVERYTNDPAYYAQTADQFLAPDIKAVLKFLRFKDLIGTEEPTVRT"
FT   CDS_pept        345964..348132
FT                   /codon_start=1
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763587"
FT                   /locus_tag="AGOS_ABL028W"
FT                   /product="ABL028Wp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50743.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI0001DB2758"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP5"
FT                   /transl_table=1
FT                   /translation="MTMYGWKLTNKLKFGRSKEEKDKDREKERDSRHNSGSKHGVFGHL
FT                   SKRLSGTEEQVRGRTEEANTGAGTPRTSKDRKETIVATPNSIAPVRLSTDVAAPGWPNG
FT                   EVQSSVPSSFRDAGSETTDVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTG
FT                   IMTIKVYNGNSFKLPFALTSNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSED
FT                   EDKLLPGDAATNYIPATIKLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKIS
FT                   TFDVTRKLPYLKVNVFVRIPSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQ
FT                   LPLNLQFNSATSIRLYNHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGS
FT                   FGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQS
FT                   PEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPEN
FT                   ILLDYQGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVL
FT                   LYEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGA
FT                   DEIKRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSE
FT                   SVQQQFGGWTYVGSEQLGSSIIPGKNIR"
FT   CDS_pept        348512..350389
FT                   /codon_start=1
FT                   /gene_family="HOG000093739" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763588"
FT                   /locus_tag="ABL027W"
FT                   /orf_name="AGOS_ABL027W"
FT                   /product="ABL027Wp"
FT                   /protein_id="AAS50744.1"
FT                   /db_xref="HOGENOM:HBG058144"
FT                   /db_xref="HOGENOM:HBG396061"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniParc:UPI00002525ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP4"
FT                   /transl_table=1
FT                   /translation="MMSIEKVQKRSSSQDLPLSSDKGEGKKRKVEFADGLVHSRHRNEL
FT                   ADEQPQDFSTKLYKGYIRDALDDLETSKDTGKLDTIANQLSLSASSPDRISAENFAILL
FT                   EMLGNNITKIDNKRGVAIVRAVLNFEKWWDLPPLTLGNYVFFLQILCSSIPKWWQDVSM
FT                   LLISNFRLPVDKTTKHHEILKYFLRAIPSSSNFIDSYIAKYFPNKNDSKKNLVNYISNV
FT                   LTLTEYCEELRFQAWSMIIEKIIAVDVELQNELDELDDDVDEEIDDKLADSDDGEDELP
FT                   GDDDAAEASTHSADDTSFDSEDEQLEGNEEYNIEVTRNIKELSKKLDVILSMLTTRLSD
FT                   ALTPETLESGEGVNTFNTLVSLFKSHILPTYYTRSVQYLMFHVSQQQPQLMDAFLVTLI
FT                   DIAFSPNETMEKKIKSLQYLGSFIARAKKLTHTQITFVASYLTSWLNRYVLEREEEVDL
FT                   PGGMDRFKHFYAAFQALCYIFCFRHALFRDGNAWECDIDAFFQRTVISKFNPLKYCNEN
FT                   VMLMFARIAQHEGIVYCFSIIENNNNERLRGIMGKSSERSDGLASATGAASTWSLAARQ
FT                   QFIDLQSYFPYDPLFLKQYKNLMRDYYIEWSEISADYESDDSNEFTDAA"
FT   CDS_pept        350992..352434
FT                   /codon_start=1
FT                   /gene_family="HOG000154429" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763589"
FT                   /locus_tag="AGOS_ABL026W"
FT                   /product="ABL026Wp"
FT                   /protein_id="AAS50745.2"
FT                   /db_xref="HOGENOM:HBG252595"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI0001DB2759"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP3"
FT                   /transl_table=1
FT                   /translation="MAGYLTFCHNEDEREYSEEVGGAHGLARRKRDSDLYRSPFLNLGQ
FT                   ANVEELAELELLELPRMSRFEVELYLRAKEFQAMNPPLVKAFGTYMCPEDRQCVRDRGI
FT                   QAYYLLPSINDNVDRRGNFLPSFLVQDKLNVTFTKYNKSSSTIMNYPLPHNKRDAVYFE
FT                   VKVYKFRNYLASNSIFSIGLVTCPYPYFVMPGMCQYSIAYESTGKLRINNSFYASTLLP
FT                   KLQEGDVVGLGYRYRTGTVFITHNGKKMMDLTHNIGIDLFVGIGAMNAAYTRTYTKEGL
FT                   LDDIDNVELRKQIQDLEADQKRDITEVMNEQLLRPHDPRTRHINSDEIELQVNLGGVGF
FT                   VFVEANVKKYAFGSLYGEIGIPPAYNGDETKTDVILQKGDDLPPKYPEDELNFFGNIKV
FT                   NLGNGSSTESTSMYNRQGSSGSVAPPPATERPRSLQNVPYALQGLLDDIEERSVYEPLL
FT                   PKGPRPAKSGHKRKKRKRRAPA"
FT   CDS_pept        complement(352554..352967)
FT                   /codon_start=1
FT                   /gene_family="HOG000001077" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931370"
FT                   /locus_tag="AGOS_ABL025C"
FT                   /product="ABL025Cp"
FT                   /function="7S RNA binding"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /biological_process="negative regulation of translational
FT                   elongation"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="AAS50746.2"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0045900"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG058145"
FT                   /db_xref="InterPro:IPR008832"
FT                   /db_xref="UniParc:UPI0001DB275A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP2"
FT                   /transl_table=1
FT                   /translation="MSVKPVDSFIKDSLQLLCANPSQTLVSFRYRGGSAEGSAAEVRFR
FT                   THNSHLGLHYKFKTRRQKDVSRVLSALGPRGVNVVAVGTERRKRKQASRDLVGMATLLV
FT                   NADVKQHVPEPAAAAAAAGSSRAKKSKKKGKKR"
FT   CDS_pept        353689..355893
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763590"
FT                   /locus_tag="ABL024W"
FT                   /orf_name="AGOS_ABL024W"
FT                   /product="ABL024Wp"
FT                   /protein_id="AAS50747.1"
FT                   /db_xref="HOGENOM:HBG103598"
FT                   /db_xref="HOGENOM:HBG252596"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00002525F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP1"
FT                   /transl_table=1
FT                   /translation="MVGRRKMGAEARRSGDSGGSGGSGEPQTATSGEKRELGGVGLLDW
FT                   GADTILRRFAAEPEYIKVLARKKGARCFRRLFVAQELQPPVDSPLHANHSSQSLGQAAP
FT                   AGDKARSVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVYGGDKHHSNTLS
FT                   LLNQQLLKYSGKRTEAVPAPGPERKEIPFDLEQQYAPVFHPDPHRVFGEHLQDILDCDW
FT                   SKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRT
FT                   WSILEGEVAEAFNCGDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGLKLLHSFHLLQKP
FT                   NETENRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRLLEIFRGFSNES
FT                   SRISAHHLEMEDGESVVLSASENHWLYTWMLHHEEYMYSHSDLDNARTVPSPIDGKDPK
FT                   KHSIRNIFRRSISFNSDILSESNPVARHHFPLFHHKAQHKGGCVKNSEYITFHAHHNPV
FT                   TAATIAPKETTHVLSLSDDIICELNMKFGGEALEHLRTKSIREPGSPAGRSDHKRNHSA
FT                   EKNYSQSTAKQNVGTIIVSAAATGQIRVFRTDVSSSVRAKALEAIRAAHGLPGSPERPL
FT                   KPVLSALAHPLSAGVAKGKHICGDNRSAPSTTCPRCAPSAVNGQQDESASTAEQSTSSP
FT                   KPTCDVCGGQKLSVVGKKTALQKTKSLYCLECGNHINRFK"
FT   CDS_pept        355982..356905
FT                   /codon_start=1
FT                   /gene_family="HOG000165141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763591"
FT                   /locus_tag="AGOS_ABL023W"
FT                   /product="ABL023Wp"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50748.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001DB275B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DP0"
FT                   /transl_table=1
FT                   /translation="MSPSTDTPVSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGEL
FT                   VAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGC
FT                   VLSDRRTYGTAALAVNATAGAAAGMIGAALGSPLQLVKTRMQALAHGGAPLPAAWPTLV
FT                   ALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAKEALSRHVPDGMALYTLASALSS
FT                   VAVCIAMNPFDVAMTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHT
FT                   ILCLTLMEQALRVVRLVENRLPQIRP"
FT   CDS_pept        357025..358230
FT                   /codon_start=1
FT                   /gene_family="HOG000006053" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763592"
FT                   /locus_tag="AGOS_ABL022W"
FT                   /product="ABL022Wp"
FT                   /function="di-trans,poly-cis-decaprenylcistransferase
FT                   activity"
FT                   /protein_id="AAS50749.2"
FT                   /db_xref="GO:0008834"
FT                   /db_xref="HOGENOM:HBG372223"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniParc:UPI0001DB275C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN9"
FT                   /transl_table=1
FT                   /translation="MVQKGTHKNNDSFPSTAHTSMVEVKNTEAATAAGGAQKQADQVIQ
FT                   LEWHDPIEEAAQELDAARVAANSEPTLRARVKRLVRGEWKQTYRNRPKISHILFQFGLL
FT                   RMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEAGSVALMRTLHT
FT                   CKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKDRMYGARLLVV
FT                   GDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVRLCQAGALDS
FT                   KDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSNCMWPDFTF
FT                   RTFFTILLKWSFVTALHEARKQERLRRKLGTYARSLLARRARPVRLEALPPPPQAISVT
FT                   DR"
FT   CDS_pept        complement(358273..358992)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931371"
FT                   /locus_tag="AGOS_ABL021C"
FT                   /product="ABL021Cp"
FT                   /protein_id="AAS50750.2"
FT                   /db_xref="HOGENOM:HBG058147"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="UniParc:UPI0001DB275D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN8"
FT                   /transl_table=1
FT                   /translation="MDLPPSIACSCTGGRSFRHSNKQPSYTKLNGAKCENTPAQGHTMF
FT                   QLELSGPLRDKLLQAGGGAAAAEVKVAAARGWVTFGSLVVLCERGAATARETQALLGSL
FT                   QLRPRAARSSNYSDEFRAQQQRLRAAAAEDEYRALTGGMQQEQQRHGFGSAAREVREQL
FT                   AAVANVVLTVVGVAYGVWWVARAAGVGAEARVLLALGCGLTALVADVAMYNVYHRKVGE
FT                   ARRRERRLHEQRRVVTS"
FT   CDS_pept        359097..360929
FT                   /codon_start=1
FT                   /gene_family="HOG000066045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082738"
FT                   /locus_tag="ABL020W"
FT                   /orf_name="AGOS_ABL020W"
FT                   /product="ABL020Wp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50751.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058148"
FT                   /db_xref="HOGENOM:HBG203424"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI00002525F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN7"
FT                   /transl_table=1
FT                   /translation="MRELNHRSVLSNRASFIISQTVYDRRALDNVADLPLINSLNHLTF
FT                   LTSSSAKVRETMSEDGALERLVSILHDCYLTLHDLCIGLHVGFRMGTVDSIVRQRKMAM
FT                   VAWKWTLAFQCLVLTGTRGTQEIRKQVAHSGVIPIIATVLDNYMIYHKNFDFFRDEPIE
FT                   FDFKSIASGNIFQLQPEEMESFFQKMDKSHPNLRLCINMERFKILVGEDIPSLLDDPAK
FT                   VNMHNCVPPITRLDTDFQSLWEGTLGLKSDEHPLSDVVLSIPREFFLGRVIPKLDDITW
FT                   SVQLLAFLTKCTATKPYLQKVSLVESISFRPILERAKERYTLLSNSLPPLNFTDLSLVD
FT                   DDDQRTSSSKPKVPIVIDPFLMEINAICEESNNKKQAKKSVNFSMLGLTDFTKLKKADT
FT                   TDVWRAFRMYDEVQMKKRFSYKWDYDKVSRELDEETWNKIINRETLNLFALVERYTVKI
FT                   ENDANITYWSSVVMRNSCRKHEATGVRQCANFFCGKWEDHPKQFPKCRRCKRTKYCSCE
FT                   CQLQSWAYHRYWCHDVGSVFTGTSSTANTTGTHTPNAVGQSAGTTTTTTTAATEVDQSI
FT                   LMTARGNVVDPQGIANQSAGEFVDTSENPPIGGA"
FT   CDS_pept        361561..362856
FT                   /codon_start=1
FT                   /gene_family="HOG000248280" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778392"
FT                   /locus_tag="AGOS_ABL019W"
FT                   /product="ABL019Wp"
FT                   /protein_id="AAS50752.2"
FT                   /db_xref="HOGENOM:HBG058149"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI0001DB2777"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN6"
FT                   /transl_table=1
FT                   /translation="MRSHRTGTHLLNTLKALHRRNFGDQVQAPRKDGRHIHTVRKPTPP
FT                   TAVPLYEIIRNLPNLFPLPTSQSWEDYKAFKSDREAFQVGLLSTLPFFERAREGKIGKI
FT                   IRTPVDDEGNYINEFCIRPASMEENHGAATNHLIFIHGYGAGLGFFIKNFEHLPLLDDQ
FT                   WVIHAIDLPGYGYSTRCQFPFDVNTHSVREVEAWFHERLETWLSKRGLLQAPHRNMVMA
FT                   HSMGAYLTAHYAQSRQNHFKKLIMCSPAGISPSKSMKKQPPWWFIKLWDRNVSPFSLVR
FT                   NSGPLGSKLTSGWSFRRFRHLLNEGEIGMRQFEALHKYSYAIFNMPGSGEYLLSFVLKC
FT                   GGDPRIPLLGSMFSPEKEHGFKAQCEWLWLYGDHDWMDKEGGQRASSYITDRIGGKSRV
FT                   EIVPNSGHHLYFDNYSYFNKILLREMQSMMQT"
FT   CDS_pept        complement(363480..365573)
FT                   /codon_start=1
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625842"
FT                   /locus_tag="ABL018C"
FT                   /orf_name="AGOS_ABL018C"
FT                   /product="ABL018Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50753.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG266050"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00002525F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN5"
FT                   /transl_table=1
FT                   /translation="MKSASVIVGEPAGPHETAPRRNSKCPDAVVERPLGFSCNTVYEFA
FT                   LEAMERGGRQRAMGWRETVEIHEDRKMVTKVVDGKETEVEKTWLYYEMGPYQYVTYDQL
FT                   HVEMHDYGRGMVKMGLQPGGEDRLHIFGATSHRWMRTFLAAQSQAITVVTAYDTLGESG
FT                   LIYSLQQTGSKAIFVDNNLLEKLVKPVQEIPDLKYVIHADPLDPEDKRYGGRMYSDAQK
FT                   AIDRMKEVRPDIEVYSMDEVVELGSLCRDSIFVHRPRKKDLACIMYTSGSTGDPKGVSL
FT                   THANIVAGIGGVSVVINRAIVKPDDRVIAFLPLAHIFELVFELTCLYWGALIGYGSVKT
FT                   LSEASVRNCKGDMKEFRPSVMVGVAAVWEGVRKAIVAQVTKLPPFKQKIFWAAYHTKLR
FT                   MKKCHIPGGDLIGSMIFKKVRETTGGNLRYILNGGSPLSRDTQVFISNLICPVLIGYGL
FT                   TETVANGCIVPPHHFKYGVVGDILGSLTVKLVDVEELGYLAKNNQGELWVKGPAVFKDY
FT                   LQNEAETAAALEDGWFKTGDIAEWTKKGQLRLIDRKKNLVKTLNGEYIALEKLECIYRS
FT                   NKYVANICVYADQTKVKPIAIVVPNVNAVTDLAISLGLIKDGCEVRDVYDSKKLKKVIL
FT                   DDMHKTAKGQGLGGIELILGFVIFDDEWTPQNGYVTSAQKLQRRKILSAVQSEVDALYA
FT                   ANS"
FT   CDS_pept        complement(365938..366921)
FT                   /codon_start=1
FT                   /gene_family="HOG000066052" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931372"
FT                   /locus_tag="AGOS_ABL017C"
FT                   /product="ABL017Cp"
FT                   /function="nucleic acid binding"
FT                   /function="ribonuclease H activity"
FT                   /protein_id="AAS50754.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="HOGENOM:HBG542276"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001DB2778"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN4"
FT                   /transl_table=1
FT                   /translation="MRPKRPASKFYAVHRGRQPGVFRDWPACRDQVTGVRGARWAAFRT
FT                   LHDAEQFVRSGKRAAPAAPAAPAAPAAPAAPAAGRAFYGVHSSNPAVPSAVFDTWAACQ
FT                   AHVHRQRGVAFRKFPTRELAQNFAHGTAAHDWALLGSSPAEFARAHKLPPPPAPFSARS
FT                   VVYCDGSALANGSARATAGIGVYFRDEPHLSLSEPLTLPPYTNNRAELLAASRALELIW
FT                   RNLAAVPAAAPRALYVLRTDSEYVVRLLSALYRAYDSPAALAAVSNGDLAVPLVQNYLR
FT                   VKHWYLLNTACFHPPAEFALEWVRGHDNEPGNEEADRLAREAAASV"
FT   CDS_pept        complement(367023..371009)
FT                   /codon_start=1
FT                   /gene_family="HOG000142353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763593"
FT                   /locus_tag="AGOS_ABL016C"
FT                   /product="ABL016Cp"
FT                   /protein_id="AAS50755.2"
FT                   /db_xref="HOGENOM:HBG058150"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008528"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR014770"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="InterPro:IPR019558"
FT                   /db_xref="UniParc:UPI0001DB2779"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN3"
FT                   /transl_table=1
FT                   /translation="MRLREASGGSSRRSDERVKSFLPSVEESYKPDVSKAELYQSLLKV
FT                   VLLEYINEPRFRRQYQRLNDVETGELFPRERQPVRSRDDRKRATWFWPNGELESTEGNA
FT                   LKKVRPILEGRLSDIAIGKYKIRSDFLRRSLLKLYNDLYLDPNMSNLLENMGRFEELIM
FT                   LFAKAASGEMMKLDVEDTQKELYQQVSQFIDILIDLLARCEVSTPEFVSKLRSYTDSFK
FT                   PEDGEGSIRSRSSQGVPAVGGNCIEVTVKPAFTVSEISHSVYIMELFGVDEKQFMADVL
FT                   HLKDGIKNDYYQYELDAIKHSIKSNGGFTADDFPTKELYEQWKEYELHAIDDLINRLEE
FT                   NKARHNESLSKKAGVKVIPANSRGMLVKLLCILLEREQPSQTSPLSSDAQFLISKCARY
FT                   WRLDYFSTRVSLFYTAYNLTLLDDGEMLKDDIEHLVQAAQSKGAQVSDTEFNSTNWNAV
FT                   DRHQWLINLNHTFISCMNVLHLMLSGIYSKPKPKFSPVLNIYYNYVKTDPLMIQYNFPE
FT                   TDFYGKWMKQLKRCLTHTSEDYYASLVKQAKKEPFGMYSIQDIAEGIVQQLKIIQKRYP
FT                   KPLLDEINITRTCAVVTIQKFLADLPEFINDAEQNALAENTEVLPAVALEAYRAIQELK
FT                   DIWVQLKPKDLSFNTAVHDPFYKYLERLCADTCVRVHEVIHNSLKEETWEPIDESHHYS
FT                   SSVLDIFKMMNESVQIFEKLQWENEYEIAKTKTRLLKSFSDGLCQYAAKVLAIIEEDLS
FT                   QADSALHSDDNSYENLITLQGTAERMKNTWLFNEMRNALMPALAEPPETYEFKQRTCVC
FT                   LNNLSEMMQKINDLEETVNAEKISDTISKHQVKVEDKKDRSDKAVPQLYTIRIVKAENI
FT                   LSFNSDGSSNSAVTLVDTSVQREIAKTKVVRKTVNPMWDELFELVVPAGEARMISATVW
FT                   HHSAKINPVSSYKVCGKCSLLLDPTVYRSDGYPQETNLDLDTQGRLILQVSLESERFDA
FT                   MFCVGRAHRALSRACDRAIGLMVSKFTAFVNFSLSRAALKTVVSSTTASAPGGAGTKTN
FT                   VVYDAILPLFDYLNSNLAILATELTRSLLHKVMLQAWNTILHSADALLLPNLSCARSRK
FT                   KVMSSKSMTLWENAMSMAKGDSSDSAAAAATIPGFGSALTPREIDVVFDWLRALCVDFF
FT                   HNGGEGPPLHDLKNQHYQNLLLVPVFYDKAADELQAEVERLMPFYEQYLDRRNYFDFGR
FT                   HTASRPALPKGSLARKDSVWAHSSRRKRAQVAAAVRQLEHDPLEVAAVTQDILLRILLL
FT                   RGRAAYVQDTLSRRAELAKAIATRKLVRAAVQGRGAPLRKPDRT"
FT   CDS_pept        join(complement(371868..371876),complement(371207..371812))
FT                   /codon_start=1
FT                   /gene_family="HOG000000765" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763594"
FT                   /locus_tag="AGOS_ABL015C"
FT                   /product="ABL015Cp"
FT                   /protein_id="AAS50756.2"
FT                   /db_xref="HOGENOM:HBG058151"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniParc:UPI0001DB277A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN2"
FT                   /transl_table=1
FT                   /translation="MIDAILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALILER
FT                   FDLLRDRQSKVLSQEELVQRDSEMAAALVRGDAGRAKRPRKRDADKPRKKRANQSDNPN
FT                   SFHMRPVQLSEPLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVF
FT                   GKKMTMFSMNKILSQHLTNPKDVSGSDQDANTEEHSDQLSA"
FT   CDS_pept        complement(372109..372726)
FT                   /codon_start=1
FT                   /gene_family="HOG000180297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763595"
FT                   /locus_tag="AGOS_ABL014C"
FT                   /product="ABL014Cp"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50757.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG268253"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniParc:UPI0001DB277B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN1"
FT                   /transl_table=1
FT                   /translation="MSSSSAEKSELPVTVEKPIPVTYDLGNLAVFDSNALDRNDLDSSN
FT                   ANREEHLRALTRDNVQLLINQILSLPIKSTTDSTGSGQSSSIALVRLPEPTTDLPREKP
FT                   LPKPKAPTKWELFAAKKNIKPKEKSGKMVYDEAAGEWVPKWGYKGANKKLDDQWLVEVD
FT                   DKVKGTEDELIDPRTLSRAERKKLIKKNELQHKRNLKNAVSK"
FT   CDS_pept        complement(372922..374889)
FT                   /codon_start=1
FT                   /gene_family="HOG000142005" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763596"
FT                   /locus_tag="AGOS_ABL013C"
FT                   /product="ABL013Cp"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50758.2"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG058152"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniParc:UPI0001DB277C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DN0"
FT                   /transl_table=1
FT                   /translation="MIKSKNSIYQLAYPATGEMTPIRDYAAECQLQNRNLQQGKVRRNP
FT                   YSESLWEALGENKRTIQRINTQVRNRHRPRSLKLEQEADIPVRKKVDSPLNLRTFGDYM
FT                   TLKSPKVDPKLLNTLDVVKRLVQTEREYIKKLELGNSVYRFELQAKKVGSMLLDKERND
FT                   ELLLFGDLETLASVSKILVKQLEEKIAEAYGGDKGDSDQILKELRVHPDKLRAFIERLD
FT                   IGTVLEHHFERIKYLYLTYSVNHQKQLELLQQIRRKHSTIYFKWYDRCLQKADLIKLED
FT                   ILKLPVERLRTWGAITEQVLLYTEGISSDLATAQLSDFYDQYCVYLRGVSTSERECNCE
FT                   AKANLELTPTQIIHFYECSVDPEVSAIDIKRKKSQSTALSVNTGTSSAYSEPNVLPSNK
FT                   ISDCKSPDSDYADLDRSICQFFSVRKGLQDLLVELEQLDLAEIICQQLANAKTWHRLMD
FT                   FEPHNENCNNSIYISSIYTAFIDKLNHQREEISVLRVKHLKKGVIDPLLVLLARTDSVR
FT                   GKIDDLKVLSKEYKAYMKQRDYHDIKKKVMAQSFEDAQALLAKELPQFMAFMHKSISYL
FT                   LLRYHSLVLEYLKILCGGEKLLKKELTFFEESERELGDNFDILQMFSSSRFYTKQAVRG
FT                   NWQFPGIPSASRVLRKLFEL"
FT   CDS_pept        complement(375050..378115)
FT                   /codon_start=1
FT                   /gene_family="HOG000074719" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082739"
FT                   /locus_tag="AGOS_ABL012C"
FT                   /product="ABL012Cp"
FT                   /function="zinc ion binding"
FT                   /protein_id="AAS50759.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG023983"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016528"
FT                   /db_xref="UniParc:UPI0001DB277D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM9"
FT                   /transl_table=1
FT                   /translation="MSFNSQRQFQLFEITPIRDPNFGTDTPLYSDPTLSAVTPLGNGTI
FT                   AIAVRSVYIQTIDLKTPASLAEFKAYGDDYQITYLEYVKDGMLVSVGECVGKPTSIKIW
FT                   NLGKTPKDAFDFHSTCEVRNGNNTFPVSAISLSQDLSCIVLGFVNGRIILVRGDLYRDR
FT                   GSRQRIIYEDLNNEPITALFLNNDYSVTFASTTSRIMLFRTTGRNNGEPERVLNANTGI
FT                   DLNCSCFNPERDELLCCLDKSVEFYKATGEKHSLLVEVPMKKRIFLIDNDHILLLSSVS
FT                   TPNSTALQLSSTGTITKKVLILDLKNQLIAMNHLLASNIVHIYSDTVDGVYSVYLVTTD
FT                   GVINRITEKPVDKQIKLITQRELYPIALQLAEQRSVSPLRIQEIRRQYGDALYKKNMKE
FT                   EAVEQYIQCLDITETSEIISRFGIQKTSRPDDSRNLATYLWSMIKQKLSHSDHVTLLLA
FT                   ILIKLKDVDGIDYFISHFSRNGEFVEEGEDESSWSVDDETFFYSDIVLMDLDTILQLLK
FT                   DSELDAQAFSLVHKFSKDPIQVVDVILNTLDDPHSALKYIKSLHVDDTLRVLIEFSKVL
FT                   LEKLPNDTNALLIDVFTGRYQRSTKCEVNIREKKQTISRNNPVFHSYKAFVTYMYSTAG
FT                   GVPNSEDIQEPTYHPPKPSLVFTSFIDRPFQFVVFLEACLESYNKFQGFLRDKQEILTT
FT                   LYDIYLSLAATDEAHNEDWRTKATAVYKESEKLAGTCRSPQAPKASNTQFDNSLMMLIS
FT                   HINNVDLYSVEGDASGTEDLSVNKANLTNTFRSMCLTKEAKKCMNFLEKYGSVEPELYR
FT                   MALGFFLSSKQVYDSIGGAPVFKARVLDKVIEMDLLQPLDILFVLSSTSVATFGLVRDF
FT                   LINHIKAQQRETHNNEKLIQSYQGELQEKEMQLKTLLSESEPLQVKVKNNFCKMCHTLL
FT                   DLPVIFFKCGHIYHQRCLPEDSISDGNGSPHYRCPNCAVDIEASENLIKPKKDNDTKAS
FT                   LLQAALSSEDSSGDRFKVVSEFIGKGGLEFGT"
FT   CDS_pept        complement(378259..380361)
FT                   /codon_start=1
FT                   /gene_family="HOG000172453" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625843"
FT                   /locus_tag="AGOS_ABL011C"
FT                   /product="ABL011Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50760.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058154"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB277E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM8"
FT                   /transl_table=1
FT                   /translation="MATVGASVEQFLQDINCEGYLGAFRKYEISSVDQLQHLDHEILEQ
FT                   VGIRSIGDRIRILNKSRTLQAGRDKGLLEELQQVIGKINALSAGPMAISEELVTDRHSV
FT                   IFILNDGSAKKVNVNGCFNADSIKKKLIKRLPPEFVAVAQNGEETSSQDYDVFVVDYAK
FT                   NVLHLLYDVELVTICHSSDRVEKNRLIFVSKDQTPSDKAILTSKKLYLKTMSAIHQLGS
FT                   LPTMLQTQGATTVGNYATPGAEAPAGDEDSLRIDNSKESLRRIFNQRPPSELISTNLPE
FT                   YFPHTDFKRLQKTLRSSFRQSVRMSMLRPGAPLPEGNNVGNILVNQNQAVDRALLQSLD
FT                   GTKTSSRSSGRSSVDGDASSMGSERRTNASKSTTLDGRDSDAGGRIELLNSESESECDD
FT                   DNIVSLPTKVVTPKSWLKGARIGSGSFGSVYLGMNAQTGELMAVKQVELQPTTVMAPSD
FT                   DKKSQPSSNAVVKNSQIHRKMVDALQHEMNLLKELHHENIVTYYGSSQEGGNLNIFLEY
FT                   VPGGSVSSMLNSYGPFEEPLVKNFTRQTLVGLTYLHRKNIIHRDIKGANLLIDIKGSVK
FT                   ITDFGISKKLSPLNKKQNKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCVVVEMFTG
FT                   KHPFPDFSQMQAIFKIGTNTIPELPSWASDGAKAFLYQTFELDYKKRPSSVELLQHKWL
FT                   DTTTML"
FT   CDS_pept        380482..380961
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082740"
FT                   /locus_tag="ABL010W"
FT                   /orf_name="AGOS_ABL010W"
FT                   /product="ABL010Wp"
FT                   /protein_id="AAS50761.1"
FT                   /db_xref="HOGENOM:HBG058155"
FT                   /db_xref="UniParc:UPI00002525FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM7"
FT                   /transl_table=1
FT                   /translation="MARGLLTSDGCTRSAAQGRHPCSFLPNEVSRPITRPLPLSANSHD
FT                   SDTMPDTAKDEVPDRVLFQRGGRTLEVHGARFMRPHTVVKPWEQKSHAPAEDASSSLLQ
FT                   AGGHRPAPAGAAGHATDSEKEASGRAGRKDTSEGQGGDVSPRAARSQPRGGSAEH"
FT   CDS_pept        381099..382808
FT                   /codon_start=1
FT                   /gene_family="HOG000192313" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763597"
FT                   /locus_tag="AGOS_ABL009W"
FT                   /product="ABL009Wp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS50762.2"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058156"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0001DB277F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM6"
FT                   /transl_table=1
FT                   /translation="MAAYLPRKVIRNAVLLVNVVFLLLLCYLLFWLGSDVLQREQHGGG
FT                   AKITRKPVMPPELAPELAPIAEESLVVNLGKLHCFHLWGLPEACWAFQRVFRRTAFDMV
FT                   AQRTWVPKNLIVSRAASRFGRSEYLYYDWITVGQLAEMSQEGLPPGSRGIVDISARKLE
FT                   NSVSVGRLYVATEPWDLAQVGRGRYVSAVTALFGEDCVEPRINWRRDDTPYRNNGGMPV
FT                   YVDVARAQVNSVQEKPRLRVDPDGKFKVVQLADLHLVPGKGECRDEFPPTENCEADVKT
FT                   MKFVNDVLDIERPDMVVYTGDQITGDLCDNDAETPLLKAFAPAIQRRIPFAVIWGNHDD
FT                   AGSLNRLQLSQYVEALPFSLFKIGPRDTMDRSFGMGNYVHQVLGENGHPEITFYFVDTH
FT                   SYAPNPRGRRVYDWVKEEQWQYFEDCHAKLEHTELSLAFLHIPLPEYLDVKSKKDPQKY
FT                   NQFLGTFREGVTAPRHNSGGAERLARLGVSAVTAGHDHCNDYCLQTDFRDIDPKIWMCY
FT                   GGAAGEGGYGGYGGTERRIRIFEIDTREKRIETWKRLNSSPNDKFDAHLIYP"
FT   CDS_pept        join(complement(384020..384058),complement(382795..383970))
FT                   /codon_start=1
FT                   /gene_family="HOG000154825" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763598"
FT                   /locus_tag="AGOS_ABL008C"
FT                   /product="ABL008Cp"
FT                   /protein_id="AAS50763.2"
FT                   /db_xref="HOGENOM:HBG058157"
FT                   /db_xref="UniParc:UPI0001DB2780"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM5"
FT                   /transl_table=1
FT                   /translation="MATMSSPQPYLLHRRLRHLRSISVCNASLVRGDTGLDMRWRLFPC
FT                   FVVVEDTHGRVQYVSEVQEGRHSVVRFNELPVLEAAESQVVLRLVGQLPEPEFAGEWAE
FT                   VARQQVDLNALHYVGHVELVDGLRELNVPVLEFADGHFAAARVPGRLADGAPGKFPARR
FT                   SFSFNALLKLNKILEYMSQVEKESQQLVRQAEALLGQSESKQLGPGLDSAFGELEVQRK
FT                   RKLAQLSALQDHACRLQANPDDEESFDSDYGSMYSELIQKKQRVHLLQERKLQRLIEIF
FT                   TNTSLFSSPYVVVRTSTDSSPYDISLGKLELQTILDVDDRISINTILGYYLLFLDILAG
FT                   KICYIPLPHRLAYYGSTSIIDNKFPLYLPTSSTQHHLDRFSEAVHLFNINIIQVRQFLN
FT                   NLKDK"
FT   CDS_pept        384268..384993
FT                   /codon_start=1
FT                   /gene_family="HOG000000953" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625844"
FT                   /locus_tag="ABL007W"
FT                   /orf_name="AGOS_ABL007W"
FT                   /product="ABL007Wp"
FT                   /protein_id="AAS50764.1"
FT                   /db_xref="HOGENOM:HBG058158"
FT                   /db_xref="HOGENOM:HBG204355"
FT                   /db_xref="InterPro:IPR021713"
FT                   /db_xref="UniParc:UPI0000252601"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM4"
FT                   /transl_table=1
FT                   /translation="MSSLLVSLTHFCDKHGPKLLVVTQCAKSAEECEKLLLPNYPSDSY
FT                   CDSCHISFPTDQESKSIRSTIGERYYVSTHYSAVRYQYLTALVKKIFSEETVSYDGSPL
FT                   LFYDHARGLNLAMGFKLEDPHARGNERRYCLVLTVDLRERAPAMEIVSQHWKFISGAFE
FT                   NMIEYIKQQRRAELLRVMQQGQVQGTSNFSSMVSGTYLRGNNLKIPKNITELTNDRLLF
FT                   VRIHKWNAFILDRLGGQLD"
FT   CDS_pept        complement(385128..386576)
FT                   /codon_start=1
FT                   /gene_family="HOG000033915" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931373"
FT                   /locus_tag="AGOS_ABL006C"
FT                   /product="ABL006Cp"
FT                   /function="N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-
FT                   forming) activity"
FT                   /biological_process="purine ribonucleotide biosynthetic
FT                   process"
FT                   /protein_id="AAS50765.2"
FT                   /db_xref="GO:0004018"
FT                   /db_xref="GO:0009152"
FT                   /db_xref="HOGENOM:HBG171016"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniParc:UPI0001DB2781"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM3"
FT                   /transl_table=1
FT                   /translation="MSEFDKYATPLSSRYASEEMSSLFSLRHRFSTWRKLWLNLAIAEK
FT                   ELGLSVITDEAIAQMREHLTITDEEIAQAAKQEAIVRHDVMAQVHTFGETCPAAAGIIH
FT                   LGATSCFVTDNADLIFMRDAYDIIIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLT
FT                   TLGKRATLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKR
FT                   VTELLGFDIVYPVTGQTYSRKIDIDILAPLSSFAATAHKMATDIRLLANLKEVEEPFEK
FT                   TQIGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFERTLDDSAIRRISLPS
FT                   AFLTADILLSTLLNISSGMVVYPKVIERRIKSELPFMATENVIMAMVEKGASRQEVHEA
FT                   IRVLSHQAAAVVKEEGGDNDLIERIKADAFFQPIWNELDSLLDPSTFVGRAPQQVEKFI
FT                   NNDVKSALAPFSEHITDAAFNLNV"
FT   CDS_pept        complement(386882..389431)
FT                   /codon_start=1
FT                   /gene_family="HOG000247903" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763599"
FT                   /locus_tag="AGOS_ABL005C"
FT                   /product="ABL005Cp"
FT                   /function="DNA binding"
FT                   /protein_id="AAS50766.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG190514"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI0001D62CF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM2"
FT                   /transl_table=1
FT                   /translation="MLLRDQLKVLLDGVFDLKEENGIEILPIFYTLPLRKDYPDYYRII
FT                   KKPLSLATVKKKLNHYKRAQEFVNDLVRITWNARMYNTKESEIYHYAQIMDRYVREVVI
FT                   PRIEREMGPVKYPYLGPLPDEQPLPGALLERDDDETGAKDDSLLPETVDEEKDATADEE
FT                   EPEASMVPEYDDDEEYTEEKRRLPKLRIPVMITPTPSAVSKSTTPQPSFQRHQAQKTHM
FT                   RRGRPPVIDLPYEQRIKNVLKNLKRETLSGSREFLTLHFDRLPDEEREPQYYTVISNPL
FT                   SLDDIRKRVKQRKYKDFLAFQQDVGLMLNNYRMYHRSQPQEMRRAAEFEAKFTDFAKYE
FT                   LSRPDEDFMTDGELKYPLDHIELHDKTYKIGDWILLHNPNDETKPTVAQIFRLWHTNDG
FT                   RRWLNCCWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHLVEEIIGKCYVCHFTRYQRGDP
FT                   DLMLEGPLFVCEYRYNESEKVFNKIRTWKGCLPEEVRDIEEPTIPVIGRKFFKYESPIK
FT                   HLLPPNATINDPIPQPTEGAVNAPPLVGAVYLRPKIKKDDLGEYSTSDDCPRYIIRPGD
FT                   PPEVGRIDPETGTIITNSQTASVLPKMNMSTPRLSSLNRNGSYSNLIGRSGSPINMTRS
FT                   TQYFPPVPNGDLRNLPIVQQIPNSTIPSAQSSAKGGIQGTMGGSINGTTPAYQPPSIIN
FT                   NLAAQAKTNNTVLGNILVDTPGAYVLPISITKNVEVLQRTDYNNQVRRLGKEQVPKKRK
FT                   NKGEVLWFKGASVVCYERLLNTGGDTDVPLNRWFKKKRKLDYEEVDEEVGDGTQVENGS
FT                   NDEYDSQDEHTELPGTFPMGLRPSAKYMSYKIASGRC"
FT   CDS_pept        389708..390667
FT                   /codon_start=1
FT                   /gene_family="HOG000085950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082741"
FT                   /locus_tag="ABL004W"
FT                   /orf_name="AGOS_ABL004W"
FT                   /product="ABL004Wp"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50767.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG267174"
FT                   /db_xref="HOGENOM:HBG641281"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI0000252604"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM1"
FT                   /transl_table=1
FT                   /translation="MASQEEQLASFQRCLQGARKILCIVGAGLSASSGLTTFQAAHGEW
FT                   RGHSALELATPEAFQENPELVWVFYSARRYTAMKARPNNGHFALAELCRRVAADERREI
FT                   LLVTQNVDGLHWRAGQPEASTVELHGSVFDYRCTEFLCSYRGRNVRDHFLTAGLRAHTP
FT                   RELPRPAAAEEPENKRAKHACEGTPETLRSRLDMLRGDLPRCPRCRVGLLRPGVVWCGE
FT                   SLSLVQMDRVDAFLSAKQKVDLVLVIGTSGRLWPAMGYVERAQLCGSRIAFFNTDIEDA
FT                   AGVAKNKRMWAFQGNAAELLPQALEPVIGRHYKPRGWS"
FT   CDS_pept        complement(390859..392544)
FT                   /codon_start=1
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082742"
FT                   /locus_tag="ABL003C"
FT                   /orf_name="AGOS_ABL003C"
FT                   /product="ABL003Cp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50768.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177066"
FT                   /db_xref="HOGENOM:HBG448377"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000252605"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DM0"
FT                   /transl_table=1
FT                   /translation="MSQGTIFSQLKIRKKRQEVAFFESNADANDVEAGEHFITELDKGD
FT                   KRLGLFSSIGLICNRMLGTGIFVVPAKIFQLTGSVYFALGLWVLGALIALAGLYVYMEF
FT                   GTAIPRNGGEKNYLEFIFKKPKFFITSMYSAYVIFLGWAAGNSVMAAAMFLDAGKVEAT
FT                   RWRERGLGVAVIFFCFLVNSLSVKAGLYFQNILGVFKIGTIIFIAITGLVALGGHIDGA
FT                   PGTENFRHSPSDLSPSAYTIVNALYQVIWSFVGYSNVNYALGEVKNPVRTLKIAGPSSL
FT                   AVLGTLYLLVNVAFFAVVPMEILKDAGMNLTPKFFDIAFGDKARRASAIFIGLSALGNV
FT                   CSVIFSQGRIVQQLGREGVLPFTSFFASSKPFNSPMAGLFQHMIICAITILAPPPGDAY
FT                   DFVLNLISYPMNIINFILACGLIWIYWQRRQSKLEWNPPIRAGYFVTSFFLIANLYLIV
FT                   APYVPPPSGSSVYKSLPYYIHCVVTWAIFAVGSIYWLIWSRLLPKWNNYELVHSEVLGE
FT                   DGFWRNKIVKKYAGEDSVSTPDGGSDSTLKEGFSGIGVKQSIVQ"
FT   CDS_pept        complement(393175..394971)
FT                   /codon_start=1
FT                   /gene_family="HOG000204376" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778393"
FT                   /locus_tag="ABL002C"
FT                   /orf_name="AGOS_ABL002C"
FT                   /product="ABL002Cp"
FT                   /function="RNA binding"
FT                   /function="polynucleotide adenylyltransferase activity "
FT                   /biological_process="RNA polyadenylation"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50769.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004652"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0043631"
FT                   /db_xref="HOGENOM:HBG134242"
FT                   /db_xref="HOGENOM:HBG594063"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007010"
FT                   /db_xref="InterPro:IPR007012"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR014492"
FT                   /db_xref="UniParc:UPI0000252606"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL9"
FT                   /transl_table=1
FT                   /translation="MSQQKVYGVTGPISKEGPTAAENKLNDELIQELKKEGTFESEEET
FT                   AKRIKVLEELQALAQEFVFKVSRKRNMSEGMARDAGGKIFTFGSYRLGVHGPGSDIDTL
FT                   VVVPKHVTRDDFFTVFDELLRARPELDEIAPVPEAFVPIIKIKYSGISIDLICARLDIP
FT                   QVPLNLTLSDKNLLRNLDEKDLRALNGTRVTDEILELVPKPTAFKIALRAIKLWAQRRA
FT                   VYANVFGFPGGVAWAMLVARICQLYPNACSAVIVARFFHILTRWSWPQPVLLKPIEDGP
FT                   LQVRVWNPKIYANDRLHKMPVITPAYPSMCSTHNICESTKKVILNELQRGVEVTTDIFT
FT                   NKKTWGDLFQKHDFFYKYKFYLTVMASTKGSDEQHLKWSGLVESKLRLLVLKLEVLSGI
FT                   NLAHPYTKPFESTYAYKTEEQYKEIFDNYGTHKTEDVLKKYTEVTNENKDDESLKGMEK
FT                   VHITTMYIGLNIAVDEKKKIDIHVPCQEFFNLCRSFQEYEDTETFSLVIKYVKLYDLPD
FT                   HVYDEGEQRPVKASKKRKNEKAGKKAKRPKSSSVLAADAEDSTMADGSTVSEEPQPPLS
FT                   NTTAPSTNTGAELSVAAGGAST"
FT   CDS_pept        395827..397884
FT                   /codon_start=1
FT                   /gene_family="HOG000161068" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082743"
FT                   /locus_tag="ABL001W"
FT                   /orf_name="AGOS_ABL001W"
FT                   /product="ABL001Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAS50770.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG326669"
FT                   /db_xref="HOGENOM:HBG434086"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI0000252607"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL8"
FT                   /transl_table=1
FT                   /translation="MDEHLIATINKLQDALAPLGGGSQSPVDLPQITVVGSQSSGKSSV
FT                   LENIVGRDFLPRGSGIVTRRPLVLQLINRRGKKGDKRNAHGDLLELDVAADQKTGQSED
FT                   NAEEWGEFLHAPGKKFYNFDQIRQEIVNETEKLTGKNAGISPIPINLRIYSPHVLTLTL
FT                   VDLPGLTKVPVGDQPVDIESQIKNMIMQYISKPNAIILAVNAANADLANSDGLKLAREV
FT                   DPEGTRTIGVLTKIDLMDEGTDVVDILSGRIIPLRYGYVPVINRGQKDIESRKTIREAL
FT                   NDEKRFFENHPSYSSNANYCGTPYLAKKLNSILLHHIRQTLPEIKNKIELSLKKYQAEL
FT                   LALGPETLDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVFHEIFKGG
FT                   VYALDPFDQIKDSDIRTIMYNSSGAAPSLFVGTEAFEVLVKQQIQRFEDPSLRLVALIF
FT                   DELVRILREIISQPKYARYPGLREAISNYFIQYLKERIIPANDFVVDIIKSEQTYINTA
FT                   HPDLLKGSQAMAMVEERLHPKQVDPKTGKSLPPTVQHTDKGSSGIFGGFFASKNKKKLT
FT                   ALEAPPSVLKATGQMTERETLETEVIKLLIESYFSIVKRTVADLIPKAVMLKLIVKSKN
FT                   DIQKILLEKLYGNQDIEELTKENDITIQRRKECHNMVQILKHASEIVSSV"
FT   CDS_pept        join(399480..399592,399651..400185)
FT                   /codon_start=1
FT                   /gene_family="HOG000228204" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625845"
FT                   /locus_tag="ABR001W"
FT                   /orf_name="AGOS_ABR001W"
FT                   /product="ABR001Wp"
FT                   /function="ATP binding"
FT                   /function="adenylylsulfate kinase activity"
FT                   /biological_process="sulfate assimilation"
FT                   /protein_id="AAS50771.1"
FT                   /db_xref="GO:0000103"
FT                   /db_xref="GO:0004020"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG309946"
FT                   /db_xref="HOGENOM:HBG384814"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="UniParc:UPI0000252608"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL7"
FT                   /transl_table=1
FT                   /translation="MSTNVTWHANINYDERVSLRNQKGCTVWLTGLSASGKSTIACTLE
FT                   KLLLLEGISAYRLDGDNIRFGLNKDLGFTEEDRNENIRRIAEVAKLFADSCTVAIAAFI
FT                   SPYKADREKARELHKDAGLDFIEVFIDVPIEVAENRDPKELYKKARAGIIKDFTGISAP
FT                   YEAPENPDIHLRTDKETVEQCADHILQFLKKLEILQSSSACSNHSNSVETAV"
FT   CDS_pept        join(complement(400940..400999),complement(400229..400873))
FT                   /codon_start=1
FT                   /gene_family="HOG000177218" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082744"
FT                   /locus_tag="ABR002C"
FT                   /orf_name="AGOS_ABR002C"
FT                   /product="ABR002Cp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS50772.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG202451"
FT                   /db_xref="HOGENOM:HBG464741"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0000252609"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL6"
FT                   /transl_table=1
FT                   /translation="MSLFEWAFGKSVTPQERLKKNQNALDRTQRELEREKRKLEAQEKR
FT                   LVQDIKKSAKNGQINAAKIQAKDLVRTKRYIEKFNGMKTQLQAISLRIQAVRSSDQMAI
FT                   SMREATGLLSSMNRSMNLPQLQRISMEFERQNDMMDQRQEFMDEAIDDAMGDELEEDEE
FT                   AEEIINKVLDEIGVGLNNKLEDAPQGLVKNSAAAEARVAIPVVSNDTGGALSASSNTDD
FT                   ELQARLNSLKRG"
FT   CDS_pept        401207..401599
FT                   /codon_start=1
FT                   /gene_family="HOG000206672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931374"
FT                   /locus_tag="ABR003W"
FT                   /orf_name="AGOS_ABR003W"
FT                   /product="ABR003Wp"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50773.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG313666"
FT                   /db_xref="HOGENOM:HBG756716"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniParc:UPI000025260A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL5"
FT                   /transl_table=1
FT                   /translation="MLYELVSIARVTNPLAVHAEAKQLATTIGKLVIENRGVVRKIIPI
FT                   GNKLLPRIQKKDQERHFQGYHFLMLFDSSAPVQSEILRTLRSDPRVLRASIMKVDTSKK
FT                   LDAVSSLERAAGYGSIPEKAKGGISF"
FT   CDS_pept        complement(402165..403484)
FT                   /codon_start=1
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082745"
FT                   /locus_tag="AGOS_ABR004C"
FT                   /product="ABR004Cp"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50774.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058159"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI0001DB2782"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL4"
FT                   /transl_table=1
FT                   /translation="MKTVVLTAQQADTVDSRMPNWFERVFLAQKPPGSRLANLETSFDA
FT                   NLSIKRLKNHQFTLKEVCHYGFLGAVLFFVFIANPAPWLLKGCVSMLFLALFLMPATGQ
FT                   FFFHALPIFTWLALYFTSASFGSTYRPPITVKVLPAIETIMYGDNLSDVLAASTNKCLD
FT                   ILAWLPYGILHFGAPFVVAAILFIFAPPTTLRGYAFAFGYINLFGVIIQNFFPAAPPWY
FT                   KNLYGLSAAHYGMKGSPGGLSRIDEYLGIDLYTTAFSNSAVIFGAFPSLHSGCATMEAL
FT                   FLAHVFPRLRLLFVFYVCWLWWSTMYLTHHYFVDLMAGSILSYVIFQYTKYCHLPIVHP
FT                   EYFTRWSYAEIKTFDIIQSDPLYHDSSDVEALPLAPLDTDFNFTFEMSSVDEVATPTPS
FT                   IFDEGAPGSASRSSANSIEVPDAEPFRANFVNKMYRQRYD"
FT   CDS_pept        complement(404103..404543)
FT                   /codon_start=1
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082746"
FT                   /locus_tag="ABR005C"
FT                   /orf_name="AGOS_ABR005C"
FT                   /product="ABR005Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50775.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI000025260C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL3"
FT                   /transl_table=1
FT                   /translation="MSAESTVKASNWRLVEVGRVVLVKKGPSAGKLAAIVEIIDNKRAL
FT                   VDGPETGVPRQAVSLGHVVLTPLVFALPRGARTSTVSKKWAAAGVNDKWAASSWAKKIA
FT                   QRERRAALSDFERFQVMVLKKRRGFVLKREVATAVKVAASAE"
FT   ncRNA           404973..405057
FT                   /ncRNA_class="snoRNA"
FT                   /locus_tag="AGOS_AgSNR87"
FT                   /product="AgSNR87"
FT   CDS_pept        join(405380..405415,405480..405737)
FT                   /codon_start=1
FT                   /gene_family="HOG000215577" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625846"
FT                   /locus_tag="ABR006W"
FT                   /orf_name="AGOS_ABR006W"
FT                   /product="ABR006Wp"
FT                   /protein_id="AAS50776.1"
FT                   /db_xref="HOGENOM:HBG058160"
FT                   /db_xref="HOGENOM:HBG398768"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI000025260D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DS5"
FT                   /transl_table=1
FT                   /translation="MSDDRYSQIERGNDRRLDELSNKLSTFRSLNRDIGNQAAADNTLI
FT                   DEIQNSFGALFVNIRNSSSRLSRAILAGNSVWKMVGLSLLILFVLYNVFKLF"
FT   CDS_pept        complement(405817..406602)
FT                   /codon_start=1
FT                   /gene_family="HOG000036539" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931375"
FT                   /gene_name="CAP1"
FT                   /locus_tag="ABR007C"
FT                   /product="F-actin-capping protein subunit alpha "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /biological_process="actin filament capping"
FT                   /cellular_component="F-actin capping protein complex "
FT                   /protein_id="AAS50777.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0008290"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="GO:0051693"
FT                   /db_xref="HOGENOM:HBG352343"
FT                   /db_xref="HOGENOM:HBG397839"
FT                   /db_xref="InterPro:IPR002189"
FT                   /db_xref="InterPro:IPR017865"
FT                   /db_xref="UniParc:UPI000025260E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DS4"
FT                   /transl_table=1
FT                   /translation="MSKFSDIITQLLFDAPPREINSVYDSLVIITEDTDNDTLLDALKR
FT                   CLVAKRLPIDVEGSPTIVTEYNKDGAKYFDPFKKVLFSVDCLDRVGLDIEPHESETTPY
FT                   QEKLYEELQKYVAKNFPGDSACTVLPTGDDDELAIIIVSSKFSPSNYWSGYWKSEYIYS
FT                   PEERSLTGRIDVVVHYFEDGNVKFSTQEFIDKEDINDPISCIRALESEIETGLDESFSK
FT                   LNQTQFAKLRRKLPVTRSKVNWGKAISNYRLGKDAAQGK"
FT   CDS_pept        complement(406771..408102)
FT                   /codon_start=1
FT                   /gene_family="HOG000094361" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082747"
FT                   /gene_name="HSE1"
FT                   /locus_tag="ABR008C"
FT                   /product="Class E vacuolar protein-sorting machinery
FT                   protein HSE1"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="AAS50778.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="HOGENOM:HBG525065"
FT                   /db_xref="HOGENOM:HBG735279"
FT                   /db_xref="HSSP:1SEM"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI000025260F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DS3"
FT                   /transl_table=1
FT                   /translation="MEYKQDIETAVSRATDGKLRTDNWQYLLDVCDLVKEEPEDGAQYV
FT                   MEAIDERLQQADANVILRSLSLVACLSENCGSRVQQAVASKRFTGLLYYLIEDKHVHAT
FT                   VKREIAKVVDQLSSSFQRDPSLKGMSDLLQKIIRRYPHLVAEPKLPQKREMSADAKLQE
FT                   DQDLEEALKLSLQEYEQQQRHNGGQPPQQAPAALASETSLPEQPQPQIVRRVKAIFDLN
FT                   ASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYVGVCPEPTAEEVAKEAAQ
FT                   EHAVFAQAGNVENLLQKLRVSQNVDVTHEDEISELYSTVTPLRPHVTKLIGKYAQKKED
FT                   LASLREVLANAEATYNMMLEKATCYSSSNFMPSTQHRTYQPSGQAAPYSNYEFSQPSTN
FT                   VLPPRPASYSVNPQVTGLPVHQQRSVPENTEIRYRSYSGDLPHT"
FT   CDS_pept        408451..409692
FT                   /codon_start=1
FT                   /gene_family="HOG000216359" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082748"
FT                   /locus_tag="ABR009W"
FT                   /orf_name="AGOS_ABR009W"
FT                   /product="ABR009Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50779.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058582"
FT                   /db_xref="HOGENOM:HBG738741"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI0000252610"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL2"
FT                   /transl_table=1
FT                   /translation="MAENSLLKPPSLSRKRSSSVGNIGLGDTKVPGLSTMSESKESKIA
FT                   ARARLRALSGASKTDIDIYYKLWLSYRELNYRHAWLTPLIILFLIYSCYFASGNRTESN
FT                   PLHMFVAISYRVGNTNMYGKGVKDMCFVFYYMVFFTFLREFMMEMVLRPLTFRLGVTKP
FT                   HKVKRMMEQAYSTFYYGLSGPFGLFVMYRTDLWLFKTAEMYKTYPDLTNEYYYKIFYLG
FT                   QAAFWAQQACILVLQLEKPRKDFRELVFHHIVTLALISLSYVFHFTKMGLAVYITMDVS
FT                   DFFLALSKIFNYMESSFTAPLFLLFVSSWVYLRHYVNIKILWSVLTEFRTVGDYTLNFA
FT                   TEQYKSWIALPIVFGLIFALHLVNLYWLALIFRILYRMLFQGVQKDERSDSESEDNEEE
FT                   LDDSSDETDKKKNQ"
FT   CDS_pept        complement(409885..411060)
FT                   /codon_start=1
FT                   /gene_family="HOG000248605" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931376"
FT                   /locus_tag="AGOS_ABR010C"
FT                   /product="ABR010Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS50780.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG058162"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI0001DB279C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL1"
FT                   /transl_table=1
FT                   /translation="MSLRYSTRAAILRSIVHRHVGARLQSTVGAVPEADEPAPQSQDQH
FT                   LTSPQMRGLMHELANYPVEDFEQLTKVSRPLTTKEKQLDERLEDFLRRFGVENQVLKPL
FT                   EENKSVAATPFTLAGGYSRYPYLAQTSADEPYSKQELFVRQMEHASHTAKLGAEIKEVY
FT                   FPHTDISNPPAIEKLSISKLAAAGVHLGQSTSLWRSSTQPYIYGSYKGIHIIDLNQTLF
FT                   HLKRAAKVVEGVAENGGLILFLGTREGQKPALRRAAERVRGCYVASKWIPGTLTNPIEI
FT                   SSVWGRHEVDFEGNPTGRELTEEENISIIKPDLIIVLNPTENRNALREAMQARVPTIGI
FT                   IDTDSEPSMVTYPVPGNDDSLRSVSLLVSILAKAGERGLANRKEKLAALSE"
FT   CDS_pept        411192..411683
FT                   /codon_start=1
FT                   /gene_family="HOG000142331" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778394"
FT                   /locus_tag="ABR011W"
FT                   /orf_name="AGOS_ABR011W"
FT                   /product="ABR011Wp"
FT                   /protein_id="AAS50781.1"
FT                   /db_xref="HOGENOM:HBG058163"
FT                   /db_xref="UniParc:UPI0000252612"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DL0"
FT                   /transl_table=1
FT                   /translation="MNSRMPEAPPPPRSACQMERALLQLVVEDDAKALVFVLGQDARRY
FT                   FEEELPASPFEFPSPQAVANSRQNVGVMFLDKLQYLYMYLTKLEVDEAPEYRTLVVYGL
FT                   EQLLGAGGELDADQVRLASLIYNTAFRVRVRHGAAVRFVAHGAPHAQLQQLEAHWRLFT
FT                   "
FT   CDS_pept        complement(411742..412452)
FT                   /codon_start=1
FT                   /gene_family="HOG000177263" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778395"
FT                   /gene_name="MRT4"
FT                   /locus_tag="ABR012C"
FT                   /product="mRNA turnover protein 4 homolog "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50782.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG028195"
FT                   /db_xref="HOGENOM:HBG628300"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI0000252613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DK9"
FT                   /transl_table=1
FT                   /translation="MPRSKRSKLVTLAQTEKKGRENKERIFDEVRQALDTYRYVWVLRL
FT                   EDVRTPVLQEIRSAWAGSKLIMGRRKVLEKALGGTRETEYKENVSGLVKQCEGMCGLLF
FT                   TDETPETVTAYFREYRKADYSRAKSRAPLRVEIPAGVVYSRGGQVPAEDDVPMVHSLEP
FT                   TLRNKFKMPTRIQNGKITLEQPYLVCEAGETLDVRQALILKQFGVAAAEFRVKLAAYYD
FT                   GEAAAVEEVRINME"
FT   CDS_pept        412710..416984
FT                   /codon_start=1
FT                   /gene_family="HOG000142004" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082749"
FT                   /locus_tag="AGOS_ABR013W"
FT                   /product="ABR013Wp"
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50783.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG058164"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB279D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK8"
FT                   /transl_table=1
FT                   /translation="MNRGDEEYDQDGDYAVSGMEDFGETQLDSQESGDDDSNAEYSYPE
FT                   EEGDYSNYYNEYGDEDAEEDAEEEEREDTEAVGRGPGGRPDRWVSSLQELLGTLAQGLE
FT                   ARRAGEDGGARRVNLAEVFPEYRQMFGMGGGARGEHGRMQTLVANVVAAAEDPYVAAES
FT                   LREINEQLLMLNPLAAERVVPQGELLLAIIDVLRDERLQGELQLQLIACRCLYNMFEMN
FT                   PEMVSSAVEKDVIPTLRKKLAEISYIDLAEQVLETLEYISRLLGKEILESGSLVECLQY
FT                   VDFFTVHAQRKATTIVANSCARAKACDFKNIEAFFPLLKGVLVNNKDQVILTKMLNALY
FT                   SICGALGASSRAELESLIDLEIIRRVVGVVSSSDIDLDGKLRSIDILSQLATTSPKIRK
FT                   QIIDSCDLSSMLWGCFSEYKKNSTSSLHETLMFVPKQLLASISRFLALLLPIEEEQVLS
FT                   IDHRDDPQAVAISEEYITLVGQLMPFLIEIYLNTVDFDIRRYILISLARIASIMSSNSS
FT                   YVDKQLIGLLSSSITQNKSAYEQDKGDKLVTGGLLIGLLSVSTIMIAKCSQNVLPALRR
FT                   EGTFEILRSLYSYLQQTHDPKGIDEGSEPFDISEDPDDGDDVTHSTSGISSDEDDYDME
FT                   FGEVDVPDQVKPKKIKFAVFRPLTTQYVEKKLWQLCQTLVEGLSSNDESVINELREIEE
FT                   LVSFLHSVDRSEDSPEYWTRTWTAVRDMIFRDNFTISGFEFISTGLSDGICRLIKLHPS
FT                   KSSSCRTAFIQVFSDRLELLVKTLQSALTKLESFEIIDCGTTESRAASLGKQMKLKLEY
FT                   IGDLKKDNIPPMMSSLMVNIHCISSYKTLNEFLKHRVAQSRFLNSILPLSNSIAASDDV
FT                   KTMNFQFQAGDEIISSSETIFGSIFKYMSNAKRSPTQIWSEVQVIKYKRVYEENDDPDI
FT                   TRLYPEHVFDSEELKPIDGILDLLSCCYNIVEDSSLFVNPKLTVKLSRQLEEPLIVASG
FT                   ALPRWALHITRHYFFLFPLDVRMFFLQNTSFGYGRLIQLWKERTENEKYSSSDDQLQQL
FT                   GRPTRHKLRISRENMFLSALKILSKYGSSPSVLEIEYQDEVGIGMGPTLEFYASVSKEF
FT                   ARKSLGMWHGSSVPGDDFLDGLLFPAPLSPKRNGAKIYELFTHLGTFVARSMLDNRILD
FT                   FRFNRVFFDLMHTAARREELDFAHPAKLLESLRLIDPQLAKSLAFVREPRNWPDLESMA
FT                   LSFTVPGYDFDLVEGGANTPVTAANAELYVARVLDAFLGSGVRQQLRAFMEGFSRAFPY
FT                   SSLLVLTPDELSELYGRVEEDWSVETLYSYITADHGYSMDSPTLHDLIAVMAAFDQHHR
FT                   RLFLQFLTGSPKLPVGGFKNLKPHLTVVLKHPEGDLSPDQYLPSVMTCANYLKLPKYSS
FT                   REVLRARIVHAIHEGSGAFLLS"
FT   CDS_pept        417699..420611
FT                   /codon_start=1
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778396"
FT                   /gene_name="STE20"
FT                   /locus_tag="ABR014W"
FT                   /product="Serine/threonine-protein kinase STE20 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="response to pheromone"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50784.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0019236"
FT                   /db_xref="HOGENOM:HBG203842"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB279E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DK7"
FT                   /transl_table=1
FT                   /translation="MSKVSGANETLQGALAPLSHMGGGGDATLLKDEGQVELPRGPGVL
FT                   NVQVLPEEGHAHLQDLEGYKSMDPRQSESASTDVSEMLQHTASLDDPIQFTRVSTSSVT
FT                   SNSSSDPRESGDTQETGSRRGCSTEEQAPAGAERVSGQDQDSWDVEEVVAEPRSGIDVT
FT                   PVGDVTNSTIRASGRSAESTSHYLDEYSDTRYSSSSPSSGSRKLSTTIITPEKNVVAQA
FT                   LHCYADNYESPLNDLMSSGDERSSSVRETSFENASSDTNANLNGGRASTGESMRSPPPA
FT                   TGLPNGFVHTQASAPALPVLPAKSPFRAVQSPFSGTRKSRNSANLAELSLPRTSTSSAS
FT                   SMEQRKSRGGRMKVVLSSFVQNIRRNSQGEKRRSGTAMKISTPYNATHVHHVGVDSRTG
FT                   EYTGLPEEWERLLASSGISKKEQQQHPQAVMDIVKFYQDVTGTSGEDKVFKTFNVSSTN
FT                   ACELSSSPSFKTPSLSSITRFEGSHEAYNSAYHSPMLQSPMGFHDPQHDEKFIPSRPAP
FT                   RPPGGAAPKTDFTSPLAYDSQSATATPKNQRFSNQSSGFFSLARKATLNKNKQQLPPIP
FT                   SAAAASAPITQPGSTANIPYIKPAENPVSAPSKSIPPSLPAVPTPPPPIEKDPPLRDLE
FT                   REREREHSSAKQGQLALERKREEKRRRNQKLQAKLAEICSPGDPSKIYRNLVKIGQGAS
FT                   GGVYTAYEIGTNASVAIKQMNLEKQPKKELIINEILVMKGSRHNNIVNFIDSYLLKGDL
FT                   WVIMEYMEGGSLTDVVTHCILTEGQIAAVSRETLRGLHFLHSKGVIHRDIKSDNILLSM
FT                   DGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMI
FT                   EGEPPYLNETPLRALYLIATNGTPKLKDADSLSPVLKRFLSWCLQVSPNDRATAMELLY
FT                   DKFIVEVAEANASLAPLVKLARMKKLAEKMDADSDDNRTD"
FT   CDS_pept        complement(420842..422560)
FT                   /codon_start=1
FT                   /gene_family="HOG000001083" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763600"
FT                   /locus_tag="ABR015C"
FT                   /orf_name="AGOS_ABR015C"
FT                   /product="ABR015Cp"
FT                   /function="DNA binding"
FT                   /protein_id="AAS50785.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG058165"
FT                   /db_xref="HOGENOM:HBG202317"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0000252616"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK6"
FT                   /transl_table=1
FT                   /translation="MDYMNLGITSRKTGLRVKQSIRRDEHSMENVDDFFAEDDESTVSS
FT                   RRQSRRTSLLSDLKPHLSGAGAAHLFLDEDGFRIPSSAPQPRKQAAWSQRRQTETELDE
FT                   YPPLDPGLPPIEDAFEEEPVAAGKYTGNGTPPYGTKYATRYDIPREEDSDVEESTIRLT
FT                   PTKPTDDDYRDVPGLVDDNETTRDNTSFNTSEHALLEDEMEDDYEVDSADEEDGEYVDA
FT                   VSRAEDSSASEHDDSDDSSASDADDAGLSRQNQRSKNGYMGDSDSEVLDSDEEYIQQQA
FT                   KQLLPSGLDGGRSTGIRRSKRVRVPPLDYWRNEKVVYKRKSDKPVLEIDKIITYDQEEE
FT                   EDEEEVRPKKKNPKTKARPYNYIPTGRPRGRPRKNAPQPATNNNEPNRDLLLKLENGEI
FT                   SNGEWLKHGILKGTVNISADKKGNEIVAFAPGLSQSEQVQESEDEKFTLAVMFDKYREM
FT                   FASGMLILPVDGMKSVSDSYNAFITFYVVQGIVEVTLSENKFICTEGSSFQVPAFNTYA
FT                   FQNAGHNEAKLFFVQVTVPENFDGSNGAAVDLQETSSRRTTGHSLSSSDMSLTTP"
FT   CDS_pept        complement(422768..424075)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763601"
FT                   /locus_tag="AGOS_ABR016C"
FT                   /product="ABR016Cp"
FT                   /protein_id="AAS50786.2"
FT                   /db_xref="HOGENOM:HBG058166"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI0001DB279F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK5"
FT                   /transl_table=1
FT                   /translation="MSPDEAVQFLQELFPDRTASVLAQVLRNANGDVDTACAMLVEREQ
FT                   ATAGKAEQGRQWNLASLMEMFPKISSADIEQTYDACDGDTDLAAMSLLNFQGLSGEDAR
FT                   MQAEYERIVRQQPDVAGRPDSWQDLRRKVADIVKYTGVKEGQAKAAFFKNSCNAPAAVA
FT                   DIISSGVARSESTEQQSPVPAAVAVPGGRVQARAGLAHTVTYSSRPRPPAEAHAASDGL
FT                   AMQRARYVYSPGSPEAIELAELVRANIQLASLSRELLQSALEYYAGDVTRTIETAAFII
FT                   GARPALREPKRRPATTRKVSQPRRPKRPAPPELRNSLFSSTEAYNRALELARAVHSSWR
FT                   IDLHGFLVDDAEALSEYVLASWWQRERELRELHCQRMSQSLALNMPPLTVVTGRGLHSV
FT                   GGVSRVRVRIQRLLDKQHYVYDEEPSYFIVKGRRPK"
FT   CDS_pept        complement(424355..425044)
FT                   /codon_start=1
FT                   /gene_family="HOG000196670" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625847"
FT                   /locus_tag="AGOS_ABR017C"
FT                   /product="ABR017Cp"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50787.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG053958"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI0001DB27A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK4"
FT                   /transl_table=1
FT                   /translation="MGKKLHLKKAQQHPGEPFFPSELHQFLDRAPRESFLPGVECMLDD
FT                   KVILVRKFFTAAVCEQLIAHFSRPNVLELFHQRGSRDYAERLNDRASVTDSETALKLWR
FT                   KLHAVLAQDPHVMQDLRFSGAKGLNPQLRLYRYQKGHHFGKHYDESVSVPGAGRTQWTV
FT                   LIYLSGGDSLEGGDTVFYKYHERGHEAVHPMPGLALLHKHGDDCLLHEAQMVMRGVKWV
FT                   LRSDIIF"
FT   CDS_pept        complement(425326..426174)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778397"
FT                   /locus_tag="ABR018C"
FT                   /orf_name="AGOS_ABR018C"
FT                   /product="ABR018Cp"
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS50788.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG058167"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI0000252619"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK3"
FT                   /transl_table=1
FT                   /translation="MRPEEQQHYFYNTGPDIRDPLGVPAALMHTEPGIRWPPQAEEHGM
FT                   QAQVLSFNDGMCNYPMGAPPETAGYPQDVTPSTGSSSTPPGSSLGSQNHRQFVSPYSQD
FT                   GMLDSLDLIEKKKAQNRAAQKAFRERKEARLRELEQKLKESEQNRDALFREVEQLKREN
FT                   QVINNENRMLLQRTTNNPSAGAAEGPEKFTFPAKDTAISDPTEGGQKQGIQYFAGGKKL
FT                   LTVPATWEYLHKISLQRDIDVYYIMQLLKGAEVCHGFGPAYPRELIDSLVGECLNEDRK
FT                   S"
FT   tRNA            complement(426590..426664)
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        complement(427033..429225)
FT                   /codon_start=1
FT                   /gene_family="HOG000066044" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763602"
FT                   /locus_tag="ABR019C"
FT                   /orf_name="AGOS_ABR019C"
FT                   /product="ABR019Cp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS50789.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG058168"
FT                   /db_xref="HOGENOM:HBG203415"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI000025261A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK2"
FT                   /transl_table=1
FT                   /translation="MRAGARSDRGCGDGEDAVAVGPPGLAAGSLGAGGLFGGGSGDEQE
FT                   HSGAAAAAQERYFVSSSGQVGVLREQAAMERQTVEWTADESYGVDINALLDRIEGAAEG
FT                   AQRAARAPGRVPQALWAEKWRPQRFVDLVGNESNNRKVMRWLRQWSALVFGEALPGRAS
FT                   ANAAAEQPEDPLQRPQKRILLLHGPPGIGKTSVAHVLARQAGYAVMELNASDERGGTRL
FT                   REKVRNCLFNDTFNSQPVCLVADEIDGSAENGLIRTLVDIVNADARATSELLGRLEHGK
FT                   RKRARHKYSGKVLVRPIVAICNNVYARALEDLRPHCQIVAFRPPGELALLERLELVCEK
FT                   EGVPADKKTLKQMAELSQGDIRNALNNLQFMSVTDGTGSPASGRRKDTGVPWFKLCNKL
FT                   FRNNPHAESRAQFQELLSEVELSSSYEKVADGCFQLYPAVKFSDMRLQKPGAISDWLYF
FT                   FDRMSASLYEHNGELLRYCPMAIMEFFVLFSDIANRQDQVIKSMEYEVREKGRRHSAMV
FT                   AATRKGMHPDSQIFTSTEALLLETLPYLDIMLSPDLTAIHDQLTRQKIMDNIVPLLHQF
FT                   GLQLHHIKDTDYRNLLAIQPPFNELVALDPKRSRETASKRPHVLNILLAKLEEEKAKKR
FT                   TVRKVRHAEEDLEVLRRNTPATPADFFKNQYTRLNAANVPVVPAAAPGAPPASTAEGPV
FT                   RRGASPPEPELKIWVKYKEGFSNAVRKNVKWGTLWQ"
FT   CDS_pept        join(429593..429601,429699..430616)
FT                   /codon_start=1
FT                   /gene_family="HOG000196557" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931377"
FT                   /gene_name="SEC14"
FT                   /locus_tag="ABR020W"
FT                   /product="SEC14 cytosolic factor "
FT                   /function="transporter activity"
FT                   /biological_process="protein transport"
FT                   /cellular_component="Golgi membrane"
FT                   /protein_id="AAS50790.2"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG141734"
FT                   /db_xref="HOGENOM:HBG328476"
FT                   /db_xref="InterPro:IPR001071"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI0001DB27A1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DK1"
FT                   /transl_table=1
FT                   /translation="MPTEEELLASYPSKCAAGSLAGTPGNLTSEHEAALEELRKVLKQA
FT                   GFTKRLDDSTLLRFLRARKFDVAAARAMFENCEKWRKENGVDTIFEDFHYEEKPLVAKF
FT                   YPQYYHKTDKDGRPVYIEELGAVNLTEMYKITTQERMLKNLIWEYESFSRYRLPASSRQ
FT                   ADCLVETSCTILDLKGISISAAAQVLSYVREASNIGQNYYPERMGKFYMINAPFGFSAA
FT                   FRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGQSDVSEAEGGLYLSDIG
FT                   PWRNPKYIGPEGEAPKAFSMSPKPESA"
FT   CDS_pept        431173..434418
FT                   /codon_start=1
FT                   /gene_family="HOG000095279" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778398"
FT                   /locus_tag="AGOS_ABR021W"
FT                   /product="ABR021Wp"
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50791.2"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG058170"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI0001DB27A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DK0"
FT                   /transl_table=1
FT                   /translation="MRPDISKPVAIGKPLQINTDFSAPNTPSSGSSEASQSRHDGAVVS
FT                   RGAIIERIRQQRGTFCGEVQWCSNLSLDDWRTHFLEITERGVLTHALDRDSVANLQSTV
FT                   QRQESLMGRAPSASAMASQNSRAPIIKHLQACSLRLLNNHHGPFPILEVGTYHNKIYLR
FT                   IREQRTFLDMFSSLLFWKSLQSTGVFSKFSVVAPIFKAIPEPTNLLVCQFKIYGPLPRN
FT                   KHVPLLSMKRPPLPDNVAHSPEEGWFAAMGMLGSDGVLDLLLQSDGSLLYSIDIKRLLR
FT                   SEIQIMDSSILQKDTFMFIGILPELRKQLGISSKDSMFISRMRTGTVPRLFLQFPLRID
FT                   LEDWYVALHSFAMLEVLSLIGTDKSNELRVSNRFKVNILEADLRMLEMERKRKRSMTEH
FT                   SDGEQAKPNTYSFYATVSIWNQQVARTSIVSGKYTPFWREEFDFNFSVKANNMRVSIRE
FT                   STGDNTDYSDNDTLLGYIEISQDMINDTELNKETRLPIFAIDNKSFQLGTICIKLASSL
FT                   NFVLPSINFSKFESVLKEFDLQVMTNYVYDTAIADDLKLDGISNVFLDVFQAIGRENDW
FT                   FQALIEKELAKFDKSILTNNQNSAPSTHIYNSLFRGNSILSKSIEKYFNRIGQEYLDKS
FT                   IGGIIRRIVAEEDMCELDPARIKEPDEIKKRVILETNQAKLISWAKEIWHIIYKTSNDL
FT                   PDAIKVQLTHIRKKLEIVCGDSNLKTVLNCISGFLFLRFFCPVLLNPKLFHIVEDHPDE
FT                   QKRRLFTLLTKVLMNLSTLTMFGPKEPWMNNMNHFIQEHKDELVDYIDKVTQRKLDFNN
FT                   KILKLSNTVARPKLDMNKEIMRELATNPYLIERYLRETELVNAFVTYRHKISSLNRLDL
FT                   KPVTMDQISRELQSLPISPTDTPNLRIGELEFEKITENNVEVFGQDMLKYLDNDDSSIK
FT                   KQGRALTPEDNADLTMRLEQESDLLFHKIKHLTTVLSDYEYPSDIILGKSEYATFLVES
FT                   VYYDSQRSLSLDCDNMFAKRDGFTKLFQNAQTVNAFFSPVKDAESLNAFIKSIESTTPV
FT                   EDSQENKNMKGKLTRNSPARNTKLSRWFKKVSF"
FT   CDS_pept        complement(434620..437619)
FT                   /codon_start=1
FT                   /gene_family="HOG000205990" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931378"
FT                   /locus_tag="AGOS_ABR022C"
FT                   /product="ABR022Cp"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="nuclear-transcribed mRNA catabolic
FT                   process, nonsense-mediated decay"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50792.4"
FT                   /db_xref="GO:0000184"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG034953"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="InterPro:IPR018999"
FT                   /db_xref="UniParc:UPI0001DB27A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DS7"
FT                   /transl_table=1
FT                   /translation="MAASLENGAKETTPAISNSGSQGLLAQDGGSDRELDFYYNSDGEL
FT                   IKLVADDEKPEEDLGNLVSVAEHACSYCSIDSPSCVVKCNACNKWFCNSKNGTSSSHII
FT                   NHLVFSHHNVVSLHPESDLGDTVLECYNCGCRNVFLLGFVSAKSEAVVVILCRLPCAQT
FT                   RNVNWDTDQWQSLIENRQLLSWVAEEPSEEDQLKACLITPSQISKLEMKWRSNKDATIN
FT                   DIDLPEEQEELPPVLMRYTDAYQYQRSFGPLVKLEADYDKQLKESQALEHISVTWTLGL
FT                   NNRHLASFALSTFESNELKVAVGDEMILRYSGLQQAEWEGRGYILRLPNSFQDEFTLEL
FT                   KPSKAPPPTNLTTGFTAEFVWKGTSYQRMQEALKKFAVDKKSISGYLYYKILGHDVPDI
FT                   EFEVDLPKDFSIPNFTKLNTSQVNAVAHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKM
FT                   HKERVLVCAPSNVAVDHLAAKLRDMGLKVVRLTAKSREDVESSVSDLALHNLVARSSRG
FT                   ELKKLLKLKDEVGELSVKDTRSFVKLVRKTESTILKKADVVCCTCVGAGDKRLDSKFRT
FT                   VLIDESTQASEPECLIPIIKGAKQVVLVGDHQQLGPVILDRNAGDAGLKQSLFERLISL
FT                   GHVPIRLEVQYRMNPYLSEFPSNMFYEGTLQNGVTVEQRTVVDSSFPWPICDIPMMFWA
FT                   NYGREEISANGTSYLNRIEAINCERIITRLFKDGVKPEQIGVVTPYEGQRAYIIQYMQM
FT                   NGSMDKDLYMTVEVASVDAFQGREKDYIILSCVRANDQQSIGFLTDPRRLNVALTRAKY
FT                   GLAILGNPASLCRNSIWNHLLIHFREKGCLVEGTMDNLQLCTMQLTRSKNVNSNSDSRQ
FT                   KNTKWHLESNLPLPEFPISNNREFDSQNLMSFGGQGSNIFAPSSDLSSFMNSNQQYWNA
FT                   PGPELGLPAKERDSEQRGYTSSNVGLDATLARELQQFTASSLGYEANQDSTGTAQFKAL
FT                   NSFQNLNIHG"
FT   CDS_pept        complement(438058..438888)
FT                   /codon_start=1
FT                   /gene_family="HOG000144424" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763603"
FT                   /locus_tag="ABR023C"
FT                   /orf_name="AGOS_ABR023C"
FT                   /product="ABR023Cp"
FT                   /protein_id="AAS50793.1"
FT                   /db_xref="HOGENOM:HBG058171"
FT                   /db_xref="UniParc:UPI000025261E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ9"
FT                   /transl_table=1
FT                   /translation="MPVSSASGSLCPSDSAGTMVPNIQKAQEAGCSFRLHSPQQSAAAE
FT                   TCQCRNGMRIFERSVEESCADVWDSDTSEEERSDAEDDALGDEACAGGRRARAVRAHSG
FT                   ASSALRQTTCARCHKLRAARSAHDEQGQRPRTNSIILQLSRQTTRQSFLDSAAPGHGDS
FT                   ADDAVCHTKSRSSFSAIPTHIYSLERYISAELDSATESFFDTDVKLADTSATNGVSSVA
FT                   SPNFPSSSASISMSLASLSSASNFNDKLSPPPVFLDQRKRRKSHIELALSESFQ"
FT   CDS_pept        complement(439249..440091)
FT                   /codon_start=1
FT                   /gene_family="HOG000160812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931379"
FT                   /locus_tag="ABR024C"
FT                   /orf_name="AGOS_ABR024C"
FT                   /product="ABR024Cp"
FT                   /protein_id="AAS50794.1"
FT                   /db_xref="HOGENOM:HBG516146"
FT                   /db_xref="InterPro:IPR007590"
FT                   /db_xref="UniParc:UPI000025261F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ8"
FT                   /transl_table=1
FT                   /translation="MSERKAINKYYPPDYDPEQAERQVRQLSKKLKTMHRDTVGIRLMT
FT                   PFSMRCLKCSEYIPKFRKFNGKKELLPERYLDTIKIYRLSIRCPRCNSTISFRTDPNRG
FT                   DYTMEAGGERNYVRDDARSPHIKPDETTDETLQRLLREEAEAARPADSAGEDRMQELEK
FT                   RLARLQQEQHDAEEIDRLHRESLERGRRAASLAASIADRRTRAEADAARAEEAFRAAPA
FT                   HVRPTTAPDPTPAAPAPARKPAGKNPLGVVVRNKKKQRARLAAQHRVPTDSAPADPSA"
FT   CDS_pept        complement(440295..441209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082750"
FT                   /locus_tag="AGOS_ABR025C"
FT                   /product="ABR025Cp"
FT                   /protein_id="AAS50795.2"
FT                   /db_xref="HOGENOM:HBG058172"
FT                   /db_xref="UniParc:UPI0001DB27A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ7"
FT                   /transl_table=1
FT                   /translation="MKVFSGAILGLTALAKMVLADSEAFYFLSIRSASMYHMSSVFEDN
FT                   GALKLGGSTADALSAVVTDDGKLKLSNGHYAVVDAKGAFTAGSADKASTGFSISRGYVT
FT                   YKGNSGFYPVGSSSPYELTLEQPGATSISVALRAQSVTGASSVDDFEPAEGAARSAAPA
FT                   AGAGPAANATAPVANGTAPATNGTAPAGGFANVTVTATGYHTVIQTITSCENNGGKCTV
FT                   LTTTGPAPVPVSTAPGSSAPHSSAPVSSAPVSSAPHSSAPHSSAPSTSASSTIPIETQT
FT                   GNGAAKAVVGLGAGVLAAAAMLI"
FT   CDS_pept        complement(441730..442209)
FT                   /codon_start=1
FT                   /gene_family="HOG000144416" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082751"
FT                   /locus_tag="ABR026C"
FT                   /orf_name="AGOS_ABR026C"
FT                   /product="ABR026Cp"
FT                   /protein_id="AAS50796.1"
FT                   /db_xref="HOGENOM:HBG058172"
FT                   /db_xref="HOGENOM:HBG202312"
FT                   /db_xref="UniParc:UPI0000252621"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ6"
FT                   /transl_table=1
FT                   /translation="MKFVSSFLLAATALAAGVLADSEEFFFLGLRTATKFHFSAIYAHD
FT                   HALKVSYQGGPKGDALSAVITDSGKLKLSDGTFAVVTPDGPVVEGSEDQASAGFAIANG
FT                   YLTYSGNSAFVPVANGDTYDLSVKPTSASPEIAIGISAQSKDTPGGVAADFPPSS"
FT   CDS_pept        complement(443045..446440)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763604"
FT                   /locus_tag="AGOS_ABR027C"
FT                   /product="ABR027Cp"
FT                   /protein_id="AAS50797.2"
FT                   /db_xref="HOGENOM:HBG058173"
FT                   /db_xref="UniParc:UPI0001DB27A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ5"
FT                   /transl_table=1
FT                   /translation="MKLPSTALAVALLAAAKVVVADSEKFSLESLSGAADLKSVSLQLK
FT                   SGKLVFSPGGKISVLVTDAGRLSFDGNKFAVIEDSGAITFGDEKEGTLGFAVRDGRLTF
FT                   RSIDSFSATKVNGEYTLSVGWNADATSVGIRAVKDGSPVKDFTPVVSIIDKPKGIDIGS
FT                   LCSKLEKLCHWSHTPSCSTVVPPPQPTTSGKPGESTAVPPPQPTTSGKPGESTAVPPPK
FT                   PTTSGKPGPSTTAVPPPKPTTSGKPGESTAVVPPPKPTTSGKPGESTVIPPPKPTTSGK
FT                   PGESTAVVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTT
FT                   AVVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVVPPPKPTTSGKPGPSTTAVPP
FT                   PKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTAVPPPQPTT
FT                   SGKPGPSTTAVPPPKPTTSGKPGESTVIPPPKPTTSGKPGPSTTAVVPPPKPTTSGKPG
FT                   ESTAVVPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTAVPPPKPTTSGKPGPSTTA
FT                   VPPPKPTTSGKPGESTAVPPPKPTTSGKPGPSTTAVPPPKPTNPGKPCTHSHRPGETCT
FT                   HHPGKPTSHGPPPQPTAPGHTTGHVPPPKPTAPGHTTGHVPHPKPDHPHHPGKPCTHSH
FT                   RPGETCTHHHPGQPTGHVEHPKPDHPHHPGKPCTHSHRPGETCTHHHPGQPTGHVPHPK
FT                   PDHPHHPGKPCTHSHRPGETCTHHHPGQPTGHVPHPKPDHPHHPGKPCTHSHRPGEPCT
FT                   HHPGKPTGRAPPQPNKPHHTRKPCTHSHRPGEPCTHHPGQPKPTAKPPAAQPGKPAPPV
FT                   QPKPTAKPHGGHPGGHRPGGSKDCHETKTYKGGIRVDKGPHHTKGGGIVHEGQATKIAG
FT                   HGAGPAATAAPGAGGHGTSGGGASGHGGASGHGKKASGHGGVSGHGGVSGHGGASGHGG
FT                   ASGGKKASGSGTRGAGAAHHRGSGSSKGSGSGAHRGGSRSGGHTGSRPKSGGHRGGGRS
FT                   GGHRGGRRDLGDDIVDYQQDVQMQKRAETTAHPVSVTTSHFTSHAVTGSQSSAHAIATT
FT                   NGAGAGFMSIPFGAVVLGVAAILL"
FT   CDS_pept        complement(447488..449779)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625848"
FT                   /locus_tag="AGOS_ABR028C"
FT                   /product="ABR028Cp"
FT                   /protein_id="AAS50798.2"
FT                   /db_xref="HOGENOM:HBG058174"
FT                   /db_xref="UniParc:UPI0001DB27A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ4"
FT                   /transl_table=1
FT                   /translation="MKLSPAFTVALMALAKMVVADSAMFSLSISGGVGINQAAGVFMKS
FT                   GKLVIGAEGSARAAVTEEGKLSFGGGLFAVVDDSGLIKGGAEAEGTSGFSITNGRLSFR
FT                   GINTFCTTHVDGDSALAVGGGSGEASIRIQATAGGSVLGDFKPAGSVDGSCSCPDASLP
FT                   GSGTPGSGDSTPSGPDGSQPSGSGSGDHPASTPASGPEGTQPSGPGNGEHPSGPGNGQQ
FT                   PGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPGGQQPSGPGNGEQPRGPG
FT                   NDSPANGPASGPQGTQPSGPGNGSPAGGQPANGPGHGPGLPTGPGPAIGQDGSQPSAPG
FT                   NGGQPANAPAHGPEGSQPNAPAPAHGAPNAPADSVAGKLHGAGQALGHAAGSVQGGGRV
FT                   DIGAVGNIAGDISGAAETAGQIAGRLSAAGEALGQAAGRISADGGASAGIDAHAAGDVA
FT                   GKLSGAADLVGSIAGELSGAASAAGELAGSVSGSLGAAGNAGVSGSASLGGEAAGHLSG
FT                   AAQVAGDVAGKIAGAAQAAANAAGQIHGAAHASSQAGASGEIAGHIAGLGQTLGEAAAT
FT                   LGGLAGSLGPTIGGSVGPGGISGNIGLGGVGLGINAGLGGGAGIHQAELSNADGHSPFG
FT                   NKEGEENGQQACSTVTTTIVAGQADQGGVATVTVPPGGGVATATVWAGENQQGGNEGNQ
FT                   GGVATATVWPGQGSNEGSQEGVATSTVWPQQSSQGGQATRSIQQATTNGAGFMNFPVGA
FT                   GLLAAAAMLL"
FT   tRNA            complement(450317..450389)
FT                   /gene_name="tRNA-Lys"
FT   CDS_pept        450617..454207
FT                   /codon_start=1
FT                   /gene_family="HOG000222963" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082752"
FT                   /gene_name="RPA2"
FT                   /locus_tag="ABR029W"
FT                   /product="DNA-directed RNA polymerase I subunit RPA2 "
FT                   /EC_number="2.7.7.6"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="metal ion binding"
FT                   /function="ribonucleoside binding"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50799.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG049456"
FT                   /db_xref="HOGENOM:HBG631122"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR009674"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI0001DB27B1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DS1"
FT                   /transl_table=1
FT                   /translation="MSVMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHV
FT                   GSFNALTEGPGGGLLNLGARDIGAKVVFDGKASDENPNYLGNKLALSVTQVSLTKPMSN
FT                   DGVTAAAERNVFPAEARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNR
FT                   CHLHKMSPQELVEHKEESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTS
FT                   YSHYGVQIRCVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDRE
FT                   IFDGIVGADTSNSFLTDRLELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSD
FT                   YLVGQELLRRIVLVHLGDENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGG
FT                   FLYGMIVKEKIEEYLQNIKLQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFL
FT                   STGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPES
FT                   WGFLCPVHTPDGSPCGLLNHFAHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSL
FT                   CCVQLDGKIVGWCSHEQGRIVADTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYL
FT                   FGGHSRMMRPVRYLPLDKQDIVGPFEQVYMDIAVTPEEIQNNVHTHVEFSPTNILSILA
FT                   NLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDY
FT                   GMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGD
FT                   PVTQHFGFGTDEWPKEWLEKLDEDGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSE
FT                   PAYIEEVTLIGDESNKFQELQYITIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMP
FT                   FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDATPWTFSEEDTPADYF
FT                   GDQLLKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSL
FT                   TMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQ
FT                   SSVPKIGSMVTIRCRRCAISFDEAKKIITQQDSEDSIFIDDSHIWEDGQGNKFVGGGNT
FT                   TTVAIPFVLKYLDSELAAMGIRLRYNVDPK"
FT   CDS_pept        454423..455532
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763605"
FT                   /locus_tag="AGOS_ABR030W"
FT                   /product="ABR030Wp"
FT                   /protein_id="AAS50800.2"
FT                   /db_xref="HOGENOM:HBG058176"
FT                   /db_xref="UniParc:UPI0001DB27B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DS0"
FT                   /transl_table=1
FT                   /translation="MSIQLLKASEGSVITGYCVTNGLRYVIFAEVTYAKSKGVLKLFSV
FT                   DNEKTITFNKPVEVGTEAAHDDAVLNKLAIIKVPVIRKNKVEKTDIVVINAGDGIQLMS
FT                   LEQLFGLDDGDGVTAKWQLSHGQDRILSFEAKATTNGVIEIWFCTRLGQAMQVKYSVSS
FT                   DKFHSFQQLMEVSDDSLNCMATGSEEYGSWEAKLGPLKAVAMACFDNSIYWLHEGTLER
FT                   QSILSFEQANNNTLTSVAYVTVKRLTTTYVNYYCGSVTNIGCIMYKRSTRGDWDVVHTF
FT                   RRPISKPESSPLLNCALHFDNVSEITIVSGTECGILCVWRYDYKAELELAVNHIKVGGE
FT                   GDLVHGVQLLGSQRAYFLCNRSELRYVDL"
FT   CDS_pept        complement(455529..456242)
FT                   /codon_start=1
FT                   /gene_family="HOG000204890" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082753"
FT                   /gene_name="THG1"
FT                   /locus_tag="ABR031C"
FT                   /product="tRNA(His) guanylyltransferase "
FT                   /EC_number="2.7.7.-"
FT                   /function="tRNA guanylyltransferase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50801.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="GO:0008193"
FT                   /db_xref="HOGENOM:HBG029648"
FT                   /db_xref="HOGENOM:HBG329601"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR016904"
FT                   /db_xref="UniParc:UPI0000252626"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DJ3"
FT                   /transl_table=1
FT                   /translation="MAKSRFEYVREYEVHDTLLPETYIVVRIDGKHFHEFSQHYSFEKP
FT                   NDERALKLMNASAKNVVMAYSGDIILAFGESDEYSFILRKDSTLFRRRRDKLSTLFVSL
FT                   FTAQYVALWPKFFPEQPLSHKRLPFFDSRCVCYPNTTVVKDYLCWRYVDTHINNLYNTV
FT                   FWNLVLKCNLTPREAEQRLSGTLSSDKQEILFSECGVNYNNESEMFKKGSLINRKGEIM
FT                   HIDVVKQIDELFAGF"
FT   CDS_pept        456620..457444
FT                   /codon_start=1
FT                   /gene_family="HOG000142029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082754"
FT                   /locus_tag="AGOS_ABR032W"
FT                   /product="ABR032Wp"
FT                   /protein_id="AAS50802.2"
FT                   /db_xref="HOGENOM:HBG058177"
FT                   /db_xref="UniParc:UPI0001DB27B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ2"
FT                   /transl_table=1
FT                   /translation="MVKKEVIRKKRKPQQDPVVRQKLIWTVGHVMTLTCGLIFTCACVY
FT                   NVLFFYRHWGWSRLLPSWLVPSRLLSFSKYGLVPHHGIGYWAAKTGVPASYRLALVGVL
FT                   FSHGVTSWQNWARLNPTYYDLLSKDNFQNLLIATLWLFSRSSFYKLVPFIITSYLHLTK
FT                   KQSASDDETTKQNSMLLHLIAYSELVVLISLLWDTLLFRGASGFALVFYLAIYWLKLNF
FT                   SPYVQTTVLRILSKLKRVVPASQRERWDAVQDFLLRKLREQKVTQEEARKRL"
FT   ncRNA           complement(457536..457614)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR61"
FT                   /product="AgSNR61"
FT   ncRNA           complement(457662..457717)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR55"
FT                   /product="AgSNR55"
FT   ncRNA           complement(457826..457906)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR57"
FT                   /product="AgSNR57"
FT   CDS_pept        complement(458221..458547)
FT                   /codon_start=1
FT                   /gene_family="HOG000203673" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763606"
FT                   /gene_name="RPS25"
FT                   /locus_tag="ABR033C"
FT                   /product="40S ribosomal protein S25 "
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50803.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG391193"
FT                   /db_xref="HOGENOM:HBG610520"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="UniParc:UPI000018D40A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DJ1"
FT                   /transl_table=1
FT                   /translation="MPPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQD
FT                   KLDRILKEVPTYRYVSVSVLVDRLKIGGSMARVALRHLETEGIIKPISKHSKQAIYTRA
FT                   TASE"
FT   CDS_pept        459227..461068
FT                   /codon_start=1
FT                   /gene_family="HOG000248337" [ FAMILY / ALN / TREE ]
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_id="IGI15763607"
FT                   /locus_tag="AGOS_ABR034W"
FT                   /product="ABR034Wp"
FT                   /biological_process="intracellular transport"
FT                   /protein_id="AAS50804.2"
FT                   /db_xref="GO:0046907"
FT                   /db_xref="HOGENOM:HBG058178"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="PDB:3N7C"
FT                   /db_xref="PDB:3OAN"
FT                   /db_xref="UniParc:UPI0001DB27B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DJ0"
FT                   /transl_table=1
FT                   /translation="MAKRFAGSQITRETYEQSASDSEGETGSGPKLASALTMQKRKIAM
FT                   PKRKTSSASGGAGFGNAFAFVKRAGAAPGAEEAAPAPATAPAGDQQAKLQALNMQFHEK
FT                   VMHAVREDPFVNLTPALEKYKKYLSSIGVLSVGMEEEREGKYATVIKHDVGMACAGGAK
FT                   QAEEDDSDAMSEDEVKPVKVEGPKFVLAQGPTTKNPVFSFGTKKQQKKEDSDSEDEIEV
FT                   KGPTFTVSGNVSSGIFKLNKDSAENKAEQSAPIFSTKSDEKSSSAAVTAFGGAAAQEAS
FT                   LNGTTPTKPVFTFGVPSDKKPEAAKPSFSFGFSASTQADKTEKAEKPVFSFGVSANQQN
FT                   DKEDKPRFTFGTAAEKNVENSKPTFGAPTSDAKQGVTSKPAFQFGTGTTNTAATPFGVK
FT                   LPVADQSKQQNKPLSFSFGSSTASLAPSFSFGAKPADASQQPAGDFKFSLPFAQDSKTL
FT                   TTENIEQTGTEEATAAHEGANDQAQTGEPESEGIKMTNGEENEEVLFCEKAKLLIFDSD
FT                   TKGYTSRGVGELKLLRKKDDKGKVRVLCRSEGMGHVLLNTSVVKSFKYQPIDADNENLI
FT                   KWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAM"
FT   CDS_pept        complement(461242..464184)
FT                   /codon_start=1
FT                   /gene_family="HOG000248855" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763608"
FT                   /locus_tag="AGOS_ABR035C"
FT                   /product="ABR035Cp"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="AAS50805.3"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG058179"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB27B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI9"
FT                   /transl_table=1
FT                   /translation="MSKHGIRLPGALLDELNGKDYKDDERFKGHRSKRARNQPNRKDKR
FT                   RERRQLKKQKRQRGDVESAPQTGRAAAARPRQQKKEKAAPAPRQTAAPFSSDDELSSGD
FT                   FDEFDEGDLSAGELEQLRELEEDESASEDEGGNSSSSDEQEEEEEEEELDAAQTMERLR
FT                   ALKAAKVKKQQRSKEPEQEEELDAAQTMERLRALKAAKSKAKHRSQEEEEDDDSEEDDD
FT                   SEDDDEEEFRGFDDEPEHDARERAARSSSSRAPILPEDLAAVERDEMAMNYYGKKLGLK
FT                   RKKWQLHATDEFDAIGGLLEGLDFFQNYGEEGQYSEDEEASQEDTGSESGDEEIGSEAG
FT                   DNARSDGGLPFSSDDELSSGDFEELDEEDVEDDSEHVEQAKKSKKENPYVAPAAGSYVP
FT                   PSLRKKMLAETDSKETVQLKRSVRSSLNKLSESNIPIIVASLNEQYDLHARQYVTDAIN
FT                   SQIIEIISQNNKLLDTFIMAYASVAYALWRLRGVEVGASFVQEAVLSFLRLYDEQMKQI
FT                   EDMGDIDVNTFSKKCSNLITLLAYAYNFGMVSSRLIYDCVRVFINKPNEFTMELVLRVV
FT                   SVSGPLIRGDDPAALKDILAELLPNVNKIKQTTRMKFLLDTLLDLKNNRLKPSILAASH
FT                   HGIKKVLAGALKTAAPTDALQVSLEDIQQIETKGKWWLVGSSWKGNMDNAFAEADKAKP
FT                   EPVAKKRTIEITDTLLDGIPDWNEIAKAQRMNTDVRRAIFISIMSAHDYMDAFTKLEKL
FT                   NLKNKQSLEVPKVLVHCLSVDSAQNGYNPYYSLLGSKICQQHHSIAKSFQFLFWNIMRK
FT                   FENDIGSDDEEDPFQINDLDEEKTLRMLSNQACFFGYLMAEGQVKLDVLKHVSIMGLNS
FT                   DGRLFLENLLFQFLLASAKKAETKKKVGNIKEWSYRDDLLQGALSHGIQAENKKIICKS
FT                   LRMFMRNFRYTNYIRGQPGSKEYQRDMRRLDWAVKRFLELIDEELDSADL"
FT   CDS_pept        464386..465468
FT                   /codon_start=1
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763609"
FT                   /locus_tag="AGOS_ABR036W"
FT                   /product="ABR036Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS50806.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0001DB27B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI8"
FT                   /transl_table=1
FT                   /translation="MARNIDLKTVTDWSVLIGTGISLYYLLHRLFNDADGPLASVSKES
FT                   REKQSTTWRRLVEANPELSRVHLNSYEQNALASVVTPQDIDVSFSDIGGLETIIDELTE
FT                   SVIYPLTTPELYTQHSLLEAPTGVLLYGPPGCGKTMIAKALARESGANFLSIRMSSIMD
FT                   KWYGESNKIVDALFSLANKIQPCIIFIDEIDSFLRERASSDHEVTAMLKAEFMTLWDGL
FT                   TSNGRIIVMGATNRITDIDSAFLRRLSKRFSVPLPNEPQRRKILDVILENVEVDPQDFD
FT                   IDYLVKATRGLSGSELKELCRDAALNAAREYIRQKRQLSAKDASYEGKPLKVRPLQTRD
FT                   FLKNLKLDATQPFVTSVALD"
FT   CDS_pept        join(465595..465683,465753..466227)
FT                   /codon_start=1
FT                   /gene_family="HOG000195924" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625849"
FT                   /locus_tag="AGOS_ABR037W"
FT                   /product="ABR037Wp"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50807.3"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058180"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI0001DB27B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI7"
FT                   /transl_table=1
FT                   /translation="MPETSVSVSQKSYSAGPSGRTIVYDEDGKPCRSCNTLLDFKFATN
FT                   ALHGKVADSTGAVPEAAAAAATVSANIPGSKHYRQVEPADVEELGRSSWTLLHTAAAKY
FT                   PRQPSDAQKQEMRQFLSIFSHIYPCNWCAKDFEQYIRDRAPRVDSRDELGQWMCEAHND
FT                   VNQKLGKELFDCNFWKKRWLDGWE"
FT   CDS_pept        complement(466293..468140)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18082755"
FT                   /locus_tag="AGOS_ABR038C"
FT                   /product="ABR038Cp"
FT                   /protein_id="AAS50808.2"
FT                   /db_xref="HOGENOM:HBG058181"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="UniParc:UPI0001DB27B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI6"
FT                   /transl_table=1
FT                   /translation="MPAGSMMAGRDALLSDIRKGSRLKKAVTNDRSAPSIGGGGRVESS
FT                   GSVGGSAPSLPSGAASGLPMGPQLGDILAGGIPKLKPVGEPVRALQVPPNASAGAPPVP
FT                   SVRPPVRKHAGGSPEGARAPVSPVAPKLPETGAPPVPSARPPQHGGDGALPVGAPRLPA
FT                   FGAPPVPGAGPARPDAGSTPPGGAPNLPNISPPPVPGAPPPVGAPKLPEAGPPPVPGVA
FT                   PPVPSIAPPPPSAAAPPPTAAPPIPAAPPPPLAPQMPAAAQSAPPPAPPPPPPPPPPAV
FT                   KAPVAPPISPPAAQQPPSIIPPASGGLPFLAEIQKKRDDRFVVDGGSNYTTQSSAQSHE
FT                   PVKPQITSLRDHSQQPPPHLPTSAAPPLPQMAAPAPPIPSFAAPQIPQVQLPAAHQPAD
FT                   TVAEGTSTTHSEHPFLSEMQRRLDATSLAGSSPSRSTAERYETADTPASSAGDAAIPLG
FT                   RPHVKQQPDRTFSPPQHIPPAAVPPPPPSIPPPVLDERPPEMIAKAPPPPPPPQAEGAF
FT                   PPPASVPSHRQRLFSSAGGTSGSSSQVPVRESSIDTFTISNRVSTGDAVSRQPICIDDT
FT                   RFKFSNAGGIPKPRVFQNKTKLYPSGRGSSVPLDLSLYS"
FT   ncRNA           468470..468553
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR46"
FT                   /product="AgSNR46"
FT   tRNA            468841..468912
FT                   /gene_name="tRNA-Met"
FT   CDS_pept        469047..469982
FT                   /codon_start=1
FT                   /gene_family="HOG000192906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763610"
FT                   /locus_tag="AGOS_ABR039W"
FT                   /product="ABR039Wp"
FT                   /protein_id="AAS50809.2"
FT                   /db_xref="HOGENOM:HBG069079"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI0001DB27B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DS6"
FT                   /transl_table=1
FT                   /translation="MDSAAVLARHRKEKKDLQNQVTGLKKQASKKNRKQVNAKCEELSR
FT                   ELEERHARELAELEHEGGEQKADDAAEDGQVTPEELLAQLELEQPAAAAAPAPQAVASG
FT                   RRGNRRKEKLARREAEVARIKAEAAAEAAEQPDLSKGEEALLQQLCSTAGLRAVDIQPD
FT                   GHCLFASVLDQLRARHGERACEPYCLPQSYEGPRSAAEMDVWALRKLACCQVREHPDDF
FT                   VPYLFDEQTLELQDVATYTAAIESSAKWGGEIELLALSQVFRCCISVLMAGRSTHRVNE
FT                   QHAVNPELKLVYYKHSYALGEHYNSLRDAA"
FT   CDS_pept        470108..471346
FT                   /codon_start=1
FT                   /gene_family="HOG000087628" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931380"
FT                   /locus_tag="AGOS_ABR040W"
FT                   /product="ABR040Wp"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50810.2"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG489518"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="UniParc:UPI0001DB27BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI5"
FT                   /transl_table=1
FT                   /translation="MGFWIRPYSTQRAIVRASNNLTSGIVGLANVGKSTFFQAITKSTL
FT                   GNPANYPFATIDPEEAKVLVPSEHLDHLQKLYGSRKKIPATLTVYDIAGLTRNASRGEG
FT                   LGNKFLGDIRLVDGIYSVVRGFRDDSITHIEGSVDPIRDLSVVQDELVLKDLEWLEAGR
FT                   EKLTRKLGRTAKSSLDHKQMQDELALLAQLEEFLYEGRRIAHFKQNWTKEEVDTLGQYN
FT                   FLTAKPTLVLLNSSPRDYLLQQNEYLDEVSKWIDQYSPGDEVLIFSAEYETRYNEFAST
FT                   SDWEGLQRYCSELAGGAAIKAGALPSALPSIILKMRQLLRLISFYTCGPEESRQWTIQQ
FT                   GTRAPQAAGVIHSDLEKTFINASVIKYDDLRDASHPLDESALRRLGKIKRCGKDYVVED
FT                   GDVVHFRAAAGKN"
FT   ncRNA           complement(471439..471493)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR69"
FT                   /product="AgSNR69"
FT   CDS_pept        complement(471996..472349)
FT                   /codon_start=1
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625850"
FT                   /locus_tag="ABR041C"
FT                   /orf_name="AGOS_ABR041C"
FT                   /product="ABR041Cp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS50811.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG236852"
FT                   /db_xref="HOGENOM:HBG317444"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="UniParc:UPI000025262F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI4"
FT                   /transl_table=1
FT                   /translation="MVDMKDKTEQQEQPQIHKIRMTLTSTKVRELEDVSANIVKNAQSF
FT                   HLVMKGPVRVPTKVLKICTRKAPNGEGSKTWDTYEMRIHKRYIDLQAAAQVAKRITQLA
FT                   IQPGVDIEVTIAA"
FT   CDS_pept        472653..473927
FT                   /codon_start=1
FT                   /gene_family="HOG000077593" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763611"
FT                   /locus_tag="AGOS_ABR042W"
FT                   /product="ABR042Wp"
FT                   /protein_id="AAS50812.2"
FT                   /db_xref="HOGENOM:HBG055988"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniParc:UPI0001DB27BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI3"
FT                   /transl_table=1
FT                   /translation="MTATKEYLCSLRAVRETSAEVFRYVSARGRGKYCKLDSSKLTDVV
FT                   QYVLKIIDRDYGRATCEIPPHGRLQHFNVGGVDRVGELLRGWRGVDDIELSRRLVDLVV
FT                   LSVLLDAGAGSQWSFREPGSGLRVGRSEGIALASFYMFKNGMLSADGSTTVNGHHLAAI
FT                   PLEMFQEAFQVTEKNTIVGLEGRWRLARKLGQVMCSNSAVFGPDARPGGIVDYLRGLCG
FT                   GGPLHIEQLWDTLMDNLLPVWPDNRCTIDGEPLGDAWQLDTLVSGDTAGRAHGIVSFHK
FT                   LTQWLCYSVLPPLTEYGYKFDILDTDQLTGLPEYRNGGLFCDLGVISLLPEAKQYGEQM
FT                   ARAAGAEDVPVFPAEHGAIVEWRCLTVALIDELLSMINKELDVPLTLAQLLEAGTWKAG
FT                   REVAQKKRPETGGPPIAIASDGTLF"
FT   CDS_pept        474251..476311
FT                   /codon_start=1
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625851"
FT                   /locus_tag="AGOS_ABR043W"
FT                   /product="ABR043Wp"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50813.2"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051317"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI0001DB27BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI2"
FT                   /transl_table=1
FT                   /translation="MDHLNPPLSQGVGYAIVVGLGAVFAIGMVMTTYILRRYQREVITA
FT                   EEFATAGRTVKTGLIASAVVSSWTWAATLLQSTTMAYKVGVSGPFYYAAGACVQIILFS
FT                   TLAIKCKQRAPNAHTFLEIIKARYGRKAHILHMCYALVTNVLVTTMLLTGGSAVVSELT
FT                   GMHTAAACFLLPVGVIIYTLFGGIKATFLTDYVHTVIIVGIILTFTFSVYRTSDMLGSA
FT                   SKVYDLLREAARQHPVKGNRNGEYLTMKSESGGIFFVVSLVGNFGTVLLDNGYFTKAFS
FT                   SSPAAALPGYVVGGIVWFAIPCLVATSLGLACLALELLPSFPNYPSRLSQEQVDAGLVL
FT                   PVAAFNLLGKGGAMAALLMVFMAVTSAMSAELIAVSTIFTYDIYRGYVNPDAPGKRLIV
FT                   TSHAACVVFGVAMSAVSVGLYYAGISLGYLYEVMGIIISSAVIPSALTLFWSKQNIYAV
FT                   TIAPLVGTTLAVTSWLVCAKVLYGSITVENTYKDYPMLTGNLVALLSPALLIPLLTYSL
FT                   GADSYDWIAMKTDILRVDETDELLDADKGLAMVVTRELFESSSVPSAIEKEEINHTTEP
FT                   NLQREMTNGLEEERILKRASRLATILCAIFILSFLVLWPVPMYGTGYIFSKGFFTGWVS
FT                   VLTLWLFCTGFAVCIYPLWEGRHGLFTTVRGIYWDCTGQKAKLRDWQCSQI"
FT   CDS_pept        complement(476474..477832)
FT                   /codon_start=1
FT                   /gene_family="HOG000176489" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763612"
FT                   /locus_tag="AGOS_ABR044C"
FT                   /product="ABR044Cp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50814.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058182"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniParc:UPI0001DB27BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI1"
FT                   /transl_table=1
FT                   /translation="MYSKEDWGGKIEPYIEVNMQKLEGKALVAVFNFQDFRHLGYQDHG
FT                   ELRMVCTQEAVNAQRCTAEELGQLLVRKKVYNPETGQNETLRSEVKSMRVEKEGVLEPR
FT                   YPVKETGFYCVFVYAPDVKYAGEVTFQNAFGHLPASDVNNLMLYGLLAVAYAIAMALYM
FT                   FAVWKHKHELLLLQKYILAFFLFLTLETILVWSAYDLVNRKGVTAGTITYNVFISIINA
FT                   GKVSMSCFLILIVALGYGVVYPKLNRKLMRRVQVFTAFNFVTMAAAIIHSSLTRAENVG
FT                   VSLLLSVFPVLTLIVFYVLIIRSLGSTLGYLREHKQVVKLNAYRKMFMLIIGSIVLNIL
FT                   GVFFSIFSMARRNDDEIISNLWKTKFIMEVWPSFVYFLVFVVFAFMWRPTDTSYMLACS
FT                   QQLPTDPENVTDFDLDDLQSLNDDASNRRVNDDEINFSDEEGPGSYHPSHQGK"
FT   CDS_pept        478086..478805
FT                   /codon_start=1
FT                   /gene_family="HOG000023557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763613"
FT                   /locus_tag="ABR045W"
FT                   /orf_name="AGOS_ABR045W"
FT                   /product="ABR045Wp"
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="AAS50815.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG156732"
FT                   /db_xref="HOGENOM:HBG294208"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR017065"
FT                   /db_xref="UniParc:UPI0000252633"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DI0"
FT                   /transl_table=1
FT                   /translation="MRSQMLALGRAARCVARRGLHIKTLTTPNENALKYVSTDGELLQE
FT                   RGAPSVEIRNFDMELIRQAPLAEKLFAQVPGVEAVMIGDDFVTVSKDAELGWAQVTPRV
FT                   LEVLTQQLASGQAAVQGQVAVGGTERFQYDEEEQEISDTIEEIIQTRVRPAIMDDGGDI
FT                   QYRGWDPETGRVYLKLQGACKSCSSSEVTLKHGIESMLKHYVEEVSGVEQVLDVEEQVA
FT                   LHEFGRLEERLRARTSK"
FT   CDS_pept        complement(478810..479136)
FT                   /codon_start=1
FT                   /gene_family="HOG000007680" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778399"
FT                   /locus_tag="ABR046C"
FT                   /orf_name="AGOS_ABR046C"
FT                   /product="ABR046Cp"
FT                   /function="4-alpha-hydroxytetrahydrobiopterin dehydratase
FT                   activity"
FT                   /biological_process="tetrahydrobiopterin biosynthetic
FT                   process"
FT                   /protein_id="AAS50816.1"
FT                   /db_xref="GO:0006729"
FT                   /db_xref="GO:0008124"
FT                   /db_xref="HOGENOM:HBG203837"
FT                   /db_xref="HOGENOM:HBG398968"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="UniParc:UPI0000252634"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH9"
FT                   /transl_table=1
FT                   /translation="MYNKIAKQLPILLRPPELQAGLAALPHWRLVGASLQRELRLADFE
FT                   ATWGLLTQVAMRAHLWGHHPTITTTHTRATIALTTHDAGGVTDIDLRMARRIERLLARS
FT                   ECIS"
FT   CDS_pept        479239..480735
FT                   /codon_start=1
FT                   /gene_family="HOG000033997" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763614"
FT                   /locus_tag="ABR047W"
FT                   /orf_name="AGOS_ABR047W"
FT                   /product="ABR047Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="AAS50817.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG058183"
FT                   /db_xref="HOGENOM:HBG203836"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="UniParc:UPI0000252635"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH8"
FT                   /transl_table=1
FT                   /translation="MSCCLLILDEELQLLTVRQLRPLPELLGPLQWFISSPRRLPVLSH
FT                   RGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIMDNFH
FT                   LVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEEEEA
FT                   DPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRLNQ
FT                   VHGAINCRSYLSGMPQLTVGLNKMVAQDRDFTSQVHFHQCVDLERLATDRHITFVPPDG
FT                   EFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVL
FT                   KVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQS
FT                   QFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHASAPTHASALLRVDFEVPY
FT                   HTISGLKVEFLKILEPQLQYQSFPWIRYKSTNHQLCAFQL"
FT   CDS_pept        481083..482156
FT                   /codon_start=1
FT                   /gene_family="HOG000141706" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931381"
FT                   /locus_tag="ABR048W"
FT                   /orf_name="AGOS_ABR048W"
FT                   /product="ABR048Wp"
FT                   /protein_id="AAS50818.1"
FT                   /db_xref="HOGENOM:HBG058184"
FT                   /db_xref="HOGENOM:HBG104294"
FT                   /db_xref="InterPro:IPR013927"
FT                   /db_xref="UniParc:UPI0000252636"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH7"
FT                   /transl_table=1
FT                   /translation="MNHTNTEPGEEHELIAIEALSRLCNGTNGETRLEKSHGAEQGQAQ
FT                   QHQDDGETLLCRMRQNPIFTNAVSLYEQTKSHHPNFRRRAELVERSASTMVRRTSELWA
FT                   PRDGASKHRLEESCETGTPLDDEVGPSPRVSKRQKIKENLKEYRLTMSIESKKQLITCL
FT                   HLLKLANRQLSSTVGSLQDLVQKEREDSGPREPEEEDGEQYFDASETIVSERSKEIKME
FT                   VVGTVKKVYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSASRETPTNARLSAN
FT                   SKMLILAEESLDMVSNIIQVFDMTLGRAEEWVKHKQELKELIKSQYMEAQLKSKVKQQL
FT                   EKEQSEQQRHELKRSSV"
FT   CDS_pept        complement(482199..482870)
FT                   /codon_start=1
FT                   /gene_family="HOG000177219" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778400"
FT                   /locus_tag="AGOS_ABR049C"
FT                   /product="ABR049Cp"
FT                   /biological_process="protein transport"
FT                   /protein_id="AAS50819.2"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG202451"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI0001DB27BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH6"
FT                   /transl_table=1
FT                   /translation="MNFIKTAIWGVDPREQHRKLKAILRKNQRQLDKSLRELAALKGKT
FT                   QVLIKKSAKTNDVKTVRIYAKELYQINKQYDRIYTSKAQLQSVGMKIEEAFHMNKMQQT
FT                   MAQSAGLMREVNSLVSVPQLRSTMMELEKELLRSGIVSEMVNDSLENIDMTVDDEEVDE
FT                   QVEQIVMQYTGAKFNAVDNVPETQLERQDALEEVVPEEDIKDEADNMLREMRERLNALQ
FT                   G"
FT   tRNA            483148..483219
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        483589..487275
FT                   /codon_start=1
FT                   /gene_family="HOG000154574" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763615"
FT                   /gene_name="TIF31"
FT                   /locus_tag="ABR050W"
FT                   /orf_name="AGOS_ABR050W"
FT                   /product="Protein TIF31 homolog "
FT                   /function="binding"
FT                   /protein_id="AAS50820.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058185"
FT                   /db_xref="HOGENOM:HBG203377"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI0001DB27BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DR9"
FT                   /transl_table=1
FT                   /translation="MSKELDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAAS
FT                   KYYTNYELLHNGVEVDEQQLISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFV
FT                   GDSDDDITSLALSNVAKFRELPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELD
FT                   SILELRPSAQDVLKGGSALSKPCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLH
FT                   ITATVSGFYVNKSSAIKFDPTLKTDAAVCLTLYELLTKHSKKFASHLSQLEAALKAHES
FT                   VNYVKPISVFLHKTWFPSSLPSNSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIV
FT                   ARLEKEKLLNRVIHDFNVAASKGSMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDL
FT                   DGHYQDKGGDAAAHAASNQDLHIIKTLLQSNMRSVRHLLTAVVEFGGVRILAQSPVPGI
FT                   LDTAGMKFIKNEKGEEEAIQAKNDITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKK
FT                   HEVDGVELKVASTSKGVVGFDKRNYILDLADNNPLDVGFALENFDAVTDEKARYPHRQT
FT                   LLRRELVEKWWFSKVDGTGSEMEAAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEV
FT                   VPTLVKEVAEGSITAPFNGEHLVDIMHKNGINIRYLGRVIELAEQELEAQRALREAHLQ
FT                   QVEADNKEFTEWEANYLKHIESLIKERQVTIQKLLAEGKEVPAELKEELKLDDKEIRKP
FT                   HEKEGVAVNNDQLSVLLTLAQIEIISRSIKHVFRKHCHELPAVIIPTFIAFALNLLFGY
FT                   CYNKAPIAEFPTDGSDIDFAFTKLTREQLLSEISEQAVLRFRYTLPDGWESRYEHTPFA
FT                   LLRPICNKFGIQLLNKEYFFTREQYQNWRQAQDKKIRSKLVEPVSTFSINDLSVRPIIK
FT                   VATLTTGVSDDCWAQGAYMINEEEKQATALALFSQSIAFREETSGYVHPTVAESYLALS
FT                   TIHSKLEKKSEAVALCRKACAIYERVCGFDSFEMIRSLNNLAMLEMANDSPYNAALCLK
FT                   TIMSILSVVIPVNHPATINSYSMLHSMCSSLQNSSAMIKVLNKLGDIIVEIDGHKSLPY
FT                   AVNESRLANLYASVGEYKRSLACIESCYELFSKELGVNHKTTVECNSWITGVENLIEST
FT                   SQSKALAASKAAAAAKQGEKKPAQKQQQSAELRDKSIDELMNFINGGSAPAKKSKKKKN
FT                   AKK"
FT   CDS_pept        complement(487452..488903)
FT                   /codon_start=1
FT                   /gene_family="HOG000141906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763616"
FT                   /locus_tag="AGOS_ABR051C"
FT                   /product="ABR051Cp"
FT                   /function="transferase activity, transferring phosphorus-
FT                   containing groups"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50821.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016772"
FT                   /db_xref="HOGENOM:HBG058186"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniParc:UPI0001DB27C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH5"
FT                   /transl_table=1
FT                   /translation="MMAVKTANAEQAVKAEEQADTGAVPLGGKAVQAVVLAVTVHLAAE
FT                   VFGKDEAGRAAFYSALSVAAAYGAAAAAGRVPAFNAVYVVYLPVMVSLLFRRELVPVNC
FT                   AMALGGMQMPVVLRVLQQLTILYLQPAARGRGLRDVAALAVHQAVWWALARVSELRSLD
FT                   MVDCGLLSILLTNVLFVIGGESSVQFQILRACLYGFLVAVGANYVFVRAYGRRNQYVRT
FT                   AVLLAVFALVFPSVILAFLDLDDTDNALVWLIKYIFSSALRMQIMAGWLVFLGVLIPSV
FT                   FVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLYP
FT                   FGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDSLASII
FT                   GRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEGVATRNIILACVVSGILE
FT                   GNSDLNDNILIPSFMLIFMELCKYY"
FT   ncRNA           489239..489315
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR78"
FT                   /product="AgSNR78"
FT   ncRNA           489399..489475
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR77"
FT                   /product="AgSNR77"
FT   ncRNA           489531..489618
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR76"
FT                   /product="AgSNR76"
FT   ncRNA           489656..489735
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR75"
FT                   /product="AgSNR75"
FT   ncRNA           489810..489852
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR74"
FT                   /product="AgSNR74"
FT   ncRNA           489919..490019
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR73"
FT                   /product="AgSNR73"
FT   ncRNA           490152..490177
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR72"
FT                   /product="AgSNR72"
FT   CDS_pept        490378..491907
FT                   /codon_start=1
FT                   /gene_family="HOG000248612" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763617"
FT                   /locus_tag="AGOS_ABR052W"
FT                   /product="ABR052Wp"
FT                   /protein_id="AAS50822.2"
FT                   /db_xref="HOGENOM:HBG058187"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="UniParc:UPI0001DB27C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH4"
FT                   /transl_table=1
FT                   /translation="MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGK
FT                   KAAQRVEKLLAGLTADGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKN
FT                   PKKDEQRNSKLQVLEGVQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQN
FT                   HRILQQFGNKEDECNPGRVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLG
FT                   TKKERRQNSDAAEKTAVAARSAEGEDDSSSSDNAASDIDEGAASESEEENSDDEAARSP
FT                   SVDEDALVSQYAGMLAASDEEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQPDADDS
FT                   SDSDSSAPPLKKQKTSKTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRR
FT                   GQRARQKIWEKKYGRNAKHIQQQFEKEREERARKQREYEERAAKRAAKEAELARTRPAF
FT                   KDSAIRAAEPGAAKSAAKPVAQELHPSWEAKKLSQEKQKAAKFQGKKIVFD"
FT   CDS_pept        complement(492209..493756)
FT                   /codon_start=1
FT                   /gene_family="HOG000181358" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625852"
FT                   /locus_tag="ABR053C"
FT                   /orf_name="AGOS_ABR053C"
FT                   /product="ABR053Cp"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="AAS50823.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG065082"
FT                   /db_xref="HOGENOM:HBG592092"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI000025263B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH3"
FT                   /transl_table=1
FT                   /translation="MDAIGFGEQAGWLWRALAALWAWRVLAALVLVLVADQAAYRRNKG
FT                   RIAGPAWKMWPLIGPFLESLDPKFEVYQAKWASGPLSCVSIFHKFVVIASTRDLTRKIL
FT                   QSPKYVKPCLVDVAKKILRPTNWVFLDGQAHLDYRRSLNGLFTRDALARYLPSQEAVID
FT                   RYMAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADDYYLVTAA
FT                   LELVNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAWCKLMLD
FT                   AKAKDDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDVLAKIRE
FT                   EQLAVRRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAVSADYTAP
FT                   KGSMLVATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGPHVCLGQKY
FT                   VFMTFTALIGKFALFTEFDHKVTSLSEKIKVFATIFPQDDLLMSFKKRDPLTGQTTE"
FT   CDS_pept        complement(494056..495000)
FT                   /codon_start=1
FT                   /gene_family="HOG000141782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625853"
FT                   /locus_tag="ABR054C"
FT                   /orf_name="AGOS_ABR054C"
FT                   /product="ABR054Cp"
FT                   /protein_id="AAS50824.1"
FT                   /db_xref="HOGENOM:HBG058188"
FT                   /db_xref="InterPro:IPR021611"
FT                   /db_xref="UniParc:UPI000025263C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH2"
FT                   /transl_table=1
FT                   /translation="MNISPTPKRYQSSNHMPRAVNHNYHSAVPAYHEHAAGQNADRIVP
FT                   DEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKLQAQA
FT                   QAARVPSPPEPAAEPAADYLQLPRRAPAAENDKKIGELYDKLEQLTKVVHQQHLHDPPA
FT                   PARPRSPARSRSPARTAVSDDDIMISESSELKRLEEQVDQLKRKVLIKSENELRKLSLN
FT                   QQLADLMHKLGVSSSSPASSALLFDRQPSPTSAASSAPLAHAHCEQCHHAEDALKKPAM
FT                   DIKNALQTPTPSRTRRDAHPHTHTTHHATNALW"
FT   CDS_pept        complement(495282..497318)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763618"
FT                   /locus_tag="AGOS_ABR055C"
FT                   /product="ABR055Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS50825.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG058189"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniParc:UPI0001DB27D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH1"
FT                   /transl_table=1
FT                   /translation="MSYYGDWYHYYPQSQQQDGHSTQSEQQAPLPGPLPPQQSNMVSAQ
FT                   QPPQPAFGGLFGQHQSHNGRRPPGEPQKAQASAAGPGVYCYYYPQQPYSGYSPFFGGTQ
FT                   GGGPAKVGGGRREEGPFRHGGCPAPTAYQYPGFQPATYGDPSGAARYAGYAQEQRAAAH
FT                   QTPAFTQHQQHEKPQQQPQPQQHQHQNQHQHQQRAAVPAAAAYMRQVGGPEALPATAAT
FT                   AASTATTTPVPTTNTSLQSNSPGATKNPFVEPVPSIIPQNSVGAGLGLGGTRVGDGSPA
FT                   STPATVKKNKAGEGSLLAIATGSHGNTAKAASVADSGSSSSGFESQGPRVTTTMWEDEH
FT                   TLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHVVKIGSMHLK
FT                   GVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTSTTSGPAENGAKLGKLIQATGA
FT                   PSRNGPPPPYGQQDQQHGAAAAMSVPSQPRRASAVAASSLPQQTPYLVSSYPSSSQPYY
FT                   GRTGYLPQPISYANYDTGGSALSNYGYSPAGSTSTGTARPPPRSQSPFQALTQVSALAQ
FT                   KQLNSKDQQLLPVGPIAALSSGTPALGQQHFQRREHMQNSLGRSTSDEGHANMLPPPQA
FT                   LIQRDHTVPQGHPHLLSKFTPIATLSSTVAAEHPGSIVYSAKE"
FT   CDS_pept        complement(498143..499612)
FT                   /codon_start=1
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763619"
FT                   /locus_tag="ABR056C"
FT                   /orf_name="AGOS_ABR056C"
FT                   /product="ABR056Cp"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="AAS50826.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG522223"
FT                   /db_xref="HOGENOM:HBG617734"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI000025263E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DH0"
FT                   /transl_table=1
FT                   /translation="MFRQSKRRVAQRRHGDGADGATILAGLTAEEEQARYDQLYPAKLS
FT                   FYALPPVGEITLDQFETWAIDRLKVLLELESLIQRNRAGRELEQAMKPLLGKLLPLGEE
FT                   QEARRKDYYSHFILRLCFCRTAELRERFVRAETALFRLRFQMLTSADQARFVQSLDLPL
FT                   VQFIDEAEKQALGAQLYDAVAPQLLHQLQLTDEAQRRQFFQHERFLKLPFESVIDLVGP
FT                   RHVLLRGGWAYLPQFMQLNHIAAEYAARLATDLRATYQHLPALAGDDRLPPILAHLSAG
FT                   HVVAPPPPPTGGGLTAADLAAEPVRAALPLCARGLLDGLAANHHLRYLGRQQLALFLKG
FT                   AGMSADDALRFWADAFTAGPTSLDRFNREYRYALRHTYGLEGNRINYRPWDCRTILAKP
FT                   RPARNEFHGCPYRDWAPDRLAAALAAMQLAPPAVAAVRDACARREYTLACTHVFDACHG
FT                   HVAPSAPGHVPAPDMSHIVHPNQFFERARPA"
FT   CDS_pept        500105..501667
FT                   /codon_start=1
FT                   /gene_family="HOG000246632" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778401"
FT                   /locus_tag="AGOS_ABR057W"
FT                   /product="ABR057Wp"
FT                   /protein_id="AAS50827.2"
FT                   /db_xref="HOGENOM:HBG058190"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI0001DB27D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG9"
FT                   /transl_table=1
FT                   /translation="MIENAGTPEYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARART
FT                   GGRLLQVESSVFPGRRYDLGASWHHDTLSNELFAEELRLPEAERAGYVFDDVPTMVVSP
FT                   AGRRLDGDFGLMLEALQREVEHYIEEQYFESLEARDMPFFELVMAYLYERRGVLTDDQI
FT                   QQLPGTVRFLEFWHAIDWKLLSAKLSEVENNGRNAFVLNYDKLLRRIESGVPREWIRLG
FT                   TEVTKIERVRDTVHITTADGACYVSKCAIVTVPQSVLELSLKPERVPGRIEFRPPLNDN
FT                   ITSAFERAHYASLGKIFFEFDKCTWDTQRPRVAIAAKVPDDFSAQVRKAQDLQELLRSA
FT                   SAQTEVKLGQDCFDFPQEFQNMVALAGIPTLIAFTQTPLTEHVERLSKQEIVDYFKPAI
FT                   VVALRALGSKEECLFDLGNTQPQDDSHPGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQ
FT                   LPLTVALNNGQDSRIRFAGEHTVMEGNGCTYGAWESGRREAEYVLEYLRRFPLAHPQDG
FT                   KKQ"
FT   CDS_pept        complement(501722..502777)
FT                   /codon_start=1
FT                   /gene_family="HOG000066040" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778402"
FT                   /locus_tag="AGOS_ABR058C"
FT                   /product="ABR058Cp"
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50828.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG058191"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI0001DB27D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG8"
FT                   /transl_table=1
FT                   /translation="MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIR
FT                   KVILVDAGSQVPMEDEDTEECCDGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIE
FT                   DRANSDGVDKRFKFVTEKEFLLQNADMLEARDGCGCQRPGKRARVGCSTGAGSPHAVEP
FT                   YTYKGVYLSTQCSCDDSACQCANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGA
FT                   CCGDRASGLLGYDYAANERTSCACSPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKR
FT                   KMSIQYKGKLINSKFWWDILYLQCAVAREPQLEALDLLQWFDNIIETHGAALPDAEPAA
FT                   TGLDYMLGKLS"
FT   CDS_pept        503174..503671
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763620"
FT                   /locus_tag="ABR059W"
FT                   /orf_name="AGOS_ABR059W"
FT                   /product="ABR059Wp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS50829.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1A3S"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252641"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG7"
FT                   /transl_table=1
FT                   /translation="MSKTAQKRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPA
FT                   DSPYEGGVFNARLQFPRDYPLSPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNMYE
FT                   EASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWRDNRADFERQVQESVRRSL
FT                   GL"
FT   CDS_pept        503998..505353
FT                   /codon_start=1
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763621"
FT                   /gene_name="DCW1"
FT                   /locus_tag="ABR060W"
FT                   /product="Mannan endo-1,6-alpha-mannosidase DCW1 "
FT                   /EC_number="3.2.1.101"
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="anchored to membrane"
FT                   /cellular_component="cell wall"
FT                   /cellular_component="extracellular region"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS50830.2"
FT                   /db_xref="GO:0005576"
FT                   /db_xref="GO:0005618"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="GO:0031225"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI0001DB27D5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DG6"
FT                   /transl_table=1
FT                   /translation="MLAVTFTAAAVLSLLAASGRTLNLDVDDLQSIREATSLLATGLMD
FT                   YYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYYMENSTYNDLLTDSLLHQAGEDLS
FT                   YTPWNETTTEGNDDQFFWGMAVMAAAERNFPNPPADQPQWLALAQAVFNTMALRWDMET
FT                   CNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYTGNATYLEWAERVYDWMYGVGL
FT                   ISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAGCAFIYNHTQDELWHQRTLRF
FT                   LDSARIFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRFLGLTAQLVPESRETIVRWIRA
FT                   SAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAALEIIQNLRCLERPAPYTAMN
FT                   GGTSPGDPAAGTKTKAENLPPLDIKAGDRAGAGIITALIGSSFLACTLWLII"
FT   sig_peptide     503998..504060
FT                   /gene_name="DCW1"
FT                   /locus_tag="ABR060W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DG6 "
FT   mat_peptide     504061..505278
FT                   /gene_name="DCW1"
FT                   /locus_tag="ABR060W"
FT                   /product="Mannan endo-1,6-alpha-mannosidase DCW1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DG6 "
FT   pro_peptide     505279..505350
FT                   /gene_name="DCW1"
FT                   /locus_tag="ABR060W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DG6 "
FT   CDS_pept        complement(505545..507143)
FT                   /codon_start=1
FT                   /gene_family="HOG000155608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625854"
FT                   /locus_tag="AGOS_ABR061C"
FT                   /product="ABR061Cp"
FT                   /protein_id="AAS50831.2"
FT                   /db_xref="HOGENOM:HBG058192"
FT                   /db_xref="InterPro:IPR018626"
FT                   /db_xref="UniParc:UPI0001DB27D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG5"
FT                   /transl_table=1
FT                   /translation="MSLRKQEAPLSPMVYHPRSGNFQLGSASHRVPLTAMCLTKFDVKK
FT                   GNTVLWTTSLAPEHKLHNIEFKTLPAGIHESEQDWVNFVLPKEDGEFYYGVALFSQNGL
FT                   RLVEEEQSHGVDRSRVEMYSLAVITDPQFRLDAMAESKYYRWKPNMFICANEYKEDLAQ
FT                   LMEQWLKSKSLEVLEHYFSYNKYQPDLGSPLLMRKWPGSSTLTGGSYEDYAQGSKDDAE
FT                   TFKPSKSWLYLLPEIIEQLGPSIFTLWKACLLRQRILVVNEHGQSFERTNALTYCLSVL
FT                   SLIPLQLERKLAHANMPLQTLYTIGIADLDHLTDMVSDALHKSDPDGPHLPSFIACTSD
FT                   EILAERGELFDMVVKLSNYHGVKVYAHGTEVRATPHEWESFQYLSANFLYREYSEVEMN
FT                   GYMKNVESLSWSQYIIDALYWWSTAGYLQPPYHNTSNLLANCDRVDEKNEVEIVLGIVE
FT                   YFHSKITLLYEKLHEIITDPDADASDRIAVPSLFLAECGLDCFSFQDHEFLKTLCAQWF
FT                   NVHIEIRVADFNVFC"
FT   CDS_pept        507280..507618
FT                   /codon_start=1
FT                   /gene_family="HOG000001085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763622"
FT                   /locus_tag="ABR062W"
FT                   /orf_name="AGOS_ABR062W"
FT                   /product="ABR062Wp"
FT                   /protein_id="AAS50832.1"
FT                   /db_xref="HOGENOM:HBG058193"
FT                   /db_xref="InterPro:IPR020491"
FT                   /db_xref="UniParc:UPI0000252644"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG4"
FT                   /transl_table=1
FT                   /translation="MNEKQLRQQLDRCLDHVQEHVDMLSARAISKLSGDAVANHEWLSE
FT                   LSGRYPTRSAEELQQFRELKDGYVKKLDTLETEVKYLEDLGQELAEFQNELSVKLQRIR
FT                   RNSYVQEN"
FT   CDS_pept        complement(507622..509103)
FT                   /codon_start=1
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763623"
FT                   /locus_tag="AGOS_ABR063C"
FT                   /product="ABR063Cp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50833.3"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="HOGENOM:HBG001389"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI0001DB27D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG3"
FT                   /transl_table=1
FT                   /translation="MLRTIGRRWLSVPATTYAPTIYALSTPMGQKSAIAVVRVSGTHAR
FT                   LVYEKLTDSKRPPTPRRASLRNLYSPQSAPEKVFLDSALTLFFEQPGTFTGEDILELHV
FT                   HGGKAVVAGVLDAIGALHDESAGVQIRYAEAGEFSRRAFQNGRFDLTEIEGIGELIDAE
FT                   TETQRRSAISSFRGQNRLLFAGWRQQIVDNIAQVAAIIDFGDDTEIQDIDAILEGVRCS
FT                   VKALRREVADFVERVTRSTILQSGIRLSVLGAPNAGKSSLVNCITKDDTSIVSSIPGTT
FT                   RDAIDVPLDINGYKVILTDTAGVRAHSTDPIELIGIARAQERTARSDIVLLVVDATAAT
FT                   PLSPALRSHLRDLTDKCRLVVINKSDLVPPSRLKYIQTQLAAELPDCGPALVISCKQRD
FT                   GLDALVHALTSHFTDLASCAAADPIAISARARDILRQDVLAGLDGFLRLASSAEVDVAS
FT                   ESLRSAADGIGTITGDAVGVEEVLGVVFSNFCVGK"
FT   CDS_pept        509679..513011
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931382"
FT                   /locus_tag="AGOS_ABR064W"
FT                   /product="ABR064Wp"
FT                   /protein_id="AAS50834.2"
FT                   /db_xref="HOGENOM:HBG058194"
FT                   /db_xref="UniParc:UPI0001DB27D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG2"
FT                   /transl_table=1
FT                   /translation="MRTALLLSLGLVAAVDPSPVNEEVSLEERFEDVSTYDFDLDSISY
FT                   LSHIAVEKAVDWLESHDISSISECFEYYNEHRLDPGTLEIAVSTGHEWYKSSDFFRQGI
FT                   DLVAELMEKSRDSQKLQWWKHGLVQSLIRLGTVDLFEELLRDNFGVHFEKLADIYKDMQ
FT                   VQLHSIDVVGGVVDAPHGNSLRAPKEFPWGGPNQGSGSSQGDSPSSPWDLPKEPPTVRS
FT                   KAPAGNGEKTEGNPLDYANPKKATAEFNFPKFKKPKDDEKKDGDKKDDKKDDKSDNKDD
FT                   KKDDKSDSKDDKKDDKSGKKDDKPDNKPDNKDDNKPDKKGDNKPDKKGDNKPDKKDDKS
FT                   DNNDAKKDGKKGEKSDRKDENKDDNSDKKDDKKDGKSDRKDENKDDNSDQKDGKKDGKS
FT                   DNKDEKSDDKSDNKDEKNDKSDKKDENKDDNSDKKDEKRDDNSDQKDEKRDDKSGKKDG
FT                   KRDEKRDDKSDKKDEKRDDNSDKKDEKRDDKSDKKDEKRDDNSDKKDEKRDDKSDKKDE
FT                   KNDKSDKKDGNDDKKDEKNDKSDKKDGNDDKKDDEKDCDKKDGDQKDDKHDDKHDDKHD
FT                   DKHDDKHDDKHDDKKKNKDKNDSDKKKKGGKHDEKHDDEKKDEDKHEDEKEEKKEDKSD
FT                   KKEDKRDDKSDKKEDKRDDKSDKKEDKRDDKKDERDDKSDRKEDKRDDKSGKKGDKSDK
FT                   DDKSDEKDKNECGRFRKCRPIEKPDESKETNPKDDNSKGKKQEDQKSKDGKNKDGKPSD
FT                   DDKTEEKPDKSKGWTKPCDRWKKNKPKDGDNSGKPKEQNPNDEKDKDSGKKGDEKSKPC
FT                   DEPKVQPIEDEKDDKNSKGPKDSKDSKDSKDSINAVKATALPRGKPLRDPALADRLKNA
FT                   HLRSSALPKSQILDPKFPVEPTQKPVPSASLVPKESLVVLPKPPATLVSPAEPPSSTAQ
FT                   PLETSEPAKPAEQAPRSTHKMSSIFIPRFKGFSKFLHAPNQAVLNGQEAPPAAPEPAPE
FT                   AAPEAAPEAGNPDADPAASASPVDGTQASSIVRYTRTAAAGSSAASSDLSDAASTLLAR
FT                   RPGYVTFDGTFPTGKRLEKYYSNHTNGSSFIIDTNVSNVATNLHPWSFVGAVIVLVSSA
FT                   LLF"
FT   CDS_pept        513287..514321
FT                   /codon_start=1
FT                   /gene_family="HOG000206216" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931383"
FT                   /locus_tag="AGOS_ABR065W"
FT                   /product="ABR065Wp"
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50835.2"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG058195"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI0001DB27D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG1"
FT                   /transl_table=1
FT                   /translation="MPQVIRALRCFHSGIFLRQGAVGATGAGGATELEKYRGYFKQLQQ
FT                   ALETGDEEAAGKSPLLHTLHSRLALPQQLGLGTLSRCLNCPSANLADVGMKTAKTAQNK
FT                   EQHNRSLNILGKNLLTLHAMRRLVERYPRLPVPVLNAAVDAYIGLPVLAQIGRGWGIES
FT                   ERETVMERFLRQEPSHMTLGRLRFFNNTLKEIDGIRILSSSNMSESASMAMAVRSIVGA
FT                   LWASTQDLQLVERFLDAHVMSRKLPITQLFMFEQPTRELARLCSREGLERPVSKLIAET
FT                   GRLSKAPVFVVGVFSGEEKLGEGFGSSLKEAKARAATDALMKWYCYQPLPSQGPVIDPG
FT                   QVLV"
FT   CDS_pept        514446..515195
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763624"
FT                   /locus_tag="AGOS_ABR066W"
FT                   /product="ABR066Wp"
FT                   /protein_id="AAS50836.2"
FT                   /db_xref="HOGENOM:HBG058196"
FT                   /db_xref="UniParc:UPI0001DB27DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DG0"
FT                   /transl_table=1
FT                   /translation="MEEWIIEEEVLLAASYYNAQSTSGVGRSRAGTSDEVPKAYLLLGD
FT                   ESAKHVQTPVAIDVRVDAGSKQLMWDASLVAERVRLVQVIHTMQTVVGLLVAGTGKCYS
FT                   TFVLEIAARWPAVHNVFTYGRDGTLQCLDLTLGRQVAYVTAACGMRKYLPQKPAKAGGK
FT                   ETDLEEQSRVLEALQQKVAQIVTYLEGIEGELELPQEEILRQCWLLVCRLRRPPSRDIE
FT                   EEILALETQCQLINVLTTQFETSMLLD"
FT   CDS_pept        complement(515205..516266)
FT                   /codon_start=1
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625855"
FT                   /locus_tag="ABR067C"
FT                   /orf_name="AGOS_ABR067C"
FT                   /product="ABR067Cp"
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="AAS50837.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189863"
FT                   /db_xref="HOGENOM:HBG203384"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniParc:UPI0000252649"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF9"
FT                   /transl_table=1
FT                   /translation="MDFYSNLPVDATATPTLFEITSSHEIDGLLKPTFQYLSANAIQRA
FT                   PTRARIMLHSRFDELYALLKLLLEYYHLDKYNATFIEKYYGLQRESVAGGVAGARLSRG
FT                   QVAVVLCEKVAAVYVRDKLDQLHGRLYGRRLTAKLSAWERWFVRWYPHLKKLVAVASLL
FT                   CKLRYLSGRSRATSVLDYLAGIQYARLSQPAGADAVAAAGAALARPVRTNWPRIRELIY
FT                   RFLKTTGGALGVLTSELFPTFIFTVRLLQQWSQQPTKKQDPWDTLSSAPPAPRPEVLVH
FT                   GDAEATDAAEGEPYISVRCPVCRSAVSNPGVLQTGYIACYPCAVRYVEKHGKCPVMQTP
FT                   LLGGPRGIRKLIC"
FT   CDS_pept        complement(516417..517499)
FT                   /codon_start=1
FT                   /gene_family="HOG000227794" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625856"
FT                   /locus_tag="AGOS_ABR068C"
FT                   /product="ABR068Cp"
FT                   /function="fructose-bisphosphate aldolase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="glycolysis"
FT                   /protein_id="AAS50838.2"
FT                   /db_xref="GO:0004332"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG055949"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001DB27DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF8"
FT                   /transl_table=1
FT                   /translation="MGVQDVLKRKQGVIVGDDVRALFSYAREHKFAIPAINVTSSSTVV
FT                   AALEAARDSKSPIILQTSNGGAAYFAGKGVSNEGQYAAVQGATAAAHYIRSIAPAYGVP
FT                   VVLHTDHCAKKLLPWYDGMLEADEAYFKEHGEPLWSSHMLDLSEETDDENIATCVKYFQ
FT                   RMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYEALAPISPNFSIAAA
FT                   FGNVHGVYKPGNVVLSPEILGEHQQYAAAKVGGSEAKPLYLVFHGGSGSTQQEFNTAIS
FT                   NGVVKVNLDTDCQYAYLQGIRDYVLNKKDYIMSMIGNPEGEDKPNKKFFDPRVWVREGE
FT                   KTMTKRIAEALQVFHAVNQL"
FT   CDS_pept        517676..519244
FT                   /codon_start=1
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763625"
FT                   /locus_tag="ABR069W"
FT                   /orf_name="AGOS_ABR069W"
FT                   /product="ABR069Wp"
FT                   /protein_id="AAS50839.1"
FT                   /db_xref="HOGENOM:HBG027398"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000025264B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF7"
FT                   /transl_table=1
FT                   /translation="MGAKVSFWGRGSVGQITWRGPVRHRVTRGRTRGHAAGCVSRAALE
FT                   QPPARADARAGRAGQRLFIAGGRPARAARGPRMNAAPPPRKFRTDDAGTFGQYTARERW
FT                   PRILQNCLEDLAAEHAEGAAAAQLRELTAQVAALKADVEADRALEFFSAAEERSAHVPA
FT                   SFNSALASSGSRSWLAAEWLTCEIYLYRRLDVLVRAQPAWREHDVFERVKRETFRQSGR
FT                   GVVELAQWFCGAATQLARSRDALEPLFREFVDISLWGNATDLSLLTNVTAAEIESLQGA
FT                   QARAAAEARVLVNDTAAAWAGLSAGPPGRVDFVLDNSGFELYADLLFALFLLDAGLAAE
FT                   VVFHTKDIPYMVSDTMDKDVEQLLADLEDGAFFAVGAAEREALDEVATRVRAALAAGRL
FT                   RLRADSFWTEPQDFWELVPGHAVFEELRQARLVVFKGDLNYRKLTGDRRWPRETPWATA
FT                   LGPLARHGLRVLSLRTCKADVVVGLPAGVDERLCAEWEREGHEHGSWWATCGRWAVVSY
FT                   CDGKY"
FT   CDS_pept        complement(519259..520449)
FT                   /codon_start=1
FT                   /gene_family="HOG000162394" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625857"
FT                   /locus_tag="AGOS_ABR070C"
FT                   /product="ABR070Cp"
FT                   /function="nucleic acid binding"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="AAS50840.2"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG210745"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="UniParc:UPI0001DB27DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF6"
FT                   /transl_table=1
FT                   /translation="MSSTIFYRFRSQKDPSRILFDGTGITVFDLKRDIIQENKLGDGTG
FT                   FQLRLYNPDTGEEYDDDGTVVARSSMVIVRRAPAEHGVAGNASRYVQGRPRVAARAQGP
FT                   AVGGSFGSYVAGGVGGGTEEERIARMFASQENQWQETQQAMSAAVPVYHSRSHGAAQDE
FT                   GPPPPGYMCYRCGGKDHWIKNCPTNSDPNFEGKRIRRTTGIPKKFLKSVEIDPLTMTPE
FT                   EMAERKIMVTDDGKFVVQVADQHSWEDYQRKQQQQKIAVREQDAVWLPNRFEDLPAELK
FT                   CPITNGLVRDPVRTARCCARLVSRAPMEDALLASDFVCPLCGAPDVLLDSLAPDAESAK
FT                   AVDEFLESHGSKRAADAPADDPTKTKMPMMPMPPFGMPFMFPMPFMPPVPPSESKK"
FT   CDS_pept        520555..520893
FT                   /codon_start=1
FT                   /gene_family="HOG000167251" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763626"
FT                   /locus_tag="AGOS_ABR071W"
FT                   /product="ABR071Wp"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="AAS50841.2"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG036091"
FT                   /db_xref="InterPro:IPR003194"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR015871"
FT                   /db_xref="InterPro:IPR015872"
FT                   /db_xref="UniParc:UPI0001DB27DD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF5"
FT                   /transl_table=1
FT                   /translation="MSTTGYYELYRRSTIGVALMDSLDTLISDGRIEASLAMRVLETFD
FT                   KVVSETLRDKTSAKLTFKGHLDTYRFCDDVWTFIIKDCQVNLDQPSADGAESSFTCERL
FT                   HIVACNSK"
FT   CDS_pept        520943..521986
FT                   /codon_start=1
FT                   /gene_family="HOG000176034" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625858"
FT                   /locus_tag="AGOS_ABR072W"
FT                   /product="ABR072Wp"
FT                   /biological_process="regulation of signal transduction "
FT                   /biological_process="response to biotic stimulus "
FT                   /protein_id="AAS50842.2"
FT                   /db_xref="GO:0009607"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="HOGENOM:HBG324543"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="UniParc:UPI0001DB27DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF4"
FT                   /transl_table=1
FT                   /translation="MVTVRERYRALVAAAAGAAGRQDEEAYQAEVARTLEGLAEVREAV
FT                   HTLGLFSRNEGVEDVATGTLELLALDWQLARVAARRYRRGADARRWRLRCLEEAVQFAM
FT                   QFLVGLQDYGVLDEALSKRLDGFEKTFRPRVEEMYPQPQSARDLGGAHLRREAKIAQFR
FT                   RVRELEAQLDELEARRAAAGADEELERRLWLAQLQQMSYECFGELEGWLMEMELLRNTE
FT                   PADEPAAAAQATPDSQEYTEKLESLQKPLLSKYGKVLRNFTLVDQRDRVKERVLGYGQY
FT                   GPTMTVEEFLEQEFESGRVLQGGEEPEEVPDEDNEEWQDKQTYKEREWDEFKEANPRGS
FT                   GNTMNKG"
FT   CDS_pept        complement(522056..525136)
FT                   /codon_start=1
FT                   /gene_family="HOG000113870" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778403"
FT                   /locus_tag="AGOS_ABR073C"
FT                   /product="ABR073Cp"
FT                   /function="binding"
FT                   /protein_id="AAS50843.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058197"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR021717"
FT                   /db_xref="UniParc:UPI0001DB27DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF3"
FT                   /transl_table=1
FT                   /translation="MAESQLSKLDVNLQSLNPYTFSKTRCIVNLHISDDTKNRDPSTTN
FT                   GSYSNSQLLSNGEHVCYHFSQDYCVLSIYPVTDAITGKTVVVHLPHETFNDHHTFTMAE
FT                   EDGCIVMDLILKTGLFLTLRFSLEYLFNRNADINSSWYSLLKPYDFTVRLPDYLYKVNS
FT                   ALSIVYLNDGGLLGLQKTQTSGSDEYDLHPVLFNDNSYFQSFTRFFSHNDSGRENVVSS
FT                   VSYGDYHLLTLTENCKLRIWDLRTNSVTAQLNLITDPQDKHRKYESIGPYLALLDSVLV
FT                   VFLPFGNGAFRTFQLSVNNSGGLVLTPRGELIRTNLSTASIWSLVDTKLTKPFELNIET
FT                   SYLQMVVLWKSNTSIKLQILNFETEALDKHSWVEASNKSLPDILDNDILGDNFEQSLLD
FT                   LKAHYTPAIYEEAQRILSANGIIFVPSQQNNDEYLSNLESILKDLKKHHDEPSSLTLYN
FT                   GEVVMVNTLYLYNHFVYKINSKLESFYYNLTSENEATQDDLLTYLQVVNGFVSTLSSET
FT                   LQRTSRKLCGLVTGELQGNMPLKDKFTAIFKECLESQFQVSNLKKLYDRLTSLDIMTLL
FT                   KSFIENHLQNSLLTPTLIDSMSFDNFSSVALLESVYQCVLIENKFIVDTLLIFTLMDFN
FT                   YSMFEKQLNFLLKTHYNQSLWLQLYRLDKSLLISEIFVATSKYGYGPKISSYADLSAAT
FT                   KRIVTYIAEAPLLENPFLIAPYNKWIIHPKNNSTVRNPSFFLDTIHTQFYVRENTVHQF
FT                   MLGLSYYRCGRYEEAYSYLSRAETAAIKPKQLPLCLQLITKAANHPWQSIISDLGVEPQ
FT                   AAGYYYNLSKLFSNVMSYSYALQSIKKSIALSQEVSPSTEFRILQLTQFMDTLIIFDEF
FT                   EEVLDVLTLEQETLGRDIRTSYYERLLSDQQLRDRFITTLFRLCSTSCEKLYLNLDDFL
FT                   IIDSLLRSQLDASMWDTYKRLFCYRILNHHEREAAEVLYEYIGRGNDPIVKEKCYWMIV
FT                   NVLASLSPQDQWIINSSNRGQVVYLADIRKDLQALTA"
FT   CDS_pept        complement(525487..527178)
FT                   /codon_start=1
FT                   /gene_family="HOG000112503" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625859"
FT                   /locus_tag="AGOS_ABR074C"
FT                   /product="ABR074Cp"
FT                   /protein_id="AAS50844.2"
FT                   /db_xref="HOGENOM:HBG124003"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001DB27E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF2"
FT                   /transl_table=1
FT                   /translation="MNQQSTGSLSAQYTLPGVMHYLQTEFTKNERDRINWELERCEMKA
FT                   RIAQLEGENRDLRRELVRCAQGHERPEEVQPVEPSLLKAKLSVQENVKEIVYLLKSPQV
FT                   TDQLDAWNEKGSSVHLLETMNLHVKKAAHGAPLTSGGTSPTSAELELGQPVAAGLPGSR
FT                   GYESDQDTVILEEPPVRVPPSSKQRGLAAPPLTPRDTPSMSLEGATGPLSNTSVIQPVA
FT                   GDSAPVAVEKLTLHQKNLLTLTETGHLKHWQINLNLELTDSLTQVSFEGLGPHVLGLFW
FT                   WDSKTFMTLDTNGLKVWSVELPEPVMLWECFQDLPFETVDMVDFKNKWLVLKVAEKILI
FT                   WKICTTGEQHTLQMSNDYEIWLHNQDPTFFILGLTEESLLVLYLDPCQLAVYNFQGKIL
FT                   QQVDLSHLVKDLKPRGKNTTRLVLNKKTSKLLVQVNKQILIYSFDQKKIVASFELGNAP
FT                   SHIIFKFNSESIILGYLDGTIEVRNLNNFETAVKRYNHFESVQSAHEQPQQSGFQKSPN
FT                   TDAQIDALLDRNLTSMDIAVIDGVPVVVSGGTDGYIRLESVWAISY"
FT   CDS_pept        complement(527391..527894)
FT                   /codon_start=1
FT                   /gene_family="HOG000203361" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763627"
FT                   /locus_tag="AGOS_ABR075C"
FT                   /product="ABR075Cp"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50845.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG028794"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="InterPro:IPR018103"
FT                   /db_xref="InterPro:IPR018105"
FT                   /db_xref="UniParc:UPI0001DB27E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF1"
FT                   /transl_table=1
FT                   /translation="MIIFKDLISGDELLSDAYDVKLVDGVIYEADCAMVKVGADNVDIG
FT                   ANPSAEGGDEDVDDGTETVNNVVHSFRLQQTAFDKKSFLTYIKGYMKEIKNRLQETNPD
FT                   EIAIFEKGAQVYVKKVIGSFKDWEFFTGESMDPEGMLVLMNYREDGVTPFVAIWKHGVK
FT                   EEKI"
FT   CDS_pept        complement(528015..528830)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18082756"
FT                   /locus_tag="AGOS_ABR076C"
FT                   /product="ABR076Cp"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50846.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB27E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DF0"
FT                   /transl_table=1
FT                   /translation="MHSLAVAVVTGGTRGIGYQVVQRTLAEGLSCVFVGSSEASVATAF
FT                   DQLGCTPLREHQFVRGVALDLATWPAWPAQASFPCWERSAAGSAQRAAALLDLAPGGPR
FT                   RARYHYDLLVNCAGVSQASLAAHTSADAAARLLHVNLGSLVSLCQLSVRPMLRARRVAH
FT                   ARPTIVNVASVLGCAHAQPPPGTAVYAASKSAVIQYSRALAAELERTGIACHAVAPGLV
FT                   PDTDMIAALPPDARARLAAAFPEAPTTPRAVCDHIWRLYRQPSPRAPGP"
FT   CDS_pept        complement(529183..531300)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778404"
FT                   /locus_tag="AGOS_ABR077C"
FT                   /product="ABR077Cp"
FT                   /protein_id="AAS50847.2"
FT                   /db_xref="HOGENOM:HBG058198"
FT                   /db_xref="UniParc:UPI0001DB27E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE9"
FT                   /transl_table=1
FT                   /translation="MSQQYSRRGGGKAKRTQVDAEKKFKLDTLTELFPDWTNEDLIDLV
FT                   HEFEDLETIIDKITTGAVTKWDEVKKPSKKDRQQKEPAGDVEHIHAGSAAAAFGASAQA
FT                   QGAPASLQRSHHSAGHQNNAKPYQRQSKYSNSPRQGKQQHQRKEKVAKENLKPAGQPAK
FT                   STASSTSWAAMLSKKEDSKLQAPEQQLEEQPQAQSQAQQTEEPVAKESQTEKKVGPQPV
FT                   AAPLHEEQDSKPKKMTWAAIASKPPKHAENASKKPQEILQNVQDLKKEINKIATEDTAV
FT                   EHSETTVTHSEVGVNAQAEHESFPIEDGARSVGADDTYYAENVDATNEDAAATVNGNAP
FT                   AASEEAAAQEDASNANANVPVSLPAEANHQASQQVSFGSEEKQQTPQQPSQQGGMHAGQ
FT                   HVVSQVPQSAQHSSQAAAQTSQQVASQAPQQQTPQQAYYQDTYTQQLPQQQAQAAQAQQ
FT                   YYMNQYQFPGYSYPGMFDSQSAYPVYNHQQFAVPQQGQPTAQSSQNSQQAQSQSQQQQQ
FT                   QQQQQQQQQQQQQQQQQQQQQQYGIPPGYVQAGELAAQSPASTHTQPQQQPQYGGYGMP
FT                   YYFYQQSFPYAQPQYGMAGQYPYQVPKAAYNYYQPQQMSQAGNQATHQSQSSQNDDSSS
FT                   ASAANPQQGQQGGANSQQQSQAAAAQAQAAAQAQFQQYYQFQQQAAANQQGMPYGYSGY
FT                   DYTSQTSRGFY"
FT   CDS_pept        complement(531646..531900)
FT                   /codon_start=1
FT                   /gene_family="HOG000230782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763628"
FT                   /locus_tag="ABR078C"
FT                   /orf_name="AGOS_ABR078C"
FT                   /product="ABR078Cp"
FT                   /protein_id="AAS50848.1"
FT                   /db_xref="HOGENOM:HBG371551"
FT                   /db_xref="HOGENOM:HBG398501"
FT                   /db_xref="InterPro:IPR007918"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="UniParc:UPI0000252654"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DS2"
FT                   /transl_table=1
FT                   /translation="MGNAMSASFAPECTPLKETYDQCFNTWYSEKFLRGRSTENECTES
FT                   WYAYMHCVEAHLVKQGIKPALDEARKEAPFEDEGQTRSQ"
FT   CDS_pept        complement(531960..532505)
FT                   /codon_start=1
FT                   /gene_family="HOG000034102" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20625860"
FT                   /gene_name="ASK1"
FT                   /locus_tag="ABR079C"
FT                   /product="DASH complex subunit ASK1 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS50849.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG058199"
FT                   /db_xref="InterPro:IPR013964"
FT                   /db_xref="UniParc:UPI0000252655"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DE8"
FT                   /transl_table=1
FT                   /translation="MARQPPAPEPTLEQLDQEITLQLQKIDANLSACFSKITKDIIPAV
FT                   ARYGAVCDDALSACSWLRELFQKSSDIQLATEPAAPAPAAESLFPQAPAPRAPEVTTEG
FT                   HVLAVPVSSDDEPDDGSTLQRQHKRRKLSLQLQQRYGSSSSSSFVSRSPTLRTRPASSP
FT                   LRAPDDPDPPAVLRFAAR"
FT   CDS_pept        533170..534192
FT                   /codon_start=1
FT                   /gene_family="HOG000246654" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763629"
FT                   /locus_tag="AGOS_ABR080W"
FT                   /product="ABR080Wp"
FT                   /protein_id="AAS50850.2"
FT                   /db_xref="HOGENOM:HBG058201"
FT                   /db_xref="InterPro:IPR019402"
FT                   /db_xref="UniParc:UPI0001DB27E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE7"
FT                   /transl_table=1
FT                   /translation="MGFPPPGNYFFLVPWIAVIPWCGMLIAMLVCWSVQGHPIYWFMDG
FT                   DQFPVYISDIGATNLQPLFVTCVAWQGLWYCIMVACEFFQRSGHWPLPWLARQRLPADV
FT                   EPVSSSSYMGSELSMRVRYAELLSSSRFLMPPYYTKHERNLIFASFVLGLIGELAILMC
FT                   AIFSTAKFHKVHLSMVGVFVSMMYFSILCAAIEYLSMGRHYARLHPLAGSAAHVGSASS
FT                   RHGHVWNKLTVSGTVKMVWLFLAAAWAICFGAVKNPSISASFEWVLAFWLCAYYVIVSV
FT                   DFYMGSRYKESKYFHQITNFSGYYKYDQLVLGEAKLHVERVGHDAGQDYRGNTPVDIVT
FT                   "
FT   CDS_pept        complement(534626..537151)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931384"
FT                   /locus_tag="ABR081C"
FT                   /orf_name="AGOS_ABR081C"
FT                   /product="ABR081Cp"
FT                   /protein_id="AAS50851.1"
FT                   /db_xref="HOGENOM:HBG124004"
FT                   /db_xref="UniParc:UPI0000252657"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE6"
FT                   /transl_table=1
FT                   /translation="MSLVSAAVGDERGSGGQPHKKSVYKPNGQPLSKEALYRAQLKYGT
FT                   YKSPARGGNLGVQDSKTASDKAATTANSNKKAVEAYKRMFVDSNASKAASRAGQQPAPA
FT                   SSAVEPAKQDTSPAAARAASGGQGLRGPTNPKAPALDISKVLEGAERAASKRIQERINP
FT                   EKVNFTYGLRTGPVESRSSSERTFSINNDLALKTKGDYLREIDGETDPDPTKLANYASS
FT                   AAIKSYDANNPMDREVIERHARDTEMFKHLSSQQVLAKARANADATISKLDREAKEKLI
FT                   FSNEGYNKAAIEIAKKNHAERQRLTGGKVNLGGGLWVYPEEVEQVAQGLVNPVLSDVDR
FT                   RASEQREVDAEIAKRQAQYEADLAEWQAIQREKAENDALEQSQAVDRREIELYDTEETL
FT                   QKKTVELAQEHAVIIEGKKLELNELKRQHAALLQQSTALYEQERAHIDAELSKQRQENA
FT                   VSLELAREEEEKALEPVIGELCETEEEHARLVEERAKLETSLSTVLSELDEYKKTVLEL
FT                   ESQLLSTTASLEEQQKGLRALISSEKELEDDINNNLSTLVISSREEASSTARELQVKEH
FT                   EAEAVIKEHKADLARSQQLLEEEKQILMQTVDELNKLKEQAKVEEPHIRPAVTLSVTES
FT                   TIQQSTSSQPASVVQRAPMHQVGQQPQNVSAGESTVHQTVSTHPSGIVQGSSSVSQPHA
FT                   IHKPSSPMDEFYSKGAQQPEHLAKLTKSSGDKPSLKQRKVNGPAYVASSPSKKDSALGR
FT                   FFHKLIPSKKSSGKGQHGVARSSTVPSRKMQTGQRPVQPATTSNQSVPRHLAREVEEDV
FT                   DAEDVRDLLETQRASGGKIRKGSLFKEVF"
FT   CDS_pept        537752..539803
FT                   /codon_start=1
FT                   /gene_family="HOG000112128" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763630"
FT                   /locus_tag="AGOS_ABR082W"
FT                   /product="ABR082Wp"
FT                   /protein_id="AAS50852.2"
FT                   /db_xref="HOGENOM:HBG058202"
FT                   /db_xref="InterPro:IPR001060"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI0001DB27EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE5"
FT                   /transl_table=1
FT                   /translation="MAQNYNYQLNFWDDQEEGVRILLRHVAQGLDACKNMVTFFEERSK
FT                   LEKDYSRKLGAIANRLEQQLESTPDYGNMQKCAELCRAEQSKLAQSHSKQAEQIYRENY
FT                   LSLKEFVSDGQARYKTLEGKIRQLRQDKLQKRQMYDELLDKLEKAKAELREIQLNQINV
FT                   VSGREMTANERQLNKWSAIVDELHRKIDVLGQEYKSAKRHWLQEWGPLSMDLQLLEESR
FT                   IQMTKTKLQEFVTFSTDCAIHEQISMDKMTNMLSGFTAQQDIHSFAYNHGTGRIKSKSV
FT                   EATFNKSASVATPVDKHTENMRILSSKLSRNRPASQRMPSNEFCRDPGSDNSSVIVLDD
FT                   DIMYGQPAKMCDNRISCISNDLADYSIQSRVSSVKRSSMHGRPIMSAASRSPTEPSYLD
FT                   RHPIDYADHTPQSAAMKGYLQQQQQTQNTEIRRAVREQQLQHREGRFNTGPLSAGSSSS
FT                   NSNPTDTTARSMATSADSMVTSISSYASSIDDSQRLAKSWNSRNRRKSRDYSRPREADS
FT                   RHSSDEDRILGQRTEMSGVTPTRSRSHHRKSLGSDVEGALRALEEDEMRKRNGRDDRSS
FT                   HAGRSAHSDDFESSRTINRQPQFIPFQRTKSVAMEWPKVTSKGRRVIGYARAIYSFTEP
FT                   NDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVELLS"
FT   CDS_pept        complement(539923..540537)
FT                   /codon_start=1
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931385"
FT                   /gene_name="CSE4"
FT                   /locus_tag="ABR083C"
FT                   /product="Histone H3-like centromeric protein CSE4 "
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50853.2"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI0001DB27EF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DE4"
FT                   /transl_table=1
FT                   /translation="MEQSMSSEQAERVAGRVEQLGGFQNNESINQRALLLLQRNRQRRQ
FT                   LLQRQEDRTRYIPDDAKRRVVERVAEPAAAESRADGAREEERAARPARPRETRRIAKKP
FT                   QRYRPSDVALQEIRRYQRSTELLISRMPFARLVKEVTDQFTTVDQQMRWQSMAILALQE
FT                   ASEAYIVGLLEHTNLLALHAKRVTVMRKDMQLARRIRGQFI"
FT   CDS_pept        join(540872..540901,540960..542324)
FT                   /codon_start=1
FT                   /gene_family="HOG000034076" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778405"
FT                   /locus_tag="ABR084W"
FT                   /orf_name="AGOS_ABR084W"
FT                   /product="ABR084Wp"
FT                   /protein_id="AAS50854.1"
FT                   /db_xref="HOGENOM:HBG058203"
FT                   /db_xref="HOGENOM:HBG396905"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI000025265A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE3"
FT                   /transl_table=1
FT                   /translation="MAPLRQDSYFLIYPRSRTTLVQFGIGEETFVPPSWEVPTRVYRDE
FT                   EGQLTSFESAEVVYPIVDGRIADLDGLLYFLKLIYKSILSHWIAEHPDTWEAHASNIPM
FT                   LLLTHYSWSQREQELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNCLVIDIGATHTD
FT                   IVPIVDYVPLDYMAYSAPIGGDDINAKLATLLPGWSPEQIEDLKKSPIFEVLSKDAKDQ
FT                   SRFNFDDDAADGEDNDEGTLDVAAIVTSGRDTREILEERERNKNKEQVSNSQLETNVFA
FT                   DRTGKQINVGKQRFQGCDDLLKGISQACGMVLAQIDEIPKNRAIWENILIAGATSEITG
FT                   FREALLTQLCEDNLVLEPEGEKHQREQDMMASMPKQRKNKYIGSASVSGGFLTSLEYLQ
FT                   SPTIIKSPKFPDYFTEWKKHGYGEVAFLGAQIVSKQVFGHSNDSFFMTRDKYDEKGPAI
FT                   IWDVCF"
FT   CDS_pept        complement(542415..543713)
FT                   /codon_start=1
FT                   /gene_family="HOG000168309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931386"
FT                   /locus_tag="AGOS_ABR085C"
FT                   /product="ABR085Cp"
FT                   /function="bile acid:sodium symporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50855.2"
FT                   /db_xref="GO:0008508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058204"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="UniParc:UPI0001DB27F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE2"
FT                   /transl_table=1
FT                   /translation="MRSMRSLGSRIWEHRVTQLIVGQWFYIGLAVAVVLAYYFPNVGRH
FT                   GGVISGEYTIGYGVVALIFLQNGLSISTKDLKVNIFNWRAHLVVQVLSFLVTSAITYGL
FT                   CCWIKSSNDPRIDDWVLVGVLMTSTLPTTVASNVVMTTNAGGNHILALAEVVIGNVLGA
FT                   FLSPLVAQMYMSTGPMKYGNPASGSSVKALYGQVLKQLSLVVFLPLIVGQVLRNVFPKQ
FT                   VKWTLETLRLRFLGSVCLLFITWSAFSTAFYQKAFETVSRICIIFLVFFNIGMYLFHTM
FT                   TSFAVCRSPVIKRGFATRPGPDSSVLYTASYRIIQPFYFNRLDTVAVMFCAPAKTATLG
FT                   VPLVAAQYGSDSPNLGKLLVPVVIYQFEQIVVAAWLVPLLRAWCRKAKPKPDLDQTYHD
FT                   NISRPTTTTGQGIQTDMTHYLDEEPVKPSNYIH"
FT   CDS_pept        544050..544556
FT                   /codon_start=1
FT                   /gene_family="HOG000003673" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931387"
FT                   /locus_tag="ABR086W"
FT                   /orf_name="AGOS_ABR086W"
FT                   /product="ABR086Wp"
FT                   /function="serine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50856.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008236"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG450547"
FT                   /db_xref="HOGENOM:HBG596607"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniParc:UPI000025265C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE1"
FT                   /transl_table=1
FT                   /translation="MFTSRLAKCSLVAVTWLPVYMTVTHHVVFISKVEGPSMRPTLNPM
FT                   DGVASDWVLVWKLGKTNIRNLNHGDVVIFRSPMNPKKVYCKRIQGKQYDTVRTRYPYPK
FT                   STCEVPKSHIWVEGDNVTQSVDSNHFGPISTGLVVGEVTRVIWPPSRWGADLHEGMGRR
FT                   AVVAS"
FT   CDS_pept        complement(544661..546067)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625861"
FT                   /locus_tag="AGOS_ABR087C"
FT                   /product="ABR087Cp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="M phase of mitotic cell cycle "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50857.2"
FT                   /db_xref="GO:0000087"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG058205"
FT                   /db_xref="InterPro:IPR000751"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI0001DB27F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DE0"
FT                   /transl_table=1
FT                   /translation="MQEAGDSKGRRSSFHGGSSSFLKNLNSLLKLKKSPGRPAEGAEPA
FT                   NEPHLGDNAKERDRGLCTRPPGPVSRCSTGTVYRSPSHRRQGSSASAKREFKPSHATAV
FT                   QHASHCCNCMLRGMQPPADSPAERGVTRGEAFANPVCSRGLESKSVPPYVYDSRLPASA
FT                   IPWHTKDSSTDQLPRISVDVLAAILDGKFSSHYSEVYIIDCRFEYEFQAGHIKNAINVS
FT                   SRRELEAEFIQKRIQRCSADPGRPPLLVFHCEYSSYRGPIIAAHLRNYDRILNHGQYPR
FT                   LHYPDIVVLEGGFKSFIEAFPGFCQGHYVGMDSYVNHELELARFKRDSKTILTRQNSQH
FT                   IFQEQGQEGGHGLAGRAYQPDPVATLLPTRRPSFSFDAPPQSPSLVIGGNSGSSACSCS
FT                   SSTRSVLTGKMLLMHDLTTDVKACDKDDQDDQFSFDLGDELAITVEDLFSSPVGRRLFP
FT                   EIVKEEDNDS"
FT   CDS_pept        complement(546573..548171)
FT                   /codon_start=1
FT                   /gene_family="HOG000141700" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763631"
FT                   /locus_tag="AGOS_ABR088C"
FT                   /product="ABR088Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS50858.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058206"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001DB27F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD9"
FT                   /transl_table=1
FT                   /translation="MKSYPTIVQFNEGRHSLLLRSISSRSSSRLTDTVLGRSGCGGDAV
FT                   TYAALFEEYNKLVEMVLLQKTTRLIGGRESVQVNQYMLEGRLGRGRFGTVLRGRRVAGC
FT                   RRGQHDTAEVVALKCIMKRPVSSLFSMNQIMRKRARLQSSGGTPPGTLTATPEPTDKVF
FT                   RRSSTKSLTSIPVEYLDSDWIMIEMNLLRIRKECLIHGQLPPHPHVSRLLEIIDSPRSD
FT                   RVWLIQEFASLGELQWERASKQQVPEQWCQFMKPSVTRAEFALKVLRDLSLGLAFLQKH
FT                   GIVHRDIKPSNILLDGTRGTAKISDFGCSILKPDHLPWWKHDPEKQRWSRAFQDEVSKI
FT                   VGTPAFIPPELCDFTLEEEGNSRKSPSGRPAADDPDRGFKVDIWSLGVTIYCILENRLP
FT                   FFGENEFETYHMVVTAELSPLPEDPADPDLEWLYVFVTHGLLCKDWTRRPTAQEVLTQL
FT                   ALHCGDHSSKMSKVKKKFSTWKRKIARSVVHRSAGQQPSESLTGTIFSHSSSSSSNVSS
FT                   IFTTDSSIELIESHR"
FT   CDS_pept        complement(548518..550233)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625862"
FT                   /locus_tag="AGOS_ABR089C"
FT                   /product="ABR089Cp"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50859.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058207"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001DB27F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD8"
FT                   /transl_table=1
FT                   /translation="MTSAEYTAYLLGAELGQGATAMGLTGAEGLYSNNSLNITAQPADK
FT                   GMVTPQLVDTPNTLKSSKTQLGTPTAMTDLLAMLDDNTAFSDMVQQQEERQWDLERQRS
FT                   KFAAQAASAVTSGRTTTSTELSPQMLLQSEVGGDSGLLDMVHDEHTSLLPLQQAEQQFI
FT                   NPNLLSSGAGSSMFADDGLIDEPIAHGSASQLIIDEMALSPGQRRLSDVVTGSIPHQQH
FT                   SRGSISHQVDFWNMSNERQSICSSHSATYPQRNSIDLMSFKKSPTPNMLSGVSGVNIDS
FT                   TTPVATSATGHMTTASSSHSNSATAVGTVAPSVFKIDNELTQLLNEYNINFNAPSKTAS
FT                   TRMRAGSLNPTGSAAPTTSASGSNIISSAMAAASRRSNSVSEPHRVQKHRASMSVIDGA
FT                   NPVLMDKLYGDVNKVKPVQWESAVMSDDDDHEEQRLSVAQQLDPKSLPGAGTFITPAVL
FT                   DGLDNTSYDMRNPSYVVPTRRKRASVSKASRASKSSSPLEEEEKPFKCQECTKAFRRSE
FT                   HLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDIKDTPPTTKKG"
FT   CDS_pept        550926..551180
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778406"
FT                   /locus_tag="ABR090W"
FT                   /orf_name="AGOS_ABR090W"
FT                   /product="ABR090Wp"
FT                   /protein_id="AAS50860.1"
FT                   /db_xref="HOGENOM:HBG058210"
FT                   /db_xref="UniParc:UPI0000252660"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD7"
FT                   /transl_table=1
FT                   /translation="MQGGIRRKQDLLPRYNTPATRQAGLTTPLKKLLAYLVLLGLVFLA
FT                   VRTGLSGSAEPPAVELEAPRAPPVEERVAGGREADVAGM"
FT   CDS_pept        complement(551190..551906)
FT                   /codon_start=1
FT                   /gene_family="HOG000263450" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763632"
FT                   /gene_name="CCS1"
FT                   /locus_tag="ABR091C"
FT                   /product="Superoxide dismutase 1 copper chaperone "
FT                   /function="superoxide dismutase activity"
FT                   /function="superoxide dismutase copper chaperone activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="intracellular copper ion transport "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="regulation of oxidoreductase activity "
FT                   /biological_process="removal of superoxide radicals "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50861.1"
FT                   /db_xref="GO:0004784"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0015680"
FT                   /db_xref="GO:0016532"
FT                   /db_xref="GO:0019430"
FT                   /db_xref="GO:0051341"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG027548"
FT                   /db_xref="HOGENOM:HBG324056"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniParc:UPI0000252661"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DD6"
FT                   /transl_table=1
FT                   /translation="MIDPSESFEATYAVPMHCGDCTGEISRALRAVPGVQEVTPDLERQ
FT                   LVAVRGIAPPSSIVQALAATGRDAILRGSGEPDSAAVAILESASAGGPPVRGLVRAVQV
FT                   APNKTLFDITLNGLPGPAQYYASIRASGDVSRGAASTGPAWHVFEDAVACERASPLGAD
FT                   LCAGSALFVAPLAVQALIGRGFLVGADRGHALAGAAAVGVLARSAGAWQNDKVVCACSG
FT                   DTLWQERGSARSANIA"
FT   CDS_pept        complement(551989..554994)
FT                   /codon_start=1
FT                   /gene_family="HOG000066095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763633"
FT                   /locus_tag="AGOS_ABR092C"
FT                   /product="ABR092Cp"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50862.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058211"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniParc:UPI0001DB27F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD5"
FT                   /transl_table=1
FT                   /translation="MSDKASGELAVPLLHESTGQNGKHAKKKKGRRRSVFQHSSPDDGC
FT                   DGGPTGPAVYAKDFGKPEVWGMLHDSDEDSTMGRRASGGAGASFIDHRQSMAVMDAAAS
FT                   SQNAASGCMNSIWRRPSTMPRNSTPGAMSMEGTARQGRETSFRDPFGAHSQDDSRPRRR
FT                   RHSSKASLRDPERAAGGQDYGSLSTFPDKLSQSPLARDRRADVVIDMDKLMEHVKMKRE
FT                   QEQLRDPFSSDAHSDRPSDEYNSQPSSRRSSESSSLDDVCLPIDEVDEDGYKEWPDVSV
FT                   LEEFSKEEIQRLKREALSDAEDFHFRYEDEDDDDTADSMQNNGIAFLHPIITNIDMPEL
FT                   GNTRVNETEQLRKGRLRPKKLTPWHLKRGSFDLPGLNAAGKPTTRDLSGHGRGDLLAGR
FT                   NIKYPPHIISNNPETFRFTYFREDLDSTIHSPTISGLLQPGQRFEELFVGSVYSNSGGD
FT                   RAGSNNANGTAAVSHAPGNINPNVHGAPSNANLANLGAPANNENSTQHAPNHPSVAAAG
FT                   MNAGTGSGTPVETQASTPVQPASTAQQSGSWDMPDPQPFWLDVLNPTEEEMKVLSKAFG
FT                   IHPLTTEDIFLGEVREKVELFRDYYLVCFRSFDIVAERSTRKKKRQQQFQENAGSGAEE
FT                   SSAEEDSKAGWFSRFRKMRRRSSAKNAAGSSTSSYQRRIKKKIEENEKYKKKSGDRRKP
FT                   RDGELEPLNVYIIVFRTGVLTFHFAPTPHPINVRRRARLLKDYLNVTADWIAYALIDDI
FT                   TDAFAPMIELIEDEVYDIEDAILNMHHIDDSSDDDSDAEDCSDDDGSFPFDRHSRSTAF
FT                   SRGSKSTGTSRSSSSTESTINANIMGWKKKGDMLRRIGECRKRVMSVIRLLGSKADVIK
FT                   GFAKRCNEQWEVAPRSEIGMYLGDIQDHIITMVASLNHYEKLLSRSHSNYLAQINIDMT
FT                   KVNNDMNDVLGKITILGAIVMPMNIITGLWGMNVIVPGQQQDSLTWFVSIALSMLILAY
FT                   IAYTYMRRRFGF"
FT   CDS_pept        complement(555260..555904)
FT                   /codon_start=1
FT                   /gene_family="HOG000000752" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625863"
FT                   /locus_tag="AGOS_ABR093C"
FT                   /product="ABR093Cp"
FT                   /function="DNA binding"
FT                   /function="transcription coactivator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="AAS50863.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003713"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG058212"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="UniParc:UPI0001DB27F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD4"
FT                   /transl_table=1
FT                   /translation="MSFNSFPSNQLYGAHRYSSAYNAVAVPDSGPGAGRYRKRKTQEAA
FT                   EDNVFFELGKNKRVTVRQFRNINLVDIREYYQESATGEMKPGKKGISLTEEQYDELLQH
FT                   RGQIDEALRSFGSARRRSPPAEPARAEPVRELEPNKKTRIERREKARKRERMPANPRLD
FT                   NPRLDNPRLDDACPPRPAAHDDDDLNSSDEDFAQALESEVRRRDEDISEEE"
FT   CDS_pept        556183..557262
FT                   /codon_start=1
FT                   /gene_family="HOG000250267" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763634"
FT                   /locus_tag="ABR094W"
FT                   /orf_name="AGOS_ABR094W"
FT                   /product="ABR094Wp"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS50864.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG397216"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI0000252664"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD3"
FT                   /transl_table=1
FT                   /translation="MRCAVFQRRRRREHVMELRTTVRRVKELDIVELPELILGGATLSP
FT                   RYIDDPYEVPTLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHPRETYFICT
FT                   KVGREGPSDFDYSAAHVRASVHRSCARLHTEYLDLVYLHDIEFVEAAGIWEALQELRRL
FT                   KDEGVIRFFGISGYPVELLQEVSEQACERPDVGPLDAVLTYCQLTLQSVRLLEQEERFF
FT                   RQSRVRVLGNSSIVGMRLLRSGGPRPFHPASVELRQCAEEAAEYCAAHGTDLADLATRY
FT                   SLAEWHGRGPTVLGVSTMDELERALKNYHLVLEQGGLSEKDTALVEHIQKRIFADHLNE
FT                   NWPSGLWSRFLRRPGAVPT"
FT   CDS_pept        complement(557279..557845)
FT                   /codon_start=1
FT                   /gene_family="HOG000066041" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763635"
FT                   /locus_tag="AGOS_ABR095C"
FT                   /product="ABR095Cp"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50865.2"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG489199"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI0001DB27F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD2"
FT                   /transl_table=1
FT                   /translation="MSMYLTLLFLVLILEMSVLFVLVLPLPFRIRRLFVRSYDKLQELG
FT                   QLRTVGVILYGLVGMLFLDSWWRAQRATQRFSEGATQDPLNTGLQTFATKAYNERNLYI
FT                   SGFILYFSICIPTVINILKSLIRQYELGAAAAGDDTEEVKLLRQELKGKQASLTALRAQ
FT                   KKNLETHFDSSTESGPQDTAAKKAQ"
FT   CDS_pept        complement(558591..559046)
FT                   /codon_start=1
FT                   /gene_family="HOG000224564" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15763636"
FT                   /gene_name="NDK1"
FT                   /locus_tag="ABR096C"
FT                   /product="Nucleoside diphosphate kinase "
FT                   /EC_number="2.7.4.6"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="nucleoside diphosphate kinase activity "
FT                   /biological_process="CTP biosynthetic process"
FT                   /biological_process="GTP biosynthetic process"
FT                   /biological_process="UTP biosynthetic process"
FT                   /protein_id="AAS50866.2"
FT                   /db_xref="GO:0004550"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006183"
FT                   /db_xref="GO:0006228"
FT                   /db_xref="GO:0006241"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG174293"
FT                   /db_xref="HOGENOM:HBG445152"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="UniParc:UPI0001DB27F7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DD1"
FT                   /transl_table=1
FT                   /translation="MSDERTFIAIKPDGVQRGLISQILSRFESRGYKLVGIKLVTPTEN
FT                   LLKQHYAEHVEKPFFPKMLAYMTSGPILATVWEGKDVVKQGRVILGATNPLNSAPGTIR
FT                   GDFALDMGRNVCHGSDSVESAQREIDLWFKKEELVDWKLNQLSWIYE"
FT   CDS_pept        complement(559364..560773)
FT                   /codon_start=1
FT                   /gene_family="HOG000113087" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931388"
FT                   /locus_tag="AGOS_ABR097C"
FT                   /product="ABR097Cp"
FT                   /protein_id="AAS50867.2"
FT                   /db_xref="HOGENOM:HBG253296"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniParc:UPI0001DB27F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DD0"
FT                   /transl_table=1
FT                   /translation="MPTHLYQPTDIVLAKVKGYPSWPAMIIPQEIIPPNVIKLHRRSQR
FT                   QQEEADDEGNEDENEDESKYIIYSDLLKFRKFERVQSSYCLKFLCDDTYTWVKAQDITL
FT                   LSTERCREWLDRSGSGKRQHKNKKLIQAYEMASKGSGEIDVWEFVEYGSAGRPEEDEEE
FT                   YVDESPAGDDDDAEELQEFGEDEMLDDDDDDDDDDDEMEDRQKRKTRSAVRPTRSSKRQ
FT                   RAAREKVQQERPLRRTRSTRARAEPAPDSDDFDEEMDEESEEVDIPSRSSTRRHTRRTS
FT                   PADKKQISNGKKAAAEPERYRYEDDEDWQLVGKGPQDLTVHSSNPLVNRLSQKKNLELH
FT                   NELKLDLQDKLLMTNKLLMEAILNSHATQEEFEVILDELDIALGMKGTHNELITVFLGN
FT                   NELLANFRALFNLKQPALKEFGLWDKFMGIFSDIYGFAYVPEQKPWTLHIDADADTASE
FT                   TVPDGITDDKP"
FT   CDS_pept        complement(561396..562016)
FT                   /codon_start=1
FT                   /gene_family="HOG000142364" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931389"
FT                   /locus_tag="AGOS_ABR098C"
FT                   /product="ABR098Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50868.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG058213"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI0001DB27F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC9"
FT                   /transl_table=1
FT                   /translation="MSDAEKAEQPQQKERRKIEIKFIQDKTRRHITFSKRKHGIMKKAY
FT                   ELSVLTGTQVLLLVVSETGLVYTFTTPKFQPIVTQPEGKNLIQACLNAPEEEEEDEDED
FT                   EDEVKDEDKPDVSVGGVAGPNAVQDVPGNPGPVDVGVPADHVAAAHSVAAATAHHHAVA
FT                   AHHHQLSPQQQQNFNNPAAYLNAEQAAVYQQYFNGVNSQQGQY"
FT   CDS_pept        complement(562402..565761)
FT                   /codon_start=1
FT                   /gene_family="HOG000093958" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15763637"
FT                   /locus_tag="AGOS_ABR099C"
FT                   /product="ABR099Cp"
FT                   /biological_process="transport"
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="AAS50869.2"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG192057"
FT                   /db_xref="InterPro:IPR007230"
FT                   /db_xref="UniParc:UPI0001DB27FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC8"
FT                   /transl_table=1
FT                   /translation="MFGASRPAFGNTGAPAFGQQQTGSFGQPQSTTNAFGPSTGTNAHS
FT                   GFGGFGNTQQQPAASPFGMSTQPQPASGPFGQGTSSVSNPPSLFSGNASGVAASGGTGI
FT                   KPFTAYTEKDATTGGTNVFQSITCMPEYKSFSFEELRFQDYQANNKVGQAGGGVGGGVS
FT                   SAFGAPSGTSPFGTNSQGTFGVGTTNAASTGGLFGQNNANTNNSPFGQTSTSNAFGQPA
FT                   NSPFGQSNTTNAFGQNTGMSTNSPFGQGNAAANSPFGMNKTSTTSTGGLFGQQNTTGGF
FT                   GQAGATGTGLFGQSAGTNTSTPFGQSNTFNQAGTTSAGGLFGQNTNRQQSGNLFGSTNQ
FT                   QNGSMFGQNNQTTTGGLFGSNPTNTFGQNTASGNLFNKPATTGGGLFGQNTTQPSGGGL
FT                   FGQNNTTNAFGQSNPSSGGLFGQNNQSMPQGGMLGQGTQQQNGFIGQSNQQQQGGLFGQ
FT                   NMQQSQQQGGLFGQNSANNTFRQNNNTGGLFGNKPAAAGGLFGQNTTGSTFGQSNNSGG
FT                   LFGQTNNQQQGNVFGTNNQQQGGLFGQNNNQQGTGLFGQNSNPQQGNGILGQNNQQQSG
FT                   GLFGQNSNPQNNQQGGLFGSKPANTTGGGLFGNNSSTTGNGLFGANNQQQTQQAGGLFG
FT                   NNNGQSTTGSGGLFGNKSAGASAGGGLFGNNTTQTGSTGGGLFGNNTSTGNTNGTGGGL
FT                   FGSKPADASSVTGGASGGLFAPKPAGAASGGLFASKPAATTTGGLFGSKPAGSATGGLF
FT                   GNNSSTSNNTGIGALQQSGINGAAVGAAQQSNPYGTNELFSRVILPNSLTQPSKPSATK
FT                   LNADNKKRASLTSAYRLAPKPLFTAKSKPATAMPGTLHRKASLSTSQESLREKIPPSTG
FT                   STVFSSETDEIILASCHKLFNPDKKSFKNLVLNRKKMEDAGAGYEESEPKRITFAPADR
FT                   EPSPAEPAPAPAPPKDSLSAEPAPAPAEQPSPAPGLLGDDIGFGDDGYYIAPALDSLAA
FT                   MSLLQLRRVSGLVVGHHLHGRIEFLAPVDLSNIPLPAICGNLVRFTEKVCEVSYVGSEP
FT                   PAPGEQLNVRARISLHNTFPTDKASRLPIKDPKHPILKRHIEKLKKIEHTRFEAYDVKT
FT                   GTYTFIVDTPVA"
FT   CDS_pept        complement(565990..566211)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20625864"
FT                   /locus_tag="ABR099W-A"
FT                   /orf_name="AGOS_ABR099WA"
FT                   /product="ABR099W-Ap"
FT                   /protein_id="AAS50870.1"
FT                   /db_xref="HOGENOM:HBG058215"
FT                   /db_xref="UniParc:UPI000025266A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC7"
FT                   /transl_table=1
FT                   /translation="MSLPVGSPKHGKACCSLELCAPHGADVPRVSPYIPYHDEDEDLIV
FT                   DFSTGSLQATSLKTWQVMEELMGRLERL"
FT   CDS_pept        566817..567539
FT                   /codon_start=1
FT                   /gene_family="HOG000112014" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764694"
FT                   /gene_name="CSM3"
FT                   /locus_tag="ABR100W"
FT                   /product="Chromosome segregation in meiosis protein 3 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="replication fork protection "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50871.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0048478"
FT                   /db_xref="HOGENOM:HBG058216"
FT                   /db_xref="InterPro:IPR012923"
FT                   /db_xref="UniParc:UPI000025266B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DC6"
FT                   /transl_table=1
FT                   /translation="MSSVGPLEDEAAGTELGGSPADPATLTEIDPSAIQVRKTRTVVKL
FT                   DCERLVSKKGLPYLLKNAPKHARISKRRDTYGNLCHVLQFYQLWAHELYPKAKFKDFVA
FT                   LCDRLGKTDRQLRAYRMQLIREELGLAAEGLDPPPQPLREHTGAGGSQPAGSVAQDTNT
FT                   NADLSDDDLLYTTSRAAAASSTANPVPRSETPAALAGVDEAELLAQLAEMQRAAEEDVH
FT                   ESEDDEQLALMREMDEFM"
FT   CDS_pept        complement(567608..570091)
FT                   /codon_start=1
FT                   /gene_family="HOG000029368" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931644"
FT                   /gene_name="ERB1"
FT                   /locus_tag="ABR101C"
FT                   /orf_name="AGOS_ABR101C"
FT                   /product="Ribosome biogenesis protein ERB1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="nucleoplasm"
FT                   /protein_id="AAS50872.2"
FT                   /db_xref="GO:0005654"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG339723"
FT                   /db_xref="HOGENOM:HBG520747"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012953"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB27FB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DC5"
FT                   /transl_table=1
FT                   /translation="MVHSKKDKSVMKHSDIKKRGAAVLEEEDVLQQDEQLLVDGATIDC
FT                   DSDDDEEFQSAEEEVLSSGSESSSKEGSTPGSPVEGSDEEAEDEDADEEEDEDAEFNRL
FT                   LAAEEGDSEGEYGSEDFSDDNDTRPLREKLSSMQLKMIPDGESASVKTRYSDGTPRIIK
FT                   PEITPVYDSDDTDVETANTIGNIPLSAYDEMPHIGYDINGKRIMRPAKGSALDALLDTI
FT                   ELPEGWTGLLDQNTGSSLNLTPEELDLISKIQKNEQVDDSVDPYEPYVDWFTRHEEIMP
FT                   VTAIPEPKRRFVPSKHEAKRIMKIVKAIREGRIIPPNKLRELREQEQANNFSYDLWGDS
FT                   EETNEHIMNLRAPKLPPPTNEESYNPPEEYLLTPEERAEWEKMDPSDRKRNFLPQKYGS
FT                   LRKVPGYGESVRERFERSLDLYLAPRVRKNKLNIDPESLIPELPSPKDLRPFPIRCSTV
FT                   YAGHKGKIRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYKATIVDIKNNQDDHIETV
FT                   EWNPDKTVGLLAVAAGENIYLLVPPIFGFEVENNSRLKIENGYGFDTFGNVKKSALNVN
FT                   SDDEQAETEATVKKQVAQWNKPTQKQAENDVAIVITCRKTVKKISWHRKGDYFVSVQPE
FT                   SGHTSVLIHQLSKHLTQSPFNKSKGIIMDAKFHPFKPQLFVCSQRYIRIYDLSQQVLVK
FT                   KLLPGARWLSTIDIHPRGDNLIASSFDKRVLWHDLDLAATPYKTLRYHEKAVRSVGFHK
FT                   KLPLFCSAADDGTIHVFHGTVYDDMMKNPLLVPLKKLTGHKLVNSLGVLDTVWHPREAW
FT                   LFSAGADNTARLWTT"
FT   tRNA            570576..570649
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        571124..573799
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931645"
FT                   /locus_tag="AGOS_ABR102W"
FT                   /product="ABR102Wp"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50873.2"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG058217"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI0001DB27FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC4"
FT                   /transl_table=1
FT                   /translation="MDTLALRAKILPAQEDGVSERESSESCCSSPRLDEDNTATKRRLR
FT                   KLRSCVSSLPTLSLRIGGPEKKLLGPTVIPRSTKKIFTSSWLSMVANAKRQGGSDVPTI
FT                   NVTPGSHGREATAGVKLNQQHVLSRDMGGEIALRKRALLKRNNSDNDYLTMKHNARHIP
FT                   STCTMRDSSLDNSLLSVDAPMQVRRRSRTMDSFDCSMTSKSLFHLNRLRSNSSTSTTVT
FT                   SSPAGTGTGHTISPHVISTPRDSLSSSSVGTFNNVNHSGSVRTKRNGSIVNVLTNFVSV
FT                   KSSTPIPKPLPVLIYLDNMSPPPAADSSLSEDEYIGSLSVYGRYVAAILAEDGNEFKQK
FT                   CLERYISTEFDFFGEPLDVSLRKLLLLLSLPKESQQIERMISCFATAYYNQNKHDSLWG
FT                   GCDDISRMAFSLLMLHTDHFNSNNKNKMTKVEFIKLLHDDQKHIPKEIADYLYDAITVR
FT                   EFPHVLLPPFMTMDDEDSQSAALCSELCCNFSPMAIIKSRYLLFRTELWVQAKGKSNSI
FT                   SFLNNHVSSASSVKHMLTDDIDIYYHIVNDSVSSATLAADMEKHGYTIPPVPSMPGVLQ
FT                   LSHKNLATFTEVKGGYLKASKEMLRNFVDIPLGAADTNLFYADSEYRYMKIIQIGKLED
FT                   MMVKKFPLVGKTTWKMHHFILTTFALFIFDGNYQLDSSVETDEVTNTTNIVIPFPPTSH
FT                   VVKVLDCNGLYATAFPGAHKPSVAHEDEILHVHRNGQEYRFHCASSSERQMWLEAINMV
FT                   AAISNCYIIIPSIPNSVGPIQKWSLHEKWEKLNSSLQEMRSKLDTVVKILECCQTLAPI
FT                   TGRCRSQLLKYVEQNLTRMDWLTYEIARKQAYLEILRSIMKVSQEAPVPDDQTSIEDSF
FT                   LFKESHIKGHECARISSWHK"
FT   CDS_pept        complement(573888..574211)
FT                   /codon_start=1
FT                   /gene_family="HOG000168285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764695"
FT                   /locus_tag="ABR103C"
FT                   /orf_name="AGOS_ABR103C"
FT                   /product="ABR103Cp"
FT                   /protein_id="AAS50874.1"
FT                   /db_xref="HOGENOM:HBG015725"
FT                   /db_xref="HOGENOM:HBG332020"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniParc:UPI000025266E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC3"
FT                   /transl_table=1
FT                   /translation="MSRHQFDLVMCMKLPGTSIGRLCERCDGKCPSCDSNVRPLSKVRI
FT                   CDQCSFGGQGKKCILCGSIGVSDAYYCWECCKLEKDRDGCPRILNVGSNKTDRHFDRKL
FT                   TER"
FT   CDS_pept        574318..575304
FT                   /codon_start=1
FT                   /gene_family="HOG000034109" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083007"
FT                   /gene_name="ASR1"
FT                   /locus_tag="ABR104W"
FT                   /product="Alcohol-sensitive RING finger protein 1 "
FT                   /function="zinc ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50875.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123803"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000025266F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DC2"
FT                   /transl_table=1
FT                   /translation="MLKHISSHIAMGCPQDECSICWESMPSGVGRLMPCGHEYHLACIR
FT                   KWFHLHSGNRSCPVCRTEASVLVDTDHEVKIDLSVGQLLDFYGLLDEIGSQLLAITLQD
FT                   HSTQDDEVNEEGLAEQRAQLTLVQCGICGEMNGDIDTCCNRCHHMYHHSCLGQLLVEVN
FT                   AEREQGWSHCIFCYEQLVPLYISGARRVLSLQDRGVHRGRVRNNRSILTELIYERSGVL
FT                   VHGIEDQHASQHDINDIEHSWHLLEQNRQRKQLEYQDKCKIQAHVRRILDHYYHCAKVT
FT                   KAQYTFINKKVSQTLYALSRGVYPAVDLDYDGIAKTLILDEMEKLSS"
FT   CDS_pept        complement(575349..576281)
FT                   /codon_start=1
FT                   /gene_family="HOG000248425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764696"
FT                   /locus_tag="AGOS_ABR105C"
FT                   /product="ABR105Cp"
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50876.2"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG058218"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI0001DB27FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC1"
FT                   /transl_table=1
FT                   /translation="MSTQSGINASKHLLDELNNRGDDGLVILGQIDDRSTEIEYRKEFR
FT                   SVGQLQEYLELKPTKPCYLFIRDSDIWQFVSYTPDTAPVREKMLYASSKNTLLRQVGTN
FT                   KIGRSVMVTEVHELAERPWAADESPKAYTEDELIKTEVDRKLNSEKNISGGRKLVSMST
FT                   GVAFKINEDELLSDLISNGTALIFEIDLTDEQIKLRTKKTPGSAKALVAAMDRDRPSYT
FT                   LYQDEGRLFFIYTCPSGSKVKERMVYAANKQGFANYVNDSGFKISETFEVGDPEELELS
FT                   ALEPQSSQPAQEDSKPKFNRPKGPQRRSK"
FT   CDS_pept        join(complement(577609..577624),complement(576680..577542))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626146"
FT                   /locus_tag="AGOS_ABR106C"
FT                   /product="ABR106Cp"
FT                   /protein_id="AAS50877.2"
FT                   /db_xref="HOGENOM:HBG058219"
FT                   /db_xref="UniParc:UPI0001DB27FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DC0"
FT                   /transl_table=1
FT                   /translation="MPSTSQTVGSGMTAMRGSKRRTQQFQITNHIITTDVISPLVADNG
FT                   GDEVAPGEGATEASQQPAFRAEAASAAGSEHEDSDLDELFSPLHEPFSSFSEGDEDEFE
FT                   FLNMSYPKRFTRQINWDASDECGASAAAGGEETYMDRASSWGPMFDSDDIIVSDSKDFW
FT                   KNIETSSSVDEQLPFTDTWSWNDAPALGSSTSDALGPSIPVAAADSLEDFINSNISSDA
FT                   HLPPAGDSFQYKIRKLTFRDSDGTLSLSASSSGSRNRISKKRIKRKAIRRKSAVSEMFF
FT                   PGVGIGEFMLL"
FT   ncRNA           578391..578470
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR41"
FT                   /product="AgSNR41"
FT   ncRNA           578629..578665
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR70"
FT                   /product="AgSNR70"
FT   ncRNA           578741..578835
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR51"
FT                   /product="AgSNR51"
FT   CDS_pept        579169..581688
FT                   /codon_start=1
FT                   /gene_family="HOG000111187" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778668"
FT                   /locus_tag="AGOS_ABR107W"
FT                   /product="ABR107Wp"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50878.2"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058220"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI0001DB27FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB9"
FT                   /transl_table=1
FT                   /translation="MSLWSFVISYLLGGLTFFPLCALAAFYIASKPKGSGGRRTTEPAV
FT                   LAACDPDFKVGELEEQKGVDAFKKGWVYVTNKYYYHTSELQRVPSPERDALPTRDKMKR
FT                   KKKFYAVLKHGNLFLYKSDAPNTDVFQVIVLKNSFVTLWPRDSSAELSDASLFTNRTCI
FT                   SICKNGKAYLDEDGKLQFETGGDIGPADQYFVYVDNNVDKEDWYFALINASKISSSGTL
FT                   LDPARSAKTAHLKTKDSLYLIQTVNSTEGQFATKWLNTLISRLFLSLQQTEMLNDWLLE
FT                   KVHKKLTKINKPGFLDDFKIEHIDVGNAAPMITNPKLLEFAPEGQTKIRFNLVYRGNLS
FT                   LIISTKVNINLGSRFKSREVAIELAMTVRELEGPMILLVKPPPSNRMWYAFESEPLLNL
FT                   DIEPVVSTRQLSSNMIINVLKSKFKEALRESIVLPYMDDMVFYPTQNEIYRGGIWMHER
FT                   QEPSEAPQQLSSSGESSDNVPTNIPSGKLDASAPSASISEKLHSPSLSPDQKSSFSSKP
FT                   SDDELNSSSLRKAAEAHHSSDSDSASERESLGDGSLKTKTMHRVGNLKNMIKARTTADA
FT                   SIRSVESTSSLDSTTSKKYFQTGMKKIGRWYKDQVNNARDAVTDAQLDILQKAEHGPFV
FT                   PEPPKPVGPEMISNRRSHPRLKSQSDIRDDFMKSSAESSADMFVNRARATSFDAPKSPN
FT                   LNATYPFGSQSPMTPVSPTSAMSRRLSANSQQEQAHSSDSIPVDSPPTTIKETISEVPE
FT                   FKEFTKENKGEPPAVPDMATAAAATVFSTTPSSILVNGQNVSPKAFARLRPLPVVPNEE
FT                   IVSQLEDCEPAKDPAPFIPPDLPPRSH"
FT   CDS_pept        complement(581795..588769)
FT                   /codon_start=1
FT                   /gene_family="HOG000034220" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764697"
FT                   /gene_name="MEC1"
FT                   /locus_tag="ABR108C"
FT                   /product="Serine/threonine-protein kinase MEC1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="meiosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50879.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG058221"
FT                   /db_xref="HOGENOM:HBG204172"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012993"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI0001DB2809"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DB8"
FT                   /transl_table=1
FT                   /translation="MDGQTRYLDELVGALRAERAQGRAGGYAGEFPPREGGGRARRVAR
FT                   TVVAKLADAEVADAAFWRACEALDLVFTGRPMVLAEALDEEAGVLWAVRSCWRVAAVHF
FT                   GRRERGWALRRASSRWVRLCADLYGQRWRARVGAELDRELCAGEAAVRAVLGGGQEAGE
FT                   HMRALRALCVAAEWAVSREFWFVTGGAERVGLRLQRLARLARYIGDAVELPLAEYEEVQ
FT                   VRLLGVSVQAYLEPDRPGLGELRFALEQLQYFVRGKHLRREFAAWSRLLLRLYVRCRSD
FT                   RAALLLVREVLVLDAAELPEAATDAQRSLQLVRYDLERQFAADHALRWDPALRAKLLAA
FT                   GTPPVILEPFTSNRQLEKLRLRVLCDFQVGDSALLVHQFSAAGVPLGADPVALYTHLDE
FT                   GIARAFGRQDTEAQVRYLSLVRKLACLESRKPSPGFDCDLCDHTNLWLPRESIDPSRPE
FT                   AASDSLAFKLLVGYYLREQLESSGEALVIGILITLRSIFTHFQPPKLVENHYGDMVDEH
FT                   GCIQLFRMAFMSLNRHVRILSVLLIPYWNLSRSYNADEQQTALIIKFLQRNPDPHITET
FT                   YLMAWTQLTLSTSGELFDSLLLKLIDIFNSSNFVEHVVMASQLKFIARVLNKTAYQLLS
FT                   PILPILLKQIGKNLGEKKLSLERLLNLLEYSAKTVIENFQRYIVPYALTQYKGDALTEI
FT                   AKIMCQNNEPSMVSEQKKRLLDRNSRQIFAVALVKHGLFSLETIETLFINNDPTFDRSY
FT                   VAGFLPDYKTLAEVLKLFKPVEKVDSPMNDNERAVLSSLRFLFLTNFSVDKHRGSKFKN
FT                   VTEWTQEKEAVFQKKLKDNILGIFQVFSSDMHDIEGKTTYFEKLRVISGISFLIKYASK
FT                   ECIISALAQVSICLQTGLEIPEMRYNTLRCWLHLVKYLSEEELSTVIDVLICFILQKWD
FT                   EFSGKIQQAAIDILDALILEKQTLLTNSRPYIVLAFLNKSELHIFENHGFFARTASKLL
FT                   KNTNWVSVFVSNLKSHNIYVIKQTLQDIRLFLEKKQDAGIDIKLISKDGKNISELLGAL
FT                   LDTSHKYRNSDLIICETCALCISMIGVLDVTKHELQRCNVYDNDICDFNNPTQTTKFLI
FT                   NIINERLVPSFWQSENPTKQLFVALVIQESLKYCGLSASSWDVTKPDLYPNESKLWNRF
FT                   NDISKTTLYPLLSSLYLAQSWKEYVPLSYPSFKVKDGYSTWIKNLSLDLLKTATESSHP
FT                   LHVFSSLIREDDGTLSDYLLPYIIMDIIIKAESGTKYFDYLQNVIKDFEYIFNYTLYDL
FT                   NHYQIDGLKMCYDSIFRVFEYCKKWVNQFRQNYSKQHGTFTIREEKYTRMLNRAGKFAD
FT                   IIPSHVLAQKSLETNSFERSALYLEQSYREKSSNGLQDDKLLPYLQTTYAEINDIDAVV
FT                   GVLKVFCSNNLTSRIEELQYSDNWKMAQDCFDALGDSLLNEQGGVENSVPTSRMLKLMY
FT                   DHQLYDQTLKKLELNIPSKKRQLPLNLDEFYNMGIETASLSGNITELKIWIRRIEQLET
FT                   LTDPSILLHYNLAKSLLAVLEGKTDMIETHSKYCYRLIGSHFTTPSHSTTLLKRRNLFI
FT                   KLHGIRDNSILSKCSTDIQFNRSVRNLAVRFKNVGSDFEPNFYLLSMRKSHNLMRSEEF
FT                   VKQDLADTYFKMAQLARENDRLDIASDCLMHALKLEHTEAELEYAEILWKQGEKELALK
FT                   TVAEIHQKRKGIKTLKDRDRAKVLLKYTEWLDLSNNATSVQISHQYKEVIGLDKDWDEP
FT                   YYSFGLYYSRLLEKKRADGFVTTGSLEYKAITYFLSAFEKNTVKVREALPKVITFWLDT
FT                   ASRSVESGSSEGEYHFKRYTKEICKCIDVAIQNCPTHIWYTVLTQLLSRLLHKHTDSAT
FT                   LIMNILLKLTLEYPSIMLWYITVLLNSQENKRVHAGKQIMDAIKKRMPDKSSLISSAIS
FT                   LVQAMTRVCIKDVKNMSSRSGKSLQNDFKFDINLAPSEMVVPVNINLANLSPSYADTSG
FT                   KHGSSKRVTINCFTPHYKVYSSLKKPKKINIIGSDGELYGIMCKKEDVRQDNQYMQFAN
FT                   MMVFLLGKDSESRRRSLNITTYAILSLREDCGLIEIVPNVDTIRSILMAKYDSMKIKYT
FT                   LSVLYEKWKSVSEEQRLGFYKSCTDTFPPVLYQWFLETFPNPIRWYNARNAFVRSYAVM
FT                   AMVGHILGLGDRHLENILLDLQTGKVLHVDFDCLFEKGKTLPVPEIVPFRLTQNIQDAF
FT                   GVTGTEGTFKKSSEVTVRVMRNNELALVNIIETIMYDRNMDHSIQNALRVLRNKVRGID
FT                   PRDDLPLSVPGQVDTVVQQASSDENLAQMYIGWLPFW"
FT   CDS_pept        complement(588848..589207)
FT                   /codon_start=1
FT                   /gene_family="HOG000157009" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083008"
FT                   /locus_tag="ABR109C"
FT                   /orf_name="AGOS_ABR109C"
FT                   /product="ABR109Cp"
FT                   /function="cyclin-dependent protein kinase regulator
FT                   activity"
FT                   /biological_process="cell cycle"
FT                   /protein_id="AAS50880.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0016538"
FT                   /db_xref="HOGENOM:HBG344965"
FT                   /db_xref="HOGENOM:HBG611605"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="UniParc:UPI0000252674"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB7"
FT                   /transl_table=1
FT                   /translation="MFSNHPFQGRKLSDQERARVLEFQESIHYSPRYSDDTHEYRHVML
FT                   PKAMLKVIPSDYFNSETGTLRILTEDEWRGLGVTQSLGWEHYECHAPEPHILLFKRPLN
FT                   FEAELRAAQQQQYGR"
FT   CDS_pept        589350..591713
FT                   /codon_start=1
FT                   /gene_family="HOG000111188" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764698"
FT                   /locus_tag="AGOS_ABR110W"
FT                   /product="ABR110Wp"
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50881.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG058222"
FT                   /db_xref="InterPro:IPR007857"
FT                   /db_xref="UniParc:UPI0001DB280A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB6"
FT                   /transl_table=1
FT                   /translation="MKSNVFVGIKGHGVLEGAAYREKYDYVLEGVTNGRYRDAVRAAAA
FT                   AGVAVSPPELAEVGGGPGGGAGRLGLAAPWLELESAEPAIGEVSLRVLEHEYEYARAEG
FT                   VKQLIVAPPRELGRLNLYAQRLGRLLARAGRGPPLVSVSLPLFEAGDPLSTWELWNTVR
FT                   RLCRYHPNLTATLAVPRGRTPGHVLRRWLAEPVSCLLVSSSIFATNQYNYPVLHKHNQE
FT                   LIGLFQRLNGRAESVLGELTIVLHGIEKHAERVRGGEPIYLEYINYLLKKGDRALLQAP
FT                   GEDGAPRVMQPLQPHAVDLSSEVYQIFEQDKTKYDLYAKAITAALRSIRSTMNKMWLHD
FT                   DLNIIVVGAGRGGLVDRAYTCLRQLGISRFKLVALEKNPQAVIHLQKKNIEKWGNSVDI
FT                   VSANMREWSSKVKFDLCISELLGSFGCNELAPECLEAFEKTNCTDRTIFIPQSYTSYVA
FT                   PVSAPLLYQMLRNKEDNALESPWVVRNVPSCLLSTKVYELWSFKHPGGTSNTARSTVTN
FT                   MKIKHKGEVHGLLGFFTAEIYGDIRLSILPDDCKIKLRGSAPDSDGRRKSVDLDSKLGH
FT                   TPNMSSWSPIFFPLLYPMFVGDDTELELTMLRNRCMRGVWYEWSLSSYVYNAISQDRKP
FT                   GSFLKGTQQLLNSKPEPNFKDTFTRSKKHDGLNSVMLDLQNTATILNAGDLGEPREAQY
FT                   DGNIEENSASTELLKRTFVGKSEFISPELTGWQSVHDVHELGQTMTEKPNKGDYNNSEY
FT                   EDKDYSNYEEYHVRVRTNTTELHNIGGHAYMIKL"
FT   CDS_pept        complement(591905..594274)
FT                   /codon_start=1
FT                   /gene_family="HOG000000998" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764699"
FT                   /locus_tag="AGOS_ABR111C"
FT                   /product="ABR111Cp"
FT                   /protein_id="AAS50882.2"
FT                   /db_xref="HOGENOM:HBG058223"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001DB280B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB5"
FT                   /transl_table=1
FT                   /translation="MNFQEPWSAATNADGFSLNSDSRTQKVKESLKLLKDTSDPWSALA
FT                   LLISEEESQVGRFKQLLQQVAGQVNDISRTSVPLLVYAIVFNHPEYIELLHETRDLDVN
FT                   IADGLTSYSPLMWCFHLQQQECCVELLNYQDELQFDYRNSSSATALDLLVPGTEMYEFA
FT                   EHHGLLELKHSPKVEDIFGSSGDLYKAPVRLDELDRTMNDKIRLQTVGLAVADEAGISA
FT                   SLYQPPDTGRPTTQEAATILFDYERLLPGQFIEFADFDIIQILDTLVDLPQRRPHDTVC
FT                   PAALIFQCLRYARRKSQRSELVESTFHLSITRILSSQQANLGGVVTGNNGDIVSLSYWL
FT                   SCLAFLYYFLYRDETFFRTHPLLLQELINAMQSLMMELCSSVHSRVEKLLVPAILSHTT
FT                   IIDVKQTLYKKDWNFFKKKRQSHKKGPDSYDEILRMLYPPSIEEQMKPAPIKIVQIFGA
FT                   LAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNLSTIEDW
FT                   VKNHDMTVPKSKMVDTFIWERFPYTLLKPISEINLKQRTLRNITMYAPVKKEEELVMDP
FT                   TNTLFYYQSFSRIAQIHLEPVHQLLQWLQVASSIDDEASLSNAMNLLNALNPAQLLKVV
FT                   EKYRYEVDEKRFDSNLKKQLANMAKNESCSVLFPEKTQPLVILPMMSELTELYVTVPDA
FT                   YRFVPLLPDDVREDIEILHERNVRDRSLEVQQTKQEPSITDDENEEDDTSSNDHRKSTT
FT                   YEPSENGNIFGTINAPGNAIQRGDWQESSTIEENPW"
FT   CDS_pept        complement(594492..600920)
FT                   /codon_start=1
FT                   /gene_family="HOG000057131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778669"
FT                   /locus_tag="AGOS_ABR112C"
FT                   /product="ABR112Cp"
FT                   /protein_id="AAS50883.2"
FT                   /db_xref="HOGENOM:HBG058224"
FT                   /db_xref="InterPro:IPR007196"
FT                   /db_xref="UniParc:UPI0001DB280C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB4"
FT                   /transl_table=1
FT                   /translation="MLNLQIEQQTEEDIRASQSIIAHINVCIALLDESNKKEVEAQVNS
FT                   ILEKSPLSVYISYWKKLVQQSSQYIKEHQKLDLRKPTHYLLYNLFRDIVHKNSETVEVL
FT                   NSAIFEDVAFLDQQHLTKKEILAVLDPTEDKEVIRRLEPEEYINKLKRVKQLQMNTFQA
FT                   LQDFVLKENPHTLEEILANLLLSLEGESLNDFIALILSEILSPGSQGLQSSSNSWFTPI
FT                   AVAEATQRGAQISNALSKLNPSAVNWNRVFNLMSTKYFLNRVIAPTLASLSATFSALGN
FT                   GLLIDQFFNCDWNLVFKLNLAILLHQWNPQQGCIDLLQTKDLRKVSKVLPNSKNSLLYL
FT                   TSVSKLDIELFLSREEFGSSPMFQLFHDCFFDDYNIVPEYLALTLISETKHFSLMVENK
FT                   AIINELLVTLMVQVFEKSPMVFGELIKKIPNHKVIEVGRIIINKDTTPLANFVQILYEE
FT                   KKLEDFIRSIPFKESLKITPSARKVGWTGFEEYIKSKLSPESVNTIIDFIDLQASMDDQ
FT                   NTPFRSSRVYDLSALHFVVTLLDAYTLPKETRRRLNDVEYKLLNTFPRLINFGHGHDEA
FT                   ILANGDLVPIATDVEKEMQTYLQKMYNKEMQIKDVVDILRKLRDSDNSRDQDIFSCITH
FT                   AVIAETKFFKEYPLEALATTSVLFGSMILFDLLRGFVLDVAFKIIADFAMEGPESKMFK
FT                   FSVQALYAFRIRLHEFPEFCRSLVDEIPSLQSQPQIFQILAESAAQTSGKASGSAGAFP
FT                   QIPDMITLNYFNVNELPVNVPQENPAREITEKVLFVVNNITMDNFSGKIADLTNLLEEK
FT                   YYAWFSNYLVNQRAKTEPNYHELYANMLEAVDSKLLHKYMLNSTYKQLYLLLSTKDISS
FT                   NDKNHLKNLGAWLGNITLGVDKPIRHRNIAFRELLLDSYKKGRLEIVVPFVTKVLQQAA
FT                   NSRVFRPPSPWTVGILRVLLELNEKANWKLNLTFEVEVLFKALGLKLTDLKPSKFVDIP
FT                   EVTEYLAGNLRTLTIEQQQIEQQQQLISMQTYQQQLALLHRQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQSQQPQPQQTQQQMQQTQQQPQTQSTAHQQAQAQQSQQQQQMHAMSN
FT                   NVNLHGEQPPMDGDGIFNNLVGQSAFVTHPDLKLLFMMAMSKAIREILVPTVEKSTSIA
FT                   VITTISIMLKDFATEVDEIKLKTAAIGMVRKLAQSLAHSTSIELLKENIRTHTQALTPN
FT                   LISINMNHSPLEELNMAIDDNINSALAPIEKAAMDKVTQDIGDQLMQAIAIRRYHKERR
FT                   SDQPFLAPNASNYALSLPEPLGLKTTGITPQQFRIYEEFAKLSVVPEQVMHMAPNHAVS
FT                   SQQVANNQLLQQQKILQQQMQQSQTQIQTDATHQQPLQQPLAAQPQIHPPLNRIQTELE
FT                   QNQKVLVQFMDRLVLHIKENADKKLSDLGSDNAIKETIYQILTFIARSAQKDQLALKVS
FT                   QAVVNSLFGTSESVLCREVLSLLLEKLCSLSIVARKDVIWWLVYALDTRKFNVPVIRAL
FT                   LEVNLIDIAELDAVLVTAMKNSMDGAIRFAMDLIRDTTLSNNPILMRLDFVCTLEYLRL
FT                   FDLEETRAFFKEFEECKIMPVAKNTKATNKERIWLVFTEWVKLLQRVSSNDVVTTVFMR
FT                   QLMDRGVLDSSDKTIEFVKASLELAVSSFKESDPTGEVFTAVDALSNLIARLLYLQDFS
FT                   QTSRTDYLNLIFSTVTLVFAKDHEVNDSTFNERPYFRFFSSLLCEWESLRGHNFIKIKD
FT                   EQCRNELLSFDTDFFNTFASFLHCYQSIAFPGFAFAWITLISHRMFLPNVLRLPNNAGW
FT                   HSCVLLLSDLLKFLSQYIKKEETSDAVSVVYKGTLRIFLAIANDVPEFLVQNHYELINN
FT                   VPRSCIQLKNIILSSFPKKMLLPDPYRTDLELDRLELCEQPPKVFYDPVQDLKNLKKPV
FT                   DNYLRIPSASLIRTISAGVLRSEYEYEAGIGYDINTVDVKLINAIVLHVGIEAALEKQK
FT                   TSFNAVFSTNATYYTLLSSLINEGSIEVKFHVIQAMVNQLRYPNAHTHWFNFVLRNMFV
FT                   SDQWGDQTLDVQEIIIRSLLERIITSKPHCWGVVFTFVSLLRMDNIKLQELPFINDTPE
FT                   MKLIFQNLSKYLVNSTNSNDKQSHETPLEQQS"
FT   CDS_pept        complement(601289..602920)
FT                   /codon_start=1
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764700"
FT                   /locus_tag="AGOS_ABR113C"
FT                   /product="ABR113Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS50884.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176937"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001DB280D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB3"
FT                   /transl_table=1
FT                   /translation="MANPVTADEASEKRIQDSIVHEKQDFELKAELQSKSSVDISTKDE
FT                   KSLVVNSRNADITLSFLLKHDKDVPPITEAEEKKLARKVMWYIVGLTASINFITYIDKA
FT                   QLSYSTLLGFFEDVNMSLNRYNNVNTLFYVGYITGQINLLFIQKFPLKNVVIVLLTIWC
FT                   IIMMVQCAMTDYKGVYVLRLCLGFTEAIIIPALNNTMLMFLTENEKAATAPIFVIATVS
FT                   VSIPMGVLSYLILLIKNPAISHWKILSIIIGSLTFVVALVALYLYPNNPTDAKFLSLKE
FT                   KVWVIRRVQDTTGSSIEQKKIKKHQIIEGLRDPISWLFLLFFATQQLANNLSYQRNLLL
FT                   KSAGHIDDMHASLISSSSGGLAVIGSLVASFIMFKKKNFTAYTVVLWSIPSFIGCVAMM
FT                   ALPDNAHIAMVVMICIASSTDGIPWIMMISWSTTSTSGYSKRLTRIGMVMVGYSISNLI
FT                   SPQLWQEAHGPRYYPAWAVQLSLSFFFAPALAILIRIILARRNKERLALASDNLGAVEI
FT                   DGDLVKTNLAMLDLTDLENKHFIYPL"
FT   CDS_pept        complement(603272..607111)
FT                   /codon_start=1
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931646"
FT                   /locus_tag="ABR114C"
FT                   /orf_name="AGOS_ABR114C"
FT                   /product="ABR114Cp"
FT                   /function="hydrolase activity"
FT                   /protein_id="AAS50885.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG285674"
FT                   /db_xref="HOGENOM:HBG305043"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI0000252679"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DB0"
FT                   /transl_table=1
FT                   /translation="MSFGIRIAIDRGGTFTDCIGTSGTGRPEDDVVIKLLSVDPANYPD
FT                   APLEGIRRLLEHFQNKQIPRGLPLCIAGIESIRMGTTLATNCLLERTGERCAFVTTKGF
FT                   KDALLIGDQTRPRIFDLSIKRPDMLYDVAVEIDERVTLVDYSEDPTRHKSTADSSAGKY
FT                   AGRSGEIVHVLKVPNEDEVRSTLRVLYAMGIRQVAIALLHSYTYPAHEEIVGRIAEEEG
FT                   FTHISLSSQVSPMIKFVPRATSAVVDAYLTPVIKDYLKGIYAGLRESDNTSIQFMQSDG
FT                   GLVDARRFSGLKAILSGPAGGVVGYSQTCSCSDNAPLIGFDMGGTSTDVSRFEGRLEHI
FT                   FETEIAGVTLRSPQLDINTIAAGGSSRLFWENGLFRVGPESAGADPGPVAYRKGGPLTI
FT                   TDANLVLGRLIPEFFPSIFGPNEDQSLDIEATKGKFSELANIINTELGSNMTVEEVAYG
FT                   FICVANESMARPIRKMTEGKGHLLSHHRLVSFGGAGGQHAVAVAHSLGIETVLMHRYSA
FT                   ILSAYGMLLADAVEEEQVPCSIFLQDTSSKDQLNEIFHQLITSTSISLLKQGLADDRLE
FT                   FERYLNLRYEGTETSLMVLQEGDSWDFVERFTKLHKREFGFVFAEKRILVDDVRVRALG
FT                   KSMVRNQEPVDQQLSQVTRSTADPSKDAKFFKDVYFVDGFIKTPIYRLDSLPVGTCIEG
FT                   PAILADDHQTNIIPPGAEAIILKTHVYIQISCNQQKITNDEVDKINPVMLSIFGHRFMD
FT                   IAEQMGSQLRKTSVSTNVKERLDFSCAIFDHEGNLVANAPHVPVHLGSMSTCIKAQATL
FT                   CKGKLKKGDVLISNHPDIGGTHLPDITIISPVFSDEKDDPLFYVASRAHHADIGGTLPG
FT                   SIPPNSKELYEEGAMIYSEKVVKAGQFNEALLKKLLFEDPAKYPGCSGSRRLSDNISDI
FT                   KAQIAANTRGIQLLNQLVDVFGLGTVTRYMDAIQENAALTVKNVLRKITKHFGKTVYSA
FT                   EDYMDDGSVIKLRVELNAKEDKYIFDFTGTSPQVHGNLNAPVAITNSAILYCLRCFVDE
FT                   EIPLNQGCLKPITVIIPESSILWPTKGVAVVGGNVMTSQRVTDVILKTFKVMADSQGDC
FT                   NNFTFGTGGNDASTGEYTQGFGYYETICGGHGAGGDSWRGPGWHGTHPVHTNMTNTRMT
FT                   DTEIFERRYPVILREFSIRKGSGGNGLYRGGDGVTRDIEFSVPVQASILSERRSLPPNG
FT                   LEGGFPGKRGLNLWVRHETGATMNIGGRNTVQVQPGDRMIINTPGGGGFGIPPN"
FT   CDS_pept        complement(607312..607887)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778670"
FT                   /locus_tag="AGOS_ABR115C"
FT                   /product="ABR115Cp"
FT                   /protein_id="AAS50886.2"
FT                   /db_xref="HOGENOM:HBG058225"
FT                   /db_xref="UniParc:UPI0001DB280E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA9"
FT                   /transl_table=1
FT                   /translation="MSNQNRNDIWNKLKSSTKSFSSSLTQLSTRNDRDGDTPTSTLVHK
FT                   ALLKHYKKREPFVGFPEWLGHTEDIGEEHNAPSIGSSADHSVASMDSGPRRTAGLAFQK
FT                   IYSSVSVSRPAGEAGSAGTTMQGRLSKSSDHLVGPRTQGATWGSQRQQLLDQDRSQTSE
FT                   QPAEPQPRSLHMRERMKRNLTKRGTFDL"
FT   CDS_pept        complement(608102..609439)
FT                   /codon_start=1
FT                   /gene_family="HOG000023158" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764701"
FT                   /locus_tag="ABR116C"
FT                   /orf_name="AGOS_ABR116C"
FT                   /product="ABR116Cp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS50887.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG179367"
FT                   /db_xref="HOGENOM:HBG324692"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000025267B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA8"
FT                   /transl_table=1
FT                   /translation="MVKKVLVLGSGFVAKPVVDVLDSTDGIEVTVGCRTLAKAKALTAG
FT                   TAASAISVDASDSEGLDAAVGEHDVVVSLIPYIHHADVVRAAIRQRKHVVTTSYISPAL
FT                   RALEPEIKAAGITVMNEIGLDPGIDHLYAVKIIDEVHRAGGKINSFLSYCGGLPAPEDS
FT                   DNPLGYKFSWSARGLLLALKNQAQFWKDGSKQVVKSEDLMASAEPYFIMPGYAFVCYPN
FT                   RDSTVFRDLYGIPEAKTVIRGTLRYQGFPEFVKVLVDMGLLKEEPHSAFTQAQPWSAAL
FT                   AAYLGAKSASQEHLVAAIDARTSWKSQADRERIIAGLSWLGLLSDELIAPAGNPLDALC
FT                   ASLEQRMQYEEGERDMVCLQHKFDIEWADGSTETRTATLIDYGRPSGYSSMAATVGYPC
FT                   AIATRLVLEGAISGPGLIAPYTPEVIEPIMRELKDKYGIYMKEKTT"
FT   ncRNA           609848..609934
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR49"
FT                   /product="AgSNR49"
FT   CDS_pept        join(complement(611014..611059),complement(610017..610960))
FT                   /codon_start=1
FT                   /gene_family="HOG000057132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764702"
FT                   /locus_tag="AGOS_ABR117C"
FT                   /product="ABR117Cp"
FT                   /protein_id="AAS50888.4"
FT                   /db_xref="HOGENOM:HBG058226"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="UniParc:UPI0001DB280F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA7"
FT                   /transl_table=1
FT                   /translation="MLVPPANFGIAEEGIYRCSKIETLNLSFLEVLALKTIIFVGGQEP
FT                   SKFFREFFERYNVQLFVIKRAQNSSLVLPGSNAQKEQPQADTAVSSGCQSSTHYKLSDA
FT                   DDLMIIKTHSLQKIFRLMLNTTNHNMLLVDKTSIVIGLLRRIQKWNISSIISEYRLYTG
FT                   KNSNYFAETFLEVVDVTVTQDLEKSVTEDIAKLDIQDLRPIELSRNGSGQQVVNERDLL
FT                   RGPELPQHMLRIIDQVEQCNSKENSAASTGIKRSPSSRGIFGNRYRLAFNKRELCEYEY
FT                   YRSGSTNAVHIKIPRESLLPQWFKFQRDLWEQLNTKQTYNFYTERIFM"
FT   CDS_pept        complement(611450..613072)
FT                   /codon_start=1
FT                   /gene_family="HOG000057133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764703"
FT                   /locus_tag="AGOS_ABR118C"
FT                   /product="ABR118Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS50889.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="HOGENOM:HBG252789"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniParc:UPI0001DB2810"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA6"
FT                   /transl_table=1
FT                   /translation="MTTATVQDIGYAFLKTYYQRMHTDPSKLFHLYSSTAELTHVNYQG
FT                   GLSPTADILPTVKVIGKENISKFYSRNNKVVQDVRVKIDACDFQSTGAGNNGILILALG
FT                   EICWSNTPTYRFCQTFVLTPVGNNNKMYDVTNDIMRFIPDVIREELLGAAFSQGADKKV
FT                   ASKAAASEEVSMKGAVSKEASEEAAPKELTAKEPLTEATAKELASKDVAGKEAAAKDIA
FT                   VKETAGKDSVNHAKDFAREVVREHQGKDQSHREQAKASRETANREAAKENVGKPTVTAT
FT                   EEDGKKDRRREHRRDEKKEDFKEARKEHGADKKEVFDSGKAHKEEQLPEREPTKSAVAD
FT                   SSSSDISREHSKPKDDIKPDEKKHTTHSEHEVPKKMSWASQLTNSDSKAVPNVVTNYTR
FT                   VPPEHTRTPDRKTPSPNGNGPKAGNKKLKHVSVPNKDGYYPIYIRNTGGVTNKDLTDAL
FT                   EREFGVVKKISASESFAVVDFEDPQCQQDAIRMHTLKINNQTVFMEPKTEKKRGPIASL
FT                   SSTSPTLANGNRSNKKHSNRRKD"
FT   CDS_pept        complement(613571..614851)
FT                   /codon_start=1
FT                   /gene_family="HOG000057134" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778671"
FT                   /locus_tag="AGOS_ABR119C"
FT                   /product="ABR119Cp"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50890.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG379569"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI0001DB2811"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA5"
FT                   /transl_table=1
FT                   /translation="MQAISGQLTEFADNEQFYMRQQVQQTHPGQQQPGGLPQMFSPQVN
FT                   HARLLGQQQQLMHGMEGGQDLQATYLLKQKMEAANAAFGHQQQGLQPQQAQQQLLASGV
FT                   LNAPPGVSLVQQGVGGMAPPPGALPPQLPLATGVHGSGLGLAPVPLIHHPNHLLVREVW
FT                   ANNLTAEFASIRRLVDQYNVIALTTEFVGTIVRPIGNFRSKNDYHYQTMRTNIDLLNPV
FT                   QIGLSLSDAQGNKPDNVPSTWQFNFLFDMSKEMVSPESLDLLKKSGVAFDKHQSIGVNA
FT                   YDFAQLLVDSGLLLTDEVTWVSFHAAYDFGFLVNILTDASMPNNKEDYEFWVQKFLPSF
FT                   YDLNVLSKAVHDLKGQRSIPQPQHSLESLADELGIPRFPLFNTTGGQSLLALLAFVRLA
FT                   KFPVFKLSNGSLDFAQFKNSIYGINKE"
FT   CDS_pept        join(complement(616116..616922),complement(615060..615761))
FT                   /codon_start=1
FT                   /gene_family="HOG000189714" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764704"
FT                   /gene_name="NOG2"
FT                   /locus_tag="ABR120C"
FT                   /product="Nucleolar GTP-binding protein 2 "
FT                   /function="GTP binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50891.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG058228"
FT                   /db_xref="HOGENOM:HBG716564"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012971"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI000025267F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DA4"
FT                   /transl_table=1
FT                   /translation="MGTAKKEQQRRIREGNTKDGNLRVKGENFYRDGKRVKFLNMYKGG
FT                   KSIRNAKGDLIRAAPLQSTDVPTARVQPDRRWFGNTRVISQDALQHFRDALGDKKNDSY
FT                   QVLLRRNKLPMSLLEEKDTSESPTAKIIDTEPYGATFGPKAQRKKPRVAAASLEDLAKA
FT                   TDSDSQKYEEKKELDSTLGLMAATEQEDGWSQVAKEAIFHKGQSKRIWNELYKVIDSSD
FT                   VVIHVLDARDPLGTRCKSVEEYMKKETPHKHLIYVLNKCDLVPTWLAAAWVKHLSKDRP
FT                   TLAFHASITNSFGKGSLIQLLRQFSQLHKDRQQISVGFIGYPNTGKSSIINTLRKKKVC
FT                   QVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSAKDTEEDILFRGVVRVEHVSHPEQYI
FT                   PAVLRRCKRHHLERTYEISGWADATEFIEMLARKQGRLLKGGEPDETGVAKQVLNDFNR
FT                   GKIPWFVSPPDRDPQPETSKRPADSEPETAQEAPEPPANKRLRV"
FT   ncRNA           complement(615815..616021)
FT                   /ncRNA_class="snRNA"
FT                   /locus_tag="AGOS_AgSNR191"
FT                   /product="AgSNR191"
FT   CDS_pept        complement(617142..618086)
FT                   /codon_start=1
FT                   /gene_family="HOG000242500" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764705"
FT                   /gene_name="ESF2"
FT                   /locus_tag="ABR121C"
FT                   /product="Pre-rRNA-processing protein ESF2 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50892.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG175804"
FT                   /db_xref="HOGENOM:HBG716559"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000252680"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75DA3"
FT                   /transl_table=1
FT                   /translation="MSDNDSDVQDFSSEEEDHGLLIDRKKQQTLDFAQDGSDSEGGSDL
FT                   DDDDIAEEESPIQNETKAATGEEPATADGDNIAPQSADELRPEERADQLKQERLRRLKK
FT                   LKASKKSNHKTGVVYLSKIPPYMKPAKMRQILSRFGDLDRLFLKREDEHSHRQRVKGGG
FT                   NKKVMFREGWAEFIRKKDAKLCAETLNGNIIGGKKGNFYHDDVMNVKYLSGFKWADLTE
FT                   QIARENDVRQSKLQLEISQANKLNAEFIRNVEKSKMLNNIRAKKHKDEDSSERTESHLP
FT                   VKQRKVTSNRASAPESQKQPASEKLSNVLHNLF"
FT   CDS_pept        complement(618456..619349)
FT                   /codon_start=1
FT                   /gene_family="HOG000227586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764706"
FT                   /locus_tag="AGOS_ABR122C"
FT                   /product="ABR122Cp"
FT                   /function="catalytic activity"
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="AAS50893.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="HOGENOM:HBG001989"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0001DB2812"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA2"
FT                   /transl_table=1
FT                   /translation="MGREQYKVKAGLAQMLKGGVIMDVVTPEQAIIAEKAGACAVMALE
FT                   RIPADMRKSGQVCRMSDPKMIREIMESVSIPVMAKVRIGHKVEAQILEALQVDYIDESE
FT                   VLTPADWANHIEKHDFKVPFVCGAKNLGEALRRIEEGAAFIRSKGEAGTGDVSEAVKHI
FT                   NLIYQEIQWCKENLKTDEQFEAHAKELRVPVELLKETVAAGKLPVVTFAAGGVATPADA
FT                   ALLMQLGCEGIFVGSGIFKSSNPEKLARAIVQATTHYMSPEKLLEVSSDLGEMMPGMTV
FT                   DSINKSNGVRLSEIGK"
FT   CDS_pept        619570..620397
FT                   /codon_start=1
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764707"
FT                   /locus_tag="ABR123W"
FT                   /orf_name="AGOS_ABR123W"
FT                   /product="ABR123Wp"
FT                   /function="transferase activity"
FT                   /biological_process="glutamine catabolic process "
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="AAS50894.1"
FT                   /db_xref="GO:0006543"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="HOGENOM:HBG001434"
FT                   /db_xref="HOGENOM:HBG292341"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="UniParc:UPI0000252682"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA1"
FT                   /transl_table=1
FT                   /translation="MNVVANDYAESILLVVERQNSSYLRKRRGRKNAAGVSLSLYLRIY
FT                   RASAGITTLSQLRNSVRSQFDIMSKVVGVLALQGSFAEHIDCLEACVRENGHNVEVIAV
FT                   KTQQELARCDSLIIPGGESTAISQIAERTGLHEHLYQFVRTPGKSAWGTCAGLIFLSNQ
FT                   VANQAALLKPLGILDVTVERNAFGRQLQSFEKDCDFSSFWDHDGPFPTVFIRAPVISKI
FT                   NSKNVEVLYTLQRDDGSEQIVAVRQGSILGTSFHPELGSDTRFHDWFLRTFVL"
FT   tRNA            complement(620512..620585)
FT                   /gene_name="tRNA-Asn"
FT   CDS_pept        complement(621909..623696)
FT                   /codon_start=1
FT                   /gene_family="HOG000202588" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764708"
FT                   /locus_tag="ABR124C"
FT                   /orf_name="AGOS_ABR124C"
FT                   /product="ABR124Cp"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50895.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG051000"
FT                   /db_xref="HOGENOM:HBG333533"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI0000252683"
FT                   /db_xref="UniProtKB/TrEMBL:Q75DA0"
FT                   /transl_table=1
FT                   /translation="MVGTNHKRGSHDEGPMRSGEDGSTSVLEQTKPAGFYRQHILLSDA
FT                   QHEGMSLTDTFLYNHDLKPVEQKRRLWSAFNFVCFWTADSINLNNFQVAATGLQLGLTW
FT                   WQCWLSIWIGYFLAGTLVVLTSRIGSHYHISFPVVIRSSFGIFFSLWPVLNRVMLAVIW
FT                   YSVQCFVSVGPVSVALKAIFGKDLEQRIPSHINNPNLTTYQLICFLIFWTFSFPFLLVS
FT                   PHKIRHLFTVKAVIVPIASIAMLFWVLSKSDWQIELGSLTGSTPVRTSVGWAFVRSTMT
FT                   CLANFATLIINLPDFARFAKTRRSALWSQLISIPLLFSVTSLVGLLTNAAGYKIFAVNY
FT                   WSPMEVIERILETHYTAATRAGAFFIAVAFMLAQLGTNICANSLAAGTDMTALLPRFIN
FT                   IRRGSIICAILAWCICPWNLMSSSSRFTETLSAYAIFLSTIGGVMIADYYLVRRGSLKL
FT                   THLYSAKPSSYYMYGTKFGINFRALAAYAVGIAPCMPGFIASVADNVTIPKWLMRVYYL
FT                   NYWVGFGLAFVVYTALSYVNPPKGIPMRKFLTERGWYEKWAEVEDFEEEWLGRAHTPSV
FT                   LLDQVSSDTSLGSLRDKKV"
FT   CDS_pept        complement(624121..628587)
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931647"
FT                   /locus_tag="AGOS_ABR125C"
FT                   /product="ABR125Cp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50896.3"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0000EA236C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D99"
FT                   /transl_table=1
FT                   /translation="MLSHHPSTCPDPQRYMIEATGPQWAKTEGHDSRTSLSGSSAPELV
FT                   AYGSEAGAEERERLSRVMTLQSMGEARAALDPGMAQKVESLARTLSQHTVRDGRLVVDP
FT                   ADFDMKAILSGLVSASQRQDIPMRQTGVLVEGVTVQGVDSSCVEGHDYGDVLALPLTAV
FT                   RAVRQAMRRRYRNILESVTLLARPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAI
FT                   SYDGIPQREMMRRYRAEVVYNSEIDVHFPHLTVKQTLDFALACKTPHMRVNNVSRAEYI
FT                   TLMRELYATVFGLRHTYDTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGL
FT                   DASTALEYAQAMRIMTNLLQSTSLVTLYQASENIYETFDKVLVLFEGRQIYFGDVMSAK
FT                   AYFEEMGYTCPPRQSTTEFLTALTDTNGYHVVKPGHEATVPRLPEEFEQYWLNSKEYRS
FT                   LLSEIEDYRREVDAHETRDQLEKFKLKGKSKYTHKRSPFMISFFEQVKLCTIRGFQRIY
FT                   GDKSFTVINVVSAVVQALITGSLYFSSPSNTSGAFSRGGILYYAILYFSLMGLANINFS
FT                   NRPILQKHKMYTLYHPSAEALASTISACVFRMIALTLFLIVLYFLSGLTVEAWRFFSIY
FT                   LFLVLASEGINAMFEVITALSTSLSQANAVAGLVMFGISIYSTYMIQKPSMHPWFAWIS
FT                   YILPIRYAFESMLNAEFHGRHMDCADTYVPTGPGYEGVTPENRVCAFIGSKPSQSWVLG
FT                   DDYLSVNYEYEYENQWRNLGILIAFWIGFLTLKCLATEYKRPMKGGGDSLVFKKGTLAK
FT                   RKVQDDSESRNVSGAAESKMVASTVGTDDVFDGLKNDDVFIWRDISFSITHNGDKKKLL
FT                   DQITGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGVITGDMLVNGLPIDASFERRTGY
FT                   VQQQDVHVKEMTVRESLQFSARLRRPESVSEAEKMNYVEKIIEILGMSDFADALVGDAG
FT                   YGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSSWAIVQLLKRLAQSGQAILCT
FT                   IHQPSATLFEQFDRLLLLQKGGQTVYFGDIGEESRTLLDYFQRNGARPCTPSENPAEYI
FT                   LESIGAGATATTTEDWAELWRNSPECARENEIVNKLVNELSEKYLSNAPAPISKYATSY
FT                   FYQFRYVVSRTMLIFYRDLDYLLSKQFLFLSAGLFIGFTFYDVGTSYTGLRNTMFAVFM
FT                   SIITSAPAMNQIQARAIKMKDLYIVRESKSNLFHWSLLLITQYLAELPYQFLFSTIYFL
FT                   CMFFPMKLGLSARENGIFFLNFCIVFQAYFVGLGLAVLYLAPNLESANVILGVFLSFLI
FT                   SFCGVVQPYYLMPGFWKFMYRLSPYTYFTQNFLGIMLHDRPVRCNSREFSFLDPPNGVT
FT                   CGEYMQPFVNSVSGYVDNPDATSNCAYCIYRVGDEYLASIGAKYSYLWRNFGILWGYVA
FT                   FNIIAMLSLYWLFRVKKVTIKNPFKRD"
FT   CDS_pept        628857..633392
FT                   /codon_start=1
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083009"
FT                   /locus_tag="AGOS_ABR126W"
FT                   /product="ABR126Wp"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50897.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001DB2821"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D98"
FT                   /transl_table=1
FT                   /translation="MSDEQCQSDHQWPMESSKVPPAGLSLSRVSTGASTSADPAHRPYV
FT                   GLAEDREEQEVIRSLARTLSGSSGAAGRDYQTGTADELAFFGANSDPRLDPESGEFDSQ
FT                   FFVRTLRKLYMSDPDHYKPAELSVVLRNLRVCGEAADTDYQATVGNWPWKTARSLYDMT
FT                   FRRGHTKAEFDILKPLDAVFEAGRLCVVLGRPGAGCSTLLKTVGARTYGFNVAPESEVS
FT                   YSGFTQKEISKNLRGEVIYSAEMDTHFASLPVGYTLEFAARCRCPQVRPGGVSRETYYK
FT                   HYASAVMATYGLSHTRNTKVGNDYIRGVSGGERKRVSLAEVTLAGAKVQCWDNSTRGLD
FT                   SATALEFVRALRDNAHVMHTTQLIAIYQCSQDAYDLFDDVLVLYEGYMIYFGPREFAKD
FT                   YFLRMGWACPPQQTSADYLTSVTSPAERQPRPGYEDKVPRTAKEFYDRWMASPERAAVQ
FT                   ERINMHMADYETGVARQQLKEHHKSRQAKHMRPSSPYLISFYMQFRAVVDRNLKRLGGD
FT                   PWVYLFNILSNTIMGLILASCFFNQKEDTASFFYRGSALFTAVLFNSFSSMLEIMSLFE
FT                   ARAIVEKHKSYAFYRPSADAFASIFTELPSKVITCVSFNIPFYFMVNLRRSAGAFFFYL
FT                   LISMTSTFAMSHLFRTLGAATTSLYVTMLPASILLLAISTYVGFVIPQKNIVGWSKWIF
FT                   YLNPIARSMEAMVANEFDGRTFECSQMMPSGPAYENVPLANKVCVAVGSLPGETTVSGT
FT                   RYMELSYDYLAKHKWRNWAIVLAYAIFFLGLYLLLIEYNKGEMQKGEMAVFLRSTLKKI
FT                   RKQNKAVKGDVESGNAQGKESSTIDSDQSRELIKKIGSDKIFHWRNVCYDVQIKKETRR
FT                   ILTNVDGWVKPGTLTALMGSSGAGKTTLLDVLANRVRVGVVTGDMFVDGLPRGASFQRN
FT                   TGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEAEKDAYVEDIIRLLEMEAYADAIVG
FT                   VTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQAV
FT                   LCTIHQPSAILMQEFDRLLLLASGGRTVYFGGLGKGCATMVEYFEKHGSQKFPEGCNPA
FT                   EFMLEIIGAAPGSHALQDYHEVWKNSEEYRSVQEELLRMETELSKKPRTESPEQNREFA
FT                   ASLWYQYKVVSKRVFQQYWRSPGYLWSKIFMGTFSALFIGFSFFKSKSSMQGMQNQMFA
FT                   TFLFLLIINPLIQQMLPQYEEQRDLYEVRERHSKTFSWKAFILSQLTAELPWAIFVGTL
FT                   AFFSVYYPVGFYNNAVDTSDRSERGFLFWLLAVCYYIFSATFGYFCIALLGSRESAAMF
FT                   ANFVFMIWTVFCGVLVNGDNLPRFWIWAYRISPLTYLVSSIMSTGMAKAKIQCAPEELV
FT                   KFIPPAGQTCEQYLRPFQSYAQGTALLNPTATDLCTMCPMQSSDTFLAGLGIYYKNRWR
FT                   DWGIFMVFIFTNIAGFILFYWFLRVPKATGVTIKKATNEEEDEEKGQQRK"
FT   tRNA            join(633848..633884,633902..633937)
FT                   /gene_name="tRNA-Arg"
FT   tRNA            join(633957..633993,634011..634046)
FT                   /gene_name="tRNA-Arg"
FT   CDS_pept        complement(634437..635489)
FT                   /codon_start=1
FT                   /gene_family="HOG000066006" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764709"
FT                   /locus_tag="AGOS_ABR127C"
FT                   /product="ABR127Cp"
FT                   /protein_id="AAS50898.2"
FT                   /db_xref="HOGENOM:HBG058229"
FT                   /db_xref="UniParc:UPI0001DB2822"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D97"
FT                   /transl_table=1
FT                   /translation="MSRLFHKKERHDDVVEAAAAVGEVVADGNEGEMVTVDLPAERSGC
FT                   KTLTHIGTYPLVQQTKDILEHLPPARILAANTKPIVVSVVHSKPVAIVRPVVNIADSVF
FT                   DKTLSVTEKVVPSLKTKTYQRLGEEIMLPYTLTKTVIVKTTNGTVSIANNFVYEPAHEN
FT                   ILKFRRYYNQRLIDTHGKPLIRGSLDFVVGPANRQYERLITRVLPEGKEVPVNGFSNEV
FT                   DRSVALTFNLVSRLIPAAAKKTSRIIWSPWNYAKHVNDVFNENLDKQEDLYWAHSWDAT
FT                   KNAITELNAETIGHVKQIIPGVRKANRAPAQNPIPVQQEVPKPAEPVEAPSEPPLEQQQ
FT                   PQVVQEAVVA"
FT   CDS_pept        637507..638652
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764710"
FT                   /locus_tag="AGOS_ABR128W"
FT                   /product="ABR128Wp"
FT                   /protein_id="AAS50899.2"
FT                   /db_xref="HOGENOM:HBG058230"
FT                   /db_xref="UniParc:UPI0001DB2823"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D96"
FT                   /transl_table=1
FT                   /translation="MWPMIEPPKDKIYGPPEHLIMCTPKTHVLEPDDMNLPPLRLGPKI
FT                   QLRIPAETCGDSIVESPSKPSKVVRQTLSMPFPEQFGIISPLLSSDDDTLSDSSMISPV
FT                   SETSSVASCSPEISKKLLPRNFLDREDEPGLLPTSVAEEGEEDDGDLSLNLLFRNESAA
FT                   QDAGKVEDKVTDSDLREDVWPLQPTEAEQSPNPLSRKRSFTGLCGEDSWKRVCQPKHCQ
FT                   LQPTKSSLKLQPHRLNFLMDSSNGNVKDATIFATEINSCNAYGVPFPASVLERVTIPVN
FT                   THVKEHYKNERGEYLGGYYDDDEDEKTEGDQKTAVANDSAGDSAIIRAYAFERLVTFKE
FT                   EAPTGLDAQSGKTADLTLDSPYRSSGCGAAKTIRWAPSVTW"
FT   CDS_pept        complement(639090..640361)
FT                   /codon_start=1
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778672"
FT                   /locus_tag="AGOS_ABR129C"
FT                   /product="ABR129Cp"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50900.2"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI0001DB2824"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D95"
FT                   /transl_table=1
FT                   /translation="MLSNKEIRIVSLLVLDTVFFLLEIIIGYTVHSLALIADSFHMLND
FT                   IVSLIVALWAVNVAKTRNPDARYTYGWKRAEILGALINAVFLIALCVSILIEAIQRFFE
FT                   PQEVKNPQLILYVGTAGLLSNILGLFLFHEHGHSHSHGTTGEDMEAHSSSHSHSHHIGS
FT                   HLHEDEPEAIQEFLPAAVVERYMSSSDENTPLVKDHDHKHSAHGADHRSLNMHGVFLHV
FT                   LGDALGNVGVMLTAIFIWKTDYSWRYYSDPFVSLVITCIIFSSALPLSRKASRILLQAT
FT                   PSSISADEIKGKILAIPGVISVHDFHIWNLTETFSIASIHVQVDCGQDSYIGTAKVIRS
FT                   IFHRYGIHSATVQPEFIGSRDVSDDSYRRFSRIAGGGLGSSTSVNEESDSTKDQVPHAY
FT                   GATNSQTGCLVDDAANCNSDNCLP"
FT   CDS_pept        641269..641604
FT                   /codon_start=1
FT                   /gene_family="HOG000248861" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778673"
FT                   /gene_name="COX23"
FT                   /locus_tag="ABR130W"
FT                   /product="Cytochrome c oxidase-assembly factor COX23,
FT                   mitochondrial"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="AAS50901.2"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="HOGENOM:HBG192206"
FT                   /db_xref="HOGENOM:HBG398308"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="UniParc:UPI0001DB2825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D94"
FT                   /transl_table=1
FT                   /translation="MPVDTAAPQSTANPDPSVQTDRAAVNFTPSTDASSFQFYPDNPES
FT                   PLARYRFAAKGPSQYFDPCQESANMSMKCLERNNYDRDLCREYFDAYRECKKQWLSARR
FT                   KDNSQWT"
FT   CDS_pept        641859..643643
FT                   /codon_start=1
FT                   /gene_family="HOG000074722" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778674"
FT                   /locus_tag="ABR131W"
FT                   /orf_name="AGOS_ABR131W"
FT                   /product="ABR131Wp"
FT                   /function="binding"
FT                   /protein_id="AAS50902.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058232"
FT                   /db_xref="HOGENOM:HBG397726"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000025268A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D93"
FT                   /transl_table=1
FT                   /translation="MSSENSFAGFVSRNRTAIIATAAAGASAVGAYYYYQQLQRQSSGE
FT                   VSKDATGSTDVKSKKKKKRNNKKKYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNE
FT                   CFKDQRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSK
FT                   CLLRRATANESLGNYADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGG
FT                   EKHELPSNTSLASFFRIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAF
FT                   TDAVEKFTAAHEANPDNAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPN
FT                   SYIYMGLIMADKGQADEYAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKA
FT                   KECDPSRVYPYIQLACLAYREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFE
FT                   NALKEYDFARKLEDAQEGIHVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRS
FT                   EQAKIGLAQLKLQQEEVDEAIKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVM
FT                   SAKIQETLDAYRAQGMVV"
FT   CDS_pept        complement(643920..644726)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764711"
FT                   /locus_tag="ABR132C"
FT                   /orf_name="AGOS_ABR132C"
FT                   /product="ABR132Cp"
FT                   /protein_id="AAS50903.1"
FT                   /db_xref="HOGENOM:HBG058233"
FT                   /db_xref="UniParc:UPI000025268B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D92"
FT                   /transl_table=1
FT                   /translation="MQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIISEVESD
FT                   DDNSSLNSDHDAFPDWQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFR
FT                   GAFVSAQQHLRRKGCVDEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAA
FT                   PKGALQTNGDALPLRNADDTPQVMAKPPYASQVPLADRISMYGLDGCESGASSDYEEGD
FT                   AADELPFLVDDFDLPYSGLQSPAKKRNVDNNEQDQSNSSKRPRVGY"
FT   CDS_pept        645024..645314
FT                   /codon_start=1
FT                   /gene_family="HOG000248549" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764712"
FT                   /locus_tag="ABR133W"
FT                   /orf_name="AGOS_ABR133W"
FT                   /product="ABR133Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50904.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058234"
FT                   /db_xref="HOGENOM:HBG395495"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniParc:UPI000025268C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D91"
FT                   /transl_table=1
FT                   /translation="MFFNMLRPLTGLPVRFGSGAFAATTQPSLIMVRTLMKTHKGAAKR
FT                   WRKTAGGYKRSKAGRSHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH"
FT   CDS_pept        complement(645405..648338)
FT                   /codon_start=1
FT                   /gene_family="HOG000029666" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083010"
FT                   /gene_name="NMA111"
FT                   /locus_tag="ABR134C"
FT                   /product="Pro-apoptotic serine protease NMA111 "
FT                   /EC_number="3.4.21.-"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="apoptosis"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50905.2"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="HOGENOM:HBG056105"
FT                   /db_xref="HOGENOM:HBG333698"
FT                   /db_xref="HSSP:1LCY"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniParc:UPI0001DB2826"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D90"
FT                   /transl_table=1
FT                   /translation="MTIQAHKRTLSEVSTSSVGQLKRREGYTEDYTDEGSDIDMPEYVT
FT                   DSANNQQWQDTISRVVQSVVSVHFAQVAPFDCESALVSEATGFVVDAKLGIILTNRHVV
FT                   GAGPFSGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPSTIKYMNVQALELKPALAKVGS
FT                   EIRVVGNDAGEKLSILAGFISRVDRNAPDYGELTYNDFNTEYIQAAAAASGGSSGSPVV
FT                   NIDGYAVALQAGGSTEASTDFFLPLDRILRALRCIQGSQPITRGTIQTQWLLKPYDECR
FT                   RMGLSPESEAKAREQFPGKIGLLVAETILREGPADKSIKEGDILISINGQMICSFIQVD
FT                   AILDENVGKPITLVVQRSGIDITVECTVGDLHAITPSRYVEVCGATFNELSYQMARYYA
FT                   IPVRAVFLSSATGSFCFDTKEKLGWIVDEVNNQPTPTLDTFIEVMSTIPDCSRVTVQYH
FT                   HLVDQHSPHVTTVYIDRHWCNEFRIFERNDETGIWDYKNLADPIPALPLKPQTAKFIDL
FT                   PISNPKLARLARMLVMVSTIGPVPLDSVDPEPRKAAGLVLDAKQGYVIVSRRIVPHDCM
FT                   DVFVTIAESVLVPASVVFLHPTQNYVIVKYDPAQVQAAVETPILSTERLKRGDKVQFVG
FT                   YTHNFRSVSSETTVTDISSLSIPSNMVPRYRATNLEAISIESSVGSRCHSGILADDDGT
FT                   VRALWLSFLGEKQDEKDKIYLMGLDLVDIGEVVEVLKKGKIPRVNIVDSGFGSISVLQA
FT                   RLRGVPEEWIKRMESESENRLQFITVTRVSYTDEEQKLVSGDIILSVNDQLVKQMRDLE
FT                   GIVTTTDVPAVQQVLRFKIVRKGSIMDLDIKTIEVEETSKIVIFAGCILQAPHHAVRQA
FT                   MLNIPSGVYCTFRGQSSPAIQYGISSTNFITHVNEIETPDLDRFLEVVRTIPDNTYCKI
FT                   RLVTFDNVPFAISLKTNYHYFPTSELSRNSDTGRWIEHLCNATPAKN"
FT   CDS_pept        complement(648713..649957)
FT                   /codon_start=1
FT                   /gene_family="HOG000000884" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764713"
FT                   /locus_tag="ABR135C"
FT                   /orf_name="AGOS_ABR135C"
FT                   /product="ABR135Cp"
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nuclear origin of replication
FT                   recognition complex"
FT                   /protein_id="AAS50906.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005664"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG058235"
FT                   /db_xref="HOGENOM:HBG203778"
FT                   /db_xref="InterPro:IPR008721"
FT                   /db_xref="InterPro:IPR016811"
FT                   /db_xref="UniParc:UPI000025268E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D89"
FT                   /transl_table=1
FT                   /translation="MSVSQVRQSVSEILGLNAQEETPDWNSGRLKRMAATTATLYNVSL
FT                   NKVMLKQPEEIARCHICAYLAAEKLSEKYEPELQYYREKIPLEPRKTVKLVGLFKQTLW
FT                   TSSPVRNLNLSPSPKKDGGRLSARDPVELRAELFGTPVKRAGAVTLPGAGELSPTKQLS
FT                   PSKPMSPVKPSPRRRLAFEDEDEDYEPDASPQPSPRRSIFPGGFEPDPDESEFDSPTKS
FT                   PFKSPTRSPTKSAQSSPRKKRGEYNQWNMLYKKYYRITPEEIVGLCNQFELPSRVAFQV
FT                   LDCFGMHATYLVYPAQLVCGLVMLCCFVVHHRKRASDPTIDDYLLKKMCALLRSNSTSD
FT                   VLEAMKITKELLDGENWYRALKIEYDYYDAADFEQSLAIRLGSMLQNSNVIASTEQFEE
FT                   WKKKVMLDLSLRDGS"
FT   CDS_pept        650249..653176
FT                   /codon_start=1
FT                   /gene_family="HOG000066111" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764714"
FT                   /gene_name="SET1"
FT                   /locus_tag="ABR136W"
FT                   /product="Histone-lysine N-methyltransferase, H3 lysine-4
FT                   specific"
FT                   /EC_number="2.1.1.43"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /cellular_component="Set1C/COMPASS complex"
FT                   /cellular_component="chromosome"
FT                   /protein_id="AAS50907.2"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0048188"
FT                   /db_xref="HOGENOM:HBG203779"
FT                   /db_xref="HOGENOM:HBG436103"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR015722"
FT                   /db_xref="InterPro:IPR017111"
FT                   /db_xref="UniParc:UPI0001DB2827"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D88"
FT                   /transl_table=1
FT                   /translation="MSGYYNHVKHQGYSRYGQNSTVRNGQHDGLRYRNPSPAHNGTNEG
FT                   EGLQGSRYENAGGVTHARRPPPVVKWGEAAFRAKYHYFDVEERKLLHLDEMKHWQNGRL
FT                   PANGYVLVADAGSKGRPVMRERNPEEQAVDPRGARAAHTVRRVRSLLTALPRIPYDAHW
FT                   VGPEPPKEVVVFPKQREQALSVQDPIIKNFFGTFGEVAHFESFNDPNNALPLNIYLVRY
FT                   INVEGNPDSPYKAAYKAVKQFAKQDYLVSGARFAVRLNMNGFLQKTIDKFVTENLQRAA
FT                   KLRHEQAKQQSTVQKVTNVSAVPSGVPPPKIPLGLERIVNNKPILRVSARFCALHGITS
FT                   EDFKYGLKNYHWTRVINHYSGIYIIFDDIAEAEKCLQMESLRLTFFSRRRKIPVKIKFM
FT                   LIEPSHQPPASQPLTDQDEVPKVYETEAELIEETLKHIINELKTTLYKDIRRRLLGPTI
FT                   FDALNPGNYPDIVARRQKEEEAKKEKEKAMVEKTKKEAPSAAAFDIFNLYGTAYKKRDG
FT                   TKGKKRHVAEGRPEESSGRRRIQSKGTAPMAHMLNYESLKVNGTASPIKEAESETCSSD
FT                   EEDDDNFDVEMTDQSSIKKLKRESTATTPEQEPLQERVAGLSAERTKELLSYPEKYRPL
FT                   AGDQPEPIYPEFLIEKYDDPLLSIVDLQRSVKDKEDMELLKKVIAYDREEVKDVINDIE
FT                   FFAWRLHRDYKEHKENMQHQSKLSESTYKNLLNAHGGCFKQQGFRKMPDKLKSIYLPHR
FT                   RKLNQPLNTVYHHGIEDFANTDNNKMDTDPPEDTFTPEQTSSRVNRALQRRFQQDIEAQ
FT                   KAAIGTESELLSLNQLTKRKKPVTFARSAIHNWGLYALEPISAKEMIIEYVGERIRQPV
FT                   AEMREKRYLKSGIGSSYLFRVDESTVIDATKKGGIARFINHCCDPSCTAKIIKVGGMKR
FT                   IVIYALRDIAANEELTYDYKFERETDDEERLPCLCGAPNCKGFLN"
FT   CDS_pept        653347..656214
FT                   /codon_start=1
FT                   /gene_family="HOG000157750" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931648"
FT                   /locus_tag="AGOS_ABR137W"
FT                   /product="ABR137Wp"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="AAS50908.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG377949"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniParc:UPI0001DB2828"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D87"
FT                   /transl_table=1
FT                   /translation="MLLHVGTLLRCTGHRILRRYTIVPAARDINPVVAKLKFSLDVIPA
FT                   TQIESQESDDSEPNKKIDRGNRMYSNSLPPSLQFVRDMMDKYPDYVLLTQMGSFYELYY
FT                   EHAEKYAPKLNITLTRREYSHGKVPFAGFPLEQLSRHLKVLVKEYGYSVAVVEQFRKDD
FT                   IADNERYKFNRRVTRVVTPGTFIDEAFENLQENQFLLSVEFPDRCMEKLSDPSIKVGLS
FT                   WCDISTGELFVQQVQLKGLISAITKIKPREILLSEDLLAYQIQNGNWYPELVEFKKYFI
FT                   KYYKTPSRHRTMETFSHLFAFGANNASKRNLDIVLHSLSQKETAALRANLTYIEQHLPE
FT                   MLANLAFPKRSLTTDSMQIDSRTSAALELHNTFRDNLKRGSLLSAIRRTVTPSGTRLLT
FT                   QWLSAPSMHLDEIKQRQNLVRLFMQNPFVTDNLIAQLKATADMTRILQKFSFKRGDAAH
FT                   LLQMAQSLQQCSAIGDTIHSFTTEGPISKDLAAVLDKLSSALRFEGGIVQEILAAINLK
FT                   KFSEFEGPQLVTAPEDEPALSLEDSNETTEFPVHPGMLNPEVSPRLGDLYSKYDKLLTR
FT                   QQQLLQEYRDFFVHTHKARTITTRNNKRDTGYALYLTGGGNSLKKILRNVNEGAEVADS
FT                   RFRIIRSSANTCWLSHEPWNELGKAMHLTTLELLDEERYILDNLQRKIITYSTEIRAIA
FT                   QTVDYLDVLSSFAILASEKNLVCPQVDESSALEIVGGRHLVVEDGLQSRAPGNFTANDC
FT                   SLQNGDIWIVTGPNMGGKSTFLRQTAIIVILAQIGCYVPCASAHIGLVDKIFSRVGSAD
FT                   DLYNDMSTFMVEMLETSFMLKGATKRSLAILDEIGRGTNAEDGVGIAYTTLHHMLTKNR
FT                   CRALFASHFGRELSELVEQHLPPGARKRVHFYRTNVREHNGRSFYDHKITPGICLSSDA
FT                   IRVAQMAGFPQEALDVARRVLAAST"
FT   CDS_pept        complement(656302..657966)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764715"
FT                   /locus_tag="AGOS_ABR138C"
FT                   /product="ABR138Cp"
FT                   /function="pseudouridine synthase activity"
FT                   /function="snoRNA binding"
FT                   /cellular_component="box H/ACA snoRNP complex"
FT                   /protein_id="AAS50909.2"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0031429"
FT                   /db_xref="HOGENOM:HBG058236"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniParc:UPI0001DB2829"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D86"
FT                   /transl_table=1
FT                   /translation="MRWASVAAALRSASDIGRMALEDSEATHSTTGVQPDDATGPDREA
FT                   QGAESSSTAAPEHIHTQNADGTQPGEGSAALVADGETVAAGLRAGAQWADETVTVELPE
FT                   DVSEADCLSSDEEGLGATPAAAAMQTSAEQGGSDGGSAEQGGSDDSSSESSADEADAAL
FT                   SDAELDEEEDAPQGPVRSKNELVEEPLPEIPADFVVESDTPILEIGTIKSAFDQNIIVQ
FT                   AMLSGEQRVLQEGSIFCLADRTVVGPVCEVFGKLSNPFYRVTFPKDAAEKFELFKNQLG
FT                   AQVFLVQPKAHWLDTFEIKQVRGTDASNGVDEEVPEDEQEFSDDEAEAEFKRQKKLAKK
FT                   RKAGNQDEKPRGKLSLEGRTGLPRMQVPSSLARASDRAPTYKPRSARQQRPVPPSHSRP
FT                   QDQRASVAQPAHSAVPYAPLAAQPAPPVSYSQTAFPQATQPQMYPTSDPMAAPNQWYHN
FT                   AAMQQVFHPAMMPQQYNPQQYAPPHFPQQYAGTYLPPQQYQEQLAPQPPVGQYNQAQLL
FT                   QQLLLQQHNQNQQQQNQQNQQNQYPYPYNYQQHQPPH"
FT   CDS_pept        658370..662350
FT                   /codon_start=1
FT                   /gene_family="HOG000157282" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20626147"
FT                   /locus_tag="AGOS_ABR139W"
FT                   /product="ABR139Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="AAS50910.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG022677"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI0001DB282A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D85"
FT                   /transl_table=1
FT                   /translation="MARHTRRSHQHVNDEDTGSEIYDKNGIKHTTPRSLKKINYAEIEN
FT                   SYDYMEDYDEGDKEEEPAELENNGRSKGLVGRERGREPEEDEDEEGPVRGRRSRKRTYV
FT                   DVEEDESFHEEEAEDEDEEALDDDEDEDEEERNWRRRREHQFVVEDEDDDEDEEDDYGA
FT                   QKKRGRRRTRRGRSRLTERRSPPRKLRTRRTRSSVNMYDSEHDGTGEALTLEDEIRELQ
FT                   EDSPIREKRSLRERTKPVNYTLPPPLTDNQMNVDGTAAPAYGSFHSPRGKRGLHSGQSF
FT                   GPIRRLFPTGGPFGGNDVTAIFGHNTNFYATAQDPTVANNKFIDSDSSDDEILPLGSTP
FT                   KPKSSEAKKKKKPEIADLDPLGVDMNINFDDIGGLDNYIDQLKEMVALPLLYPELYQNF
FT                   NITPPRGVLFYGPPGTGKTLMARALAASCSTEKRKITFYMRKGADILSKWVGEAERQLR
FT                   LLFEEAKKHQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQVIVIGA
FT                   TNRPDAVDPALRRPGRFDREFYFPLPDIRARAKILEIHTRKWHPPVSSAFIEKLASLTK
FT                   GYGGADLRALCTEAALNSIQRRFPQIYQSEVKLAINPREVQVKAKDFMIAMEKITPSSA
FT                   RSSGNLAEPLPRTIAVLLNDQFEEIKQKLNSILPEASSKSHRGSSLIKEYLEYEDEEDE
FT                   EDGEDNIEGTGIHSSNGFSRHEFFKMLDQARTVKPKLLITGPAGNGQQYIGSALLHHLE
FT                   DYNIQNLDLGTLLSESLRTMESAIVQTFIEAKKRQPSVIYIPNADIWSRTVPESAIMTL
FT                   ASLFRSLKTNERVLLLAIAEGFTEEELHNTPLSLFGFDLNIVSIREPSTAQRHNYFKTL
FT                   EELLKMKPTKFREKRKRKKPLPVLPVCDTPSNDDIGSDGELLTEDEKLRRKLKSYHHQD
FT                   MKLKNTLKIKLSGLMDLFKGRYKRFRKPPIEDSLLIHLFEPEAYASNPEWQPAYVREDD
FT                   MILEVSTGRKYYNMDLDIIEERLWNGYYSEPKQYLKDIELIYRDANTTGDRERIIKASE
FT                   MFANAQMGIEEISTPELIQECRDTRQRELLRQQLYLRDQQKKIHEEEAKLEQEKKDPTF
FT                   PNDDNHPEEADLSVGAGQQLHSPSQMSHEACESHAEDGLGVPHGFENNTYAIGDNTPET
FT                   IDNGSPKPLEDFCGEDKTVPDDKSVPERFVQEGEASEMGFIPKTPSARPVSMHSNPSSK
FT                   ESVVAPMQKTGLEVNSIEDTSVAVQSELTRDEDLPMTPEPAFILDETVLAKIISMLKTK
FT                   TQGFTVEQLETCYAAVLELVWEARSSWDKTSVIKQIEKYIGM"
FT   CDS_pept        complement(662417..663808)
FT                   /codon_start=1
FT                   /gene_family="HOG000116699" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778675"
FT                   /locus_tag="AGOS_ABR140C"
FT                   /product="ABR140Cp"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="AAS50911.2"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG447642"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI0001DB282B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D84"
FT                   /transl_table=1
FT                   /translation="MKRALERLRQLPRANERFNIFNSVNLSAAQQVMPSEKPLGNLVVG
FT                   IKDNIVTKKLPTTCSSGVLAGYMSPYDATVVELLDEAGAVTAGKTNMDEFGMGSGGIHS
FT                   FFGPTLNPAFPERPTVAGGSSSGSAAAVAAGVVDFALGTDTGGSVRMPAAYTSTVGFKP
FT                   SYGRVSRHGVIAYAQSLDTVGIGARDVGLVRRVFEVLDRHDPKDPTSLPDELRQQAAAL
FT                   RREKKHLKIGIPAELLHGSVAAEIRERLLVVLDKLQAQGHELYPVSVPAVKNSLLVYYM
FT                   LAPAEAASNLARYDGIRYGCRDEDLDMSDEVLFAPTRGKFGKEVKNRIVLGNYNLCSGA
FT                   FKNNYMKAQKLRVELINQFDSIFAFENICTGNKPNPAGVDVLLSLTCMAPPPSLEAFTS
FT                   KENKSPVNSYINDVFTVPMSLAGLPCISVPLAGMKGVGIQLTAQFADDYGLLDAAEDVM
FT                   QEQLN"
FT   CDS_pept        663924..665015
FT                   /codon_start=1
FT                   /gene_family="HOG000142054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764716"
FT                   /locus_tag="AGOS_ABR141W"
FT                   /product="ABR141Wp"
FT                   /biological_process="microtubule-based process "
FT                   /cellular_component="dynactin complex"
FT                   /protein_id="AAS50912.2"
FT                   /db_xref="GO:0005869"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="HOGENOM:HBG058237"
FT                   /db_xref="InterPro:IPR006996"
FT                   /db_xref="UniParc:UPI0001DB282C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D83"
FT                   /transl_table=1
FT                   /translation="MKVEVIDLSATQAQDPLDEEEPKEQEVFETSDNEGLVDEETDEAR
FT                   QDQEVVSDPVASQDEARTVFESTVVVSTGDFSGRIDRCADLCRTGRADESVDQRLARIG
FT                   RELQEIELERGAEEYADEAQGLQEMYRALERERARELGRMQARLQLAPSEEGAVRLPRV
FT                   TLDAGDCERIVELERKIASLEASVGQTSSTKSVVTCVNELFHKVSLLENNEPLLEKFET
FT                   SMKRISKEYEESIIGRRATKDPALQKHITEDLKTTDTKVAEIYNSYNLLKKYAGVLPDL
FT                   INRVQSLNTLHREVRDAATTVQDFDQNVAQLSAQADRWDTMLTEMEEKLDQHEASFEKN
FT                   KETIFHWVSALEAKLDGQKGSSL"
FT   CDS_pept        665108..670984
FT                   /codon_start=1
FT                   /gene_family="HOG000157749" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083011"
FT                   /locus_tag="AGOS_ABR142W"
FT                   /product="ABR142Wp"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="AAS50913.2"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG023097"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI0001DB2839"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D82"
FT                   /transl_table=1
FT                   /translation="MSVAYSTDSVSSYMRAMQAMIGSAQEFRFTKRELELPEVEVECVD
FT                   IASATESEELTTLSLDRNVWDEVFDLFEDLDSRRLETLAENNDQAKAVRVYKKLFQLLD
FT                   ESTLHSSEEEVVKQLVVILKTHGEDGMLEQVLFDCLGSENIELLSYVIQQQAVLKQLPV
FT                   DEGVDLRQFLMEQPTLLSETDIRAQVLLTAAEGRNQELRKLQRIERYPNIYRNSEVNSS
FT                   AFSFGGQEYVLPVGTTRLSLHTHEEVVIPCSENKNEYLSSSRLLKVEDLDRFCQSVFPY
FT                   ETLNAIQTLVYPVAYKTNENMLICAPTGAGKTDIALLTILNTVKQFSEINGDEVDIFYE
FT                   DFKVIYVAPLKALAAEIVDKFSQRLAPYKIRVRELTGDMQLTKAEIIETQVIVTTPEKW
FT                   DVVTRKANGDNDLVSKVKLLIIDEVHLLHEDRGSVIETLVARTLRQVESSQSMIRILGL
FT                   SATLPNFFDVADFLGVNRHVGMFYFDQSFRPKPLEQQLLGCRGKAGSKQGRENIDKVSY
FT                   EKLYEHVLNGSQVMVFVHSRKDTVRTARNYISFAQANQQSDVFLSSDQSVTKFSRDISK
FT                   HKDRDMKELFQHGFGIHHAGMSRSDRNLTEKMFKEGAINVLICTATLAWGVNLPADVVL
FT                   IKGTQIYDSKKGGFIDLGISDVIQIFGRAGRPGFGSLHGTGILCTTSDRLDHYISLITQ
FT                   QYPIESKFSSKLVDNLNAEISLGTVTNVEEGITWLGYTYLYVRMKQNPLIYGLDWNEVS
FT                   NDPQLYDKRRSMIMQAARRLHALQMIVFNDTTMNFIPKDLGRVASDFYLLNESVEIFNQ
FT                   LCNPRVTEADVLAMISMSSEFDSIKYREDEAGELAKLFDTAVECQVGGQVESSAGKTNI
FT                   LLQAYISQTRINDSALISDSNYVAQNSARICRALFLIGINKRWGRFAIIMLDICKAIER
FT                   RMWAFEHPLSQFALPETILRQLRDKSPPIENMLDMEASELGELVHNNKMGAKLYRILRT
FT                   FPRVEITAECFPITTNVMRIHATLEPDFIWDFHIHGNAQFFWVLVEESDNSEILHFEKF
FT                   ILSRKQMGHVHEMDFMIPLSDPLPPQVVIKVVSDTWIGSESTHVISFQHLIRPHNETLL
FT                   TRLLRLRPLPTTALNNPLVESIYQFKYFNPLQTMTFHTLYNTNENVFVGSPTGSGKTVV
FT                   AELAIWHAFRDFPGSKVVYIAPMKALVRERLHDWKKRITPVTGDRLVELTGDSVPDPRD
FT                   VKDATIIITTPEKFDGISRNWQTRKFVQNVSLVIMDEIHLLASDRGPILEMIVSRMNYI
FT                   SAQTKKPIRLLGMSTAVANAYDMAGWLGVKNNGLYNFPSSIRPVPLKMYIDGFPDNLAF
FT                   CPLMKTMNKPAFMAISQHSPDKPVLIFVASRRQTRLTALDLIHLCGMEDNPRRFMKMDD
FT                   EGELRYYLDQVSDETLKLSLQFGIGLHHAGLVEKDRSISHQLFQLNKIQILVATSTLAW
FT                   GVNLPAHLVIIKGTQFYDAKIEGYRDMDLTDILQMMGRAGRPAYDTSGTAIVYTKESKK
FT                   MFYKHFLNVGFPVESSLHKVLDDHIGAEISSGTITTRQEAMDFLTYTFLFRRAHHNPTY
FT                   YGILEDTTAAGVNEYLSSLIDTTVQNLAQSQCIMTEGKRIIPTAFLSISAYYYISHKTV
FT                   RQLLSQLYNSCKFQDVLKWLSLAVEYDELPVRGGETIMNVEMSENSRYSVESTFTGEQE
FT                   LPIWDPHVKAFLLLQAYLSRADLAIADYYQDTISVLDQALRILQAYIDIASESGYLRTV
FT                   MTMIKAMQCIKQGTWYEDNPVTALPGITLQRLDPELFGDDGFPYEYSGEMLTLEKLGRM
FT                   GYAALCSVCRVHNIQGAAKDKFIREASMLPVLDKVHFKDQSNPDKLTLVAFRHNESYKD
FT                   GFRVWCDKFPKAQKELWFAIGFQGDELLMIKRCQPRRDEGRVIITCDFVVPEELYGETL
FT                   GFVLINDAMDLHYELSHTLAGGPKK"
FT   CDS_pept        complement(671072..671737)
FT                   /codon_start=1
FT                   /gene_family="HOG000074710" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083012"
FT                   /gene_name="EFG1"
FT                   /locus_tag="ABR143C"
FT                   /product="rRNA-processing protein EFG1 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50914.3"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058238"
FT                   /db_xref="HOGENOM:HBG397455"
FT                   /db_xref="InterPro:IPR019310"
FT                   /db_xref="UniParc:UPI0001722CFD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D81"
FT                   /transl_table=1
FT                   /translation="MANLKSARHRKAAYDSSLQLANALGAGANKIKKQIRNVERLLAKK
FT                   RDTLPDTVIVEKERTLEALRLELASAEKRALARKNAKKYHMVRFFERKKATRRYKQALK
FT                   KVETSAGDDAALTDLRQRELELCYVVNFPKTTKYIALYPVEEDPEAAKETAAKRDAFLK
FT                   VVAKQLSEGTLPVPLEQILKGKKLNKESTGISVSDSEDEEEPGRNEEAHEEEEDDFFE"
FT   CDS_pept        complement(671937..672632)
FT                   /codon_start=1
FT                   /gene_family="HOG000246490" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626148"
FT                   /locus_tag="ABR144C"
FT                   /orf_name="AGOS_ABR144C"
FT                   /product="ABR144Cp"
FT                   /protein_id="AAS50915.1"
FT                   /db_xref="HOGENOM:HBG124689"
FT                   /db_xref="HOGENOM:HBG397242"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniParc:UPI0000252697"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D80"
FT                   /transl_table=1
FT                   /translation="MDTPTHRIKRRSSMPCRALCLSLAAEEVKPRNILHFIYAYIYIVK
FT                   SASDVPHCWRPGSSMGIFRRESSSRSATQKLAKSDTEKLAPRTIHDPILEAVNEAQPFE
FT                   QAVATFTENENHTLCSDQRVTKDVFGKPVVQPDISNPTRSRDERPLDTIRGFEYAITGD
FT                   QQWMQQLETHRYGFSVRPDFPGLPVGAYMAGAGGYPSFQREQPVFEAPKVSPPRTQSKR
FT                   RGLFGTRKK"
FT   CDS_pept        complement(672814..674487)
FT                   /codon_start=1
FT                   /gene_family="HOG000216602" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764717"
FT                   /locus_tag="AGOS_ABR145C"
FT                   /product="ABR145Cp"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="AAS50916.2"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG138467"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI0001DB283B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D79"
FT                   /transl_table=1
FT                   /translation="MIESLENVSELLPSSIPVPTSVITVTSYVLFYLQRIIMAIPGAHY
FT                   MVEYIAKSHQDDPYRTMVELGLILYGIVYYLNKPRKQGQAEQARFTAREEEQLIAEWEP
FT                   EPLVDPDFREGWRLAKMPQRRSDDMGNRVTVMRDDGRETHADVLDMASYNCLRLSQQDA
FT                   VVARVEKTIRNYGVGSCGPAGFYGNQDLHYNLEYELARFFGTENAVLYGQDFCVASSVI
FT                   PAFTKRGDVIVADDQVSVALQNALQLSRSTVYYFKHNDMKSLEELLTKLDERDRAEHLP
FT                   ALPRKFIVTEGLFQNSGDIAPLPELVKLKGAFHYRLVVDETNSLGVLGNTGRGLSEHFN
FT                   VQRCSSIDITIGSMATALGSSGGFVLGDNVMSRHQRIGSNAYCFSASLPPYTCAGALAM
FT                   LQTMDADNSAVQNLRTLAKAFHASFTSDLELAEYILVTSNENSSVLHLQLAPAFRMRLF
FT                   GSSAESIYDELVQLRARHATSLYVDSWEQEERFLQRIVDRVLKDGVLITRNTVVLKHES
FT                   LPIVPSLKAYCHAAMSCSELERAHEVIKAAIIACCAQPSL"
FT   CDS_pept        674887..676224
FT                   /codon_start=1
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764718"
FT                   /locus_tag="AGOS_ABR146W"
FT                   /product="ABR146Wp"
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="AAS50917.2"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG407991"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI0001DB283C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D78"
FT                   /transl_table=1
FT                   /translation="MLRSIARSPLLKRSIATQAAPKAEITELSNGLVVATEPNSNAGSA
FT                   SVGIVFGSGAAAENPYNNGVSHVLSSAFKSINGAAAAKEGFSLSTAVERDFQSYILDTE
FT                   AANAGRALDFLQSKLFAPVSDGAFASVRDATLKRVAAFEEQEHAERVLEHLHATAFQNT
FT                   PLSLPKRGTVESIETLEKSDMESFAKSHFVASNAVVVGSGNISHEALVKAVESQLSLAG
FT                   GSKPVSKKVSSFLGSEIRLRDDTLPKAWISIAAEGEPISSPNYYVAKVAAQIFGSYVAS
FT                   EPASNLQGVKLLDTVKEYHLADSFNHFSLSYKDAGLWGFSTEISNIHQIDDLMHFALKE
FT                   WNRLSVSITETEVARGKALLKLNLATAASSNAAAATALGAQTLATGSKLALTEVFAKID
FT                   AITAKDVKKWANERLWDQDIAIAGTGQIEGLLDYMRMRNDMSMMRW"
FT   CDS_pept        complement(676762..677832)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083013"
FT                   /gene_name="PSY4"
FT                   /locus_tag="ABR147C"
FT                   /product="Serine/threonine-protein phosphatase 4 regulatory
FT                   subunit 2"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50918.2"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG058239"
FT                   /db_xref="InterPro:IPR015267"
FT                   /db_xref="UniParc:UPI0001DB283D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D77"
FT                   /transl_table=1
FT                   /translation="MQSGEESRLGIKCASLHEELTQIVIDQDVGPLQRVPASEFLARLV
FT                   EHMGQTIPREVFGAEAETGTRDLERLGAIVAYIDENFAAQNVLPFTIQRICELCYHPLH
FT                   YFRVGELRKFVNALEKVCYVRSSWSAGYGAVPSPAEGTPTREASVDVSMSKIPWLPDDG
FT                   GRDLRQFIEKIESIVSVNFGYEDDEDEGRDAAIQEYYDNEGAGDDEDDDQDYVDEDSAT
FT                   SEDEEEDVEEEEEEEGPEPEVGLEPVHAESAPEECVGTNKRTTAEREDCHMQPCAAAHS
FT                   TDGAHPCGLKRSKLQEDGATMASPPDIVAEGGSHDPQVVDASKPPQLTTSATNVSCNAS
FT                   IEATVSLDDDSTAGGE"
FT   CDS_pept        678180..679049
FT                   /codon_start=1
FT                   /gene_family="HOG000000824" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764719"
FT                   /locus_tag="AGOS_ABR148W"
FT                   /product="ABR148Wp"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50919.2"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG378671"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="UniParc:UPI0001DB283E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D76"
FT                   /transl_table=1
FT                   /translation="MLKNFLLVNSPTSSTAELRGMFGLRRWIAGSAWRAAGAARPAMPR
FT                   ATPALRPAAVAQRRAQTTAAGGNAARAADTAAVDEADKQADEWLAALDELEAEFSATEY
FT                   QPEVSLAGEGQKLDLLEEAARARRAFQPTAEQQAEWERLQQVPLPPRRDEVIEHVTNML
FT                   MRHGKKEKARKQLARALYVVFCATRQDPVVQLRRALDELAPLMVVKTFKTGVAKAAVIP
FT                   VPLNQRQRQRLAWRWIVEGSEKRSSSDFAVRLGEELVAVLSGRGSGLSKRDAMHKTAIA
FT                   HRAYIKLK"
FT   CDS_pept        join(complement(679428..679505),complement(679070..679426))
FT                   /codon_start=1
FT                   /gene_family="HOG000000821" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /ribosomal_slippage
FT                   /gene_id="IGI19778676"
FT                   /locus_tag="AGOS_ABR148CA"
FT                   /product="ABR148C-Ap"
FT                   /protein_id="AAS50920.2"
FT                   /db_xref="HOGENOM:HBG253062"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniParc:UPI0001DB283F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D75"
FT                   /transl_table=1
FT                   /translation="MELSGLGIRWRYFGLLCATGCVAVFLGITTDKRFNAITAEHDKAA
FT                   HFAVFALESWLFTRSIVTRHVAVPGRWLQGGDVEQGAQAARVSKYWVAGLACGAAAAVL
FT                   SEVAQHVVSRGRRVFDVWDVACNAAGALVGVGAAWWRERR"
FT   CDS_pept        679805..683485
FT                   /codon_start=1
FT                   /gene_family="HOG000112328" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083014"
FT                   /locus_tag="AGOS_ABR149W"
FT                   /product="ABR149Wp"
FT                   /function="calcium ion binding"
FT                   /protein_id="AAS50921.2"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG058241"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001DB2840"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D74"
FT                   /transl_table=1
FT                   /translation="MSKIVFRVPLLADEQASFGAQFRELDSDELGIVTGETLKELFGKS
FT                   GLSSQQLSRVWALVDTEKQGFLNLTQFSAAMRAIGHLQATPHAAITPELYQTPATRLAT
FT                   FTGVVTGGIPAISAHDAGKYGQLFERSAEGRVISGARAKDVFLKAKLPHVVLGSIWTLC
FT                   DRNNSGSLDRAEFIMAMHLIQLSLSKHPSVATFPQALPAYLWNSIAAAVPLSSESTGVS
FT                   ASSVSRPVSLARIPSSSFSNASSDWVMTPEKKQQFDSLFDSLDKNRAGALGADILVPFF
FT                   LTSKLSQDTLATVWDLADIHNSPVFTKTEFAIAMFLIQKKNAGVELPDVVPEQLLASPT
FT                   LGLYQTAGQPRSPQSTSHGGPPAAPPQTYLQPVPSRDTKPHFEQLQQQQTTSSSLTELL
FT                   GLNPSFNAPASHTVQSTSVSSVNASPRQPTSNRSQPVNVANRGINSAENTSRSIPALSP
FT                   QGTPQNQAMRHSSYISTLPTVPDFASLQVSEQLAPVKDIYMDSETSGQLSQATTDVANL
FT                   SNQVSSLTTQVTKTTERKEHAQQELSRINELKASLEAKLTTLHSSYQQETQQMEEVEQL
FT                   LTKARAETEVLTQQLQNTESTCHSTQSELTNLQLELQECEKTNTQLKEKISNYNNLILS
FT                   LQQDLAGKQQQVKQQRALVDVNTQQADLNATTVAGLEEEIKGLDDRLAKLIEKRKELDD
FT                   YQTNIERQHKDLEEKHLQFVSRSQELENKYLEFSQREKDLQERTKQIVEQEHVYNEQVS
FT                   RLQQLFKDLNIQRAAFEKAEQDLQECRVEYTQQVQKLSDKQLKLAMRELPEDRSNNASH
FT                   SENEDAVAKYVEETVTNSKLNVGGHATTLDTARVATVLPQDEEGKQDSVFDKDFPTSPS
FT                   QTELEEEEHPATAETAAQALDESDMNIYRIPRTESVTSSTANNAPQSLRDEAVSDTQGP
FT                   VADEENESATITKRATANSDDEENSTQAASRSLPGEWGDLNYPDHATEKSNNKLKENLS
FT                   VENSPTPASFDKMTLSVDSTDDSGMEAEKYHSTSDIPATVLPQRVMSPLVPARNVVVKA
FT                   VDSISGHTFSFDDEFADLEQASPEDEATGSKRVSSIEGFETIDHADLEDELHETGFTGA
FT                   GTAEMLTPSNYSTQTGHPTSAQVASSPVGNDEWDEIFSGFGNNSPGLKQPTAQTTMGGS
FT                   SQANTPQLKSPLNRKIATTPKSLAVEELGSMGFTEQEARKALEKCKWNLEAATNMLLDG
FT                   S"
FT   CDS_pept        complement(683574..684173)
FT                   /codon_start=1
FT                   /gene_family="HOG000248864" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764720"
FT                   /locus_tag="ABR150C"
FT                   /orf_name="AGOS_ABR150C"
FT                   /product="ABR150Cp"
FT                   /protein_id="AAS50922.1"
FT                   /db_xref="HOGENOM:HBG058242"
FT                   /db_xref="HOGENOM:HBG202259"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="InterPro:IPR016851"
FT                   /db_xref="UniParc:UPI000025269E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D73"
FT                   /transl_table=1
FT                   /translation="MSHDHRIRFKRLNQVCEKALAQSISKLQNWDKLSSCYPGYISTRE
FT                   GYANLKTCQVQVCDFWSQLCRQEFQAIFEERDVKAKLDELDDLILKAKERARSHRDGTG
FT                   SHTRVEDLTPAQLIRGSIRRAQSETLEQLDTRLRSLDGKNAKLRAELEELNKAVGSELE
FT                   ELDRLYEKWLGKGLGNGAGELQQGVENMVVETREGP"
FT   CDS_pept        684314..685192
FT                   /codon_start=1
FT                   /gene_family="HOG000000820" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778677"
FT                   /locus_tag="ABR151W"
FT                   /orf_name="AGOS_ABR151W"
FT                   /product="ABR151Wp"
FT                   /protein_id="AAS50923.1"
FT                   /db_xref="HOGENOM:HBG058243"
FT                   /db_xref="HOGENOM:HBG395604"
FT                   /db_xref="UniParc:UPI000025269F"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D72"
FT                   /transl_table=1
FT                   /translation="MARYPIAQTSNILNAARLVHLAQLPAAMRSGPQMDNIWYLVAAAA
FT                   FNTCNEPREIPLLYHFALLRHTSGAVDDPSDEEVARKVVKLFDRDEGSRRATFNQWYRT
FT                   PTAGQRQITQRFRETLLKSVALSGLPRAINSLHVLAQETPESLLPEHGAVKLDERNNGQ
FT                   LFAHAARNNGMDHEALVARGLEHWCHIYGKVSERVANNLNASYPDLWYHAIVNVYAPLL
FT                   SHSGPLDARETSLVIIANLVPQDVNAQLWGHLRGAQNIGCEAEAIECSRQLSIEVSRMC
FT                   GVRWKGAVAKL"
FT   CDS_pept        join(complement(687191..687214),complement(685277..687142))
FT                   /codon_start=1
FT                   /gene_family="HOG000210599" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764721"
FT                   /locus_tag="AGOS_ABR152C"
FT                   /product="ABR152Cp"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="AAS50924.2"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG051623"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017906"
FT                   /db_xref="UniParc:UPI0001DB2841"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D71"
FT                   /transl_table=1
FT                   /translation="MDYIKVAKVNNVILHRRGQSVEGTLHLTTHHLIFTGRGLAREFWV
FT                   SYPTIGAVFKNRGSALISKQRSGEGVAESLYWDKDIWSVAQIKVVGKDYTVFSLDFAVE
FT                   ASAQDVFESLLHLTVLHQVSQLYAFIYLPNRVEAPFDSWKLYKPLEEYARQGLTLDRGS
FT                   PWRSTAINDNYQFCATYPAVLVVPASISDTLLTHASKYRSQNRIPVLTYYYKKTGASIT
FT                   RSAQPLPGLTQQRSIQDEKLVYEAFQCAPEKTKKDLIVDARPATNAMAQTALGGGTENM
FT                   DNYGFGSTCSRMFLGIDNIHVMRDTLNFLVENFLVDNDLNLPIDAHSLNSGKASNWLKY
FT                   IKVLLSATDTLVKSIIFNKSNILVHCSDGWDRTAQVCSLVQLCLDPYYRTFEGFMVLVE
FT                   KDWLSFGHRFAERCGHLSSEYIFRDNSINRINLTSNSVQLADNETIDQSLSTNDLVVRK
FT                   SSFIRKKTNLKLTSPIFQQFLDCVYQLLLQNPEQFEFNERFLRRLVYHLYSCQYGTFIF
FT                   DNEQERVLREASKVTRSVWDYFRSRPREFTNPAYKPVGPDEEEDWLLPDLNKLQWWWQL
FT                   FGRRQHEFSDAGSSPNTQGTSNAMSAAASENGKNIYKLTSKLTTFSLEIFGKK"
FT   CDS_pept        complement(687563..687937)
FT                   /codon_start=1
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764722"
FT                   /locus_tag="ABR153C"
FT                   /orf_name="AGOS_ABR153C"
FT                   /product="ABR153Cp"
FT                   /protein_id="AAS50925.1"
FT                   /db_xref="HOGENOM:HBG268212"
FT                   /db_xref="HOGENOM:HBG524054"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniParc:UPI00002526A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D70"
FT                   /transl_table=1
FT                   /translation="MAIGYSMYIERPVPDTTSAKNKYAKMAIYGCAHCKTHLSSSNYFM
FT                   SDDYRGRTGAAYLMQKVINVMEGRRETRCMSTGRYVVCDIYCHTCKNLVGWKYLLSEKR
FT                   DQEYKEGKYILELEPITECD"
FT   CDS_pept        complement(688484..690643)
FT                   /codon_start=1
FT                   /gene_family="HOG000141856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764723"
FT                   /locus_tag="ABR154C"
FT                   /orf_name="AGOS_ABR154C"
FT                   /product="ABR154Cp"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50926.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG190325"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI00002526A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D69"
FT                   /transl_table=1
FT                   /translation="MKLSIVLTLATLPSALASSASSGYKRTPVGQYVSAGCKHATEAKA
FT                   AFCKKSHPKRFECQCTNENALASLVYCAYKETEHDPKERHSFEESFIETCKGKVTQEGI
FT                   EAAYNRALKKIVSVKDIPNFNKTIPVKVPVKHDHAAYVSGYRTKRSRSRNKDDALEMSF
FT                   VLLCFWGLVTVLSGLAHVSRRMAPRLWMSASRSLNSVTAFRKLRQYVTMPATHRGKHTE
FT                   KYGFLGFMPTRLESVIIFIFVTLSVVFHAVRYEYVYPNTVYKTRHAQMGRLVGDRSGML
FT                   ANCLFVLTWLFASRNSIILAFTGWKQSTMLTYHKAIARTAIASTLVHTISMLVHTLDLG
FT                   RSKYTTRSQTGWWRWGSVATVAACVILIQAQSWFRMYSYEIFLYLHILLAVFVLAGAWM
FT                   HTAWFSDEQWYFACAALWCFDRFIRLVRMGYFGFRTAHARVLSAENGIFELVVPKHKAW
FT                   IAFPGSVAYVYFLGTPLFWQSHPFTIAPAEDGKLRFVIKAKRGATAHILRRLLASPDQS
FT                   ASFRVCVEGPYGNYAPIKHYDHLLLYAGGSGIPGPLCYAKHLGELGLSSRVPFVKLYWV
FT                   VRHAADLDWYKDDLTALARYSNIQPIVYITRPDSASPLKAEADSLSDDDSEGRACSPQK
FT                   EGSLTEVTTSLLYSKQFAHVEFRYNRPDTSQLIAGDMADLAGASVAVMSCASPNMVDDI
FT                   RAAVALAAGSYKSSTIDYYEELQVW"
FT   CDS_pept        complement(691310..692185)
FT                   /codon_start=1
FT                   /gene_family="HOG000165015" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764724"
FT                   /gene_name="SEC17"
FT                   /locus_tag="ABR155C"
FT                   /product="Vesicular-fusion protein SEC17 "
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50927.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0005794"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG020810"
FT                   /db_xref="HOGENOM:HBG397841"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00002526A3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D68"
FT                   /transl_table=1
FT                   /translation="MSEAKDLIARAEKKAQPASGLMKWLTGGDSYRLEEASDLYVEAAN
FT                   LYRLSKELSAAGDTFWKAAECQVEAGNEDEAGNTFVEAYKCYKGANPERACEALERAIA
FT                   IFTRKGQFRRGAYFKFELAEVQETDLQDYGRARENYELAGDWYMQDQALALSNKAYIKC
FT                   ADLNALDEKYLAAAELYRKIISNSVGNRLSQWSLRDYYLKLCLCFLAASDTVAAEKTLQ
FT                   EALQEDSSFHGSREHDLLAAIIEDVKQGDVEAFSNHVFEFDKFSKLDKWKTTVLLRVKT
FT                   SITEVEDDLL"
FT   CDS_pept        693159..695549
FT                   /codon_start=1
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083015"
FT                   /locus_tag="AGOS_ABR156W"
FT                   /product="ABR156Wp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS50928.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058312"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI0001DB2842"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D67"
FT                   /transl_table=1
FT                   /translation="MADLSGTAVKREPEKGPASALDTTGDLPHIYDTVSVETPGPFETS
FT                   EKKVDKEGADTEGDSGEFTDVLVEDDSPYPEVRAAVPSFDDTTMLQNTVRMWTIGLLMT
FT                   TIGSAVNMLFSMHAPSMAVSTFVTSMLAWPLGRFWARWVPNVRIFGRFGGPFLNPGPFS
FT                   LKEHALITVMGNISFGGGAAYATDILLSMNMFYKRDYGWLFDLLAIWSTQCIGFSLAGL
FT                   CYKILITPPLMIWPSTLVQCTFLSNIHIHNNKVANGWKVSRLKFFMIIFIAGFIYYWLP
FT                   GYLFQALSSFAWVTWIAPKNVVVNQIFGSSTGLGLLPITFDWNQIAGYVGSPLVPPISA
FT                   IFTILCSMVTIFWIVVPIVHYSNTWYGNYVPISDSTSMDRFQQRYNVTKVVNQRLSLDL
FT                   EAYHSYSRLYLPTTFAISYGMSFASVMATISHTACFHWRTIYNGVRNINTQDRDVHARL
FT                   MERYKAPPYWWYLVTFFVFLALSIATVRAWDTQLPVWALFLALAIAGFFLLPVGIIYAL
FT                   TNMAVGLNVITEFIIGYMLPGRPIAMMFFKTFGYITNSQAITFAQDMKLGHYLKVAPKL
FT                   MFTAQFIATIWGSTVQIAVLRWSEANIKGLCTKAQPGHFTCPGATVFFTASIIWGVIGP
FT                   QRMFSAGQMYSSLNYFFVLGFFLPIVNWLILSKWPKRFEKSGRGLKFVAKYLSWPVFFS
FT                   GTGLIPPATPYNYGSYCIVGIFFGYFIKRYYFQWWCKYNYSLSAALDIGLAWGALIIFF
FT                   STGIAVRKAPVWWGNTVIDTLDTNGQAIKYILQEGEYFDRASP"
FT   CDS_pept        695969..699310
FT                   /codon_start=1
FT                   /gene_family="HOG000234583" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083016"
FT                   /gene_name="CPA2"
FT                   /locus_tag="ABR157W"
FT                   /product="Carbamoyl-phosphate synthase arginine-specific
FT                   large chain"
FT                   /EC_number="6.3.5.5"
FT                   /function="ATP binding"
FT                   /function="carbamoyl-phosphate synthase (glutamine-
FT                   hydrolyzing) activity"
FT                   /function="metal ion binding"
FT                   /biological_process="arginine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50929.2"
FT                   /db_xref="GO:0004088"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG025555"
FT                   /db_xref="HOGENOM:HBG405439"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001DB2843"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D66"
FT                   /transl_table=1
FT                   /translation="MSTAGISDEASASAFTTAGYCPQLIKGIDSVLIIGSGGLSIGQAG
FT                   EFDYSGSQAIKALKETGKRTILINPNIATNQTSYSLADEVYFLPVTPEFITHVIKRERP
FT                   DGILLTFGGQTGLNCGVALQRAGTLEKYGVTVLGTPISVLETTEDRELFARALKEINMP
FT                   IAESVACSTVEDAVAAANDIGYPVIVRSAYALGGLGSGFADDDLQLRQLCAQSLALSPQ
FT                   VLVEKSLKGWKEIEYEVVRDRVGNCITVCNMENFDPLGIHTGDSIVLAPSQTLSDEEFH
FT                   MLRTAAIEIIRHLGVVGECNVQYALQPDGLAFKVIEVNARLSRSSALASKATGYPLAYT
FT                   AAKIALGYTLPELPNPVTKSTVANFEPSLDYIVAKVPRWDLSKFQHVDKTIGSAMKSVG
FT                   EVMAIGRNFEEAFQKAFRQVDPSLLGFQGSDEFADLDEALQFPTDRRWLAVGEALMNRG
FT                   YSVERVHELTKIDRFFLHKCMNIVRMQKQLETLGSINRLDEVLLRKAKKLGFCDKQIAR
FT                   AISDDLSELDIRALRKSFGILPFVKRIDTMAAEVPAVTNYLYVTYNAVKDDVTFGDNGI
FT                   MVLGSGVYRIGSSVEFDWCAVNTVQALRKEGHKTIMINYNPETVSTDFDEVDRLYFEEL
FT                   SFERVMDIYEAECASGCVISMGGQQPQNIASQLYEQGANILGTSPEDIDKAEDRHKFST
FT                   ILDTLGLDQPRWSELKSLSEVKHFLDDVGYPVLVRPSYVLSGAAMSTVYNSEDLEGVFE
FT                   SAVAVSPEHPVVISKFIEGAQELDIDAVAYKGSLLVHAISEHVENAGVHSGDATLVLPP
FT                   QSLKEEEKTRLKQLAAQVAAAWNITGPFNMQIIKTAEGGHTCLKIIECNIRASRSFPFV
FT                   SKVLGVNFVEIAVKAFLGGDLVPPSCDLMARSYNYVATKCPQFSFTRLPGADPFLGVEM
FT                   ASVGEVAAFGSNALESYWVALQGLMSFCVPLPPSGILLGGDLSKEHLGRVAALLAPHGF
FT                   TLLALSEATCEYLSRYLPAESSVTVLQMPETGREVRALFEQHNVQCVVNLAARRASSPI
FT                   DPDYRIRRSAIDFAVPLFNEPQTTMLFARALSAYLPAELEMRQSDGPETPSYVLPWREY
FT                   LGFKPT"
FT   CDS_pept        699464..699676
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22059042"
FT                   /locus_tag="AGOS_ABR158WA"
FT                   /product="ABR158WAp"
FT                   /protein_id="ADJ41750.1"
FT                   /db_xref="UniParc:UPI0001DB2844"
FT                   /db_xref="UniProtKB/TrEMBL:D8FGA7"
FT                   /transl_table=1
FT                   /translation="MDEDGPYSWYLQHTPAPDARKLEDLRIWQNEQIYERSRKVYSPPL
FT                   EPLGVGCQEKRAATAQRGPAKRRRT"
FT   CDS_pept        699980..701227
FT                   /codon_start=1
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083017"
FT                   /locus_tag="ABR158W"
FT                   /orf_name="AGOS_ABR158W"
FT                   /product="ABR158Wp"
FT                   /function="GTP binding"
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /protein_id="AAS50930.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG163560"
FT                   /db_xref="HOGENOM:HBG444960"
FT                   /db_xref="HSSP:1AS3"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniParc:UPI00002526A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D65"
FT                   /transl_table=1
FT                   /translation="MGLCASKDKGSATHAEKRRQDRHGASQKVETGAKRVDYGAEVKPE
FT                   TSPSHSTSGATAGGRKRSVVSGTSQQTTAVAGPGSMGQPSASNRALKVLLLGSGESGKS
FT                   TVLQQLKILHQNGFTQEELLDFKPFIIDNIVETGKDLLNARAKFNVLLEPDCGLTENDL
FT                   QQVLEYSRPAGSTPLLPRGLAGILSRIWQLPSTKELLTGPERSSFYLMDNAGYFFKSLD
FT                   RISQPDYVPTVADVLRTRKKTSGIFDTTIEMDADLKLHIYDVGGQRSERKKWIRCFDNV
FT                   TLIIFCVSLSEYDQTLIEDKTQNRLQESLILFDSVVNSRWFTRTSVVLFLNKIDAFAEK
FT                   LQTVPLEKYFPDYTGGQDINRAAKYILWRFVQLNRANLNIYPHVTQATDTSNIRLVFAA
FT                   IKETILENTLRDSGVL"
FT   CDS_pept        complement(701563..702711)
FT                   /codon_start=1
FT                   /gene_family="HOG000141907" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764725"
FT                   /locus_tag="ABR159C"
FT                   /orf_name="AGOS_ABR159C"
FT                   /product="ABR159Cp"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="AAS50931.1"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG058244"
FT                   /db_xref="HOGENOM:HBG202257"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI00002526A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D64"
FT                   /transl_table=1
FT                   /translation="MHLMMILTLLCLFGRFGRGLAPRLGGLVGIGGVADVGGEELNSSA
FT                   LQTSETLAAEASHVTITRAGYDKLVYFSKICALTYCIKDRTLVENKTFYDGGCPADLEF
FT                   CSNLTVNPTAKRTRVELVLEAERNELGTGYVAVDHGRQVVILAFRGSSTQQDWFSDMQI
FT                   HPIAYVPASLTRYNKLVADGVIPPCVDCKVHRGFYRFAKTLNRNFLERIERIYNLYPNY
FT                   KLVVTGHSLGAALASLCGIELALRGFEPLVLTYATPRMFNHSLRDWVNALFKTEQIHFE
FT                   SVQKKELQLNKGYFRVVHTRDYIPMVPPLYVAAGLEIYIEKLHFPHELKDLHYRGMNLE
FT                   PLWHIEGDLLSPRSRFNERIEKWLHMYEHRSYFIMINTCSGF"
FT   CDS_pept        complement(703001..704953)
FT                   /codon_start=1
FT                   /gene_family="HOG000112318" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764726"
FT                   /locus_tag="ABR160C"
FT                   /orf_name="AGOS_ABR160C"
FT                   /product="ABR160Cp"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50932.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058245"
FT                   /db_xref="HOGENOM:HBG202256"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI00002526A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D63"
FT                   /transl_table=1
FT                   /translation="MDHAPSTWARITHPVYLYETNKLSLGFVVLTVLHLSVCFVLLGVS
FT                   ASDYLCPIVVTLTSQRNRPHKGILAAILLAWCNSSPDLFSSLMSWNAANNAAALSVGEV
FT                   LGACGVIICVVQGAIFMVMRSAWVNLSAAERHSIIVDLLFAMLAVCIIGYVCLMNAVSV
FT                   LDCVVMLLIYAAYIVSKISAGQRHAPPTIEVSSPANQSDQMPPELVGPYSDMNDSDSQF
FT                   FISDIDTGIKPSLLTSIDYNSLLKVLETAMPRETADTISLETMATPHTEHRPVTEPNER
FT                   VDPARQPGITRTAPPMFQPYSDNPELQLLTPQPLRSEDLFKRRIMQLKSNALYIFAPQL
FT                   ANFREKSHVSQVLSVALTPFMLLLRITIPQYSKFAQVAPGGASISLPRTTIAMAVINAV
FT                   AAPLWAVMLYMSFAESRAPVTVWLLAGLVATAMLTMTVLLYARVHRAGKFSLTPDPHTS
FT                   VADAERAAHTATYLFNGIGVCCSMLWISYLANTLIEIMTLYQRITDVSEAILGLTIFSW
FT                   GNSVSDLMSNVAMARLYHKLPGDEGTHQDTKFLAISLGACLGGVLLNTMIGVGISGLVT
FT                   MLPLKRWSITLRDQGVDSKFLVSCVAIVLQLIFLLWLFLTNARFLQSHMKTVGLAMCAW
FT                   WLAATLLNLVLEASI"
FT   CDS_pept        complement(705271..706491)
FT                   /codon_start=1
FT                   /gene_family="HOG000172419" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778678"
FT                   /locus_tag="ABR161C"
FT                   /orf_name="AGOS_ABR161C"
FT                   /product="ABR161Cp"
FT                   /function="adenosine kinase activity"
FT                   /biological_process="purine ribonucleoside salvage "
FT                   /protein_id="AAS50933.1"
FT                   /db_xref="GO:0004001"
FT                   /db_xref="GO:0006166"
FT                   /db_xref="HOGENOM:HBG018795"
FT                   /db_xref="HOGENOM:HBG314716"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI00002526A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D62"
FT                   /transl_table=1
FT                   /translation="MSSRGFGLLRGVFRARTARHLVYHVTGPRLHMGMPGDTAKFASAS
FT                   RLSAVTRTSTSGYRSVERTAKAGMSESFKLVCLGNPLLDISATVDPEYLERYSLKSNDA
FT                   ILVDAAGDDGRMKIFDEMLEFPGMRYVAGGAAQNTARGAAYVLGRDQVAYFGCVGRDQF
FT                   SEKLMSANKAAGVSTFYQEEPEISTGKCAVMITGHDRSMVTDLGAANHFKPEHLDKHWN
FT                   VVESAKMFYVGGFHLTVSPEAIVKLGKHAQENGKPFVLNFSAPFIPQFFRSALEQVLPY
FT                   TTHIIANESEAASYAESFGLDCDREDLVSIAKHVIGDSSRTVVFTHGLEPTIVVSPAGE
FT                   AAYPVHPVDKEKIVDTNGAGDAFAGGFVAALVQGRDLPTAVDMGQWLAALSIQEFGPCY
FT                   PTEKLQY"
FT   CDS_pept        706673..707488
FT                   /codon_start=1
FT                   /gene_family="HOG000247924" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931649"
FT                   /locus_tag="ABR162W"
FT                   /orf_name="AGOS_ABR162W"
FT                   /product="ABR162Wp"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50934.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG395368"
FT                   /db_xref="HOGENOM:HBG434259"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI00002526AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D61"
FT                   /transl_table=1
FT                   /translation="MRDPFLKYSLFSDHDSLLLRHSHEVLVSFLMYQFVLYPVVAPAVN
FT                   RMIFGQHYTRAAPRTRANFDIHTVSTVQAVLCVGMIWPLLRLPAALPVFGFYDEYASLV
FT                   AATMVGYFVWDVYLCTRYLAVFGPGFLGHALGSLAVLLSALTPAFQPWLGKFLIFEAST
FT                   PLVNVNWFITQLARGSTSAVVPRWLPVVNGLLLLVTFFCVRIVWGVMALIAMDYYVWRQ
FT                   WGPETPKLVGLLVPAINFFMTLLNFYWFYKMVRIAKKMVRASKHVAKVT"
FT   CDS_pept        707714..709075
FT                   /codon_start=1
FT                   /gene_family="HOG000257874" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626149"
FT                   /locus_tag="ABR163W"
FT                   /orf_name="AGOS_ABR163W"
FT                   /product="ABR163Wp"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50935.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG318805"
FT                   /db_xref="HOGENOM:HBG435738"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniParc:UPI00002526AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D60"
FT                   /transl_table=1
FT                   /translation="MKLVEGVQVLLDRGDIPWKKVIAGLNIAQFGFETYLATREYKKLN
FT                   ELSLPSELEGVIDKETMQKTQAYERAKLRYRMVRDLVFLGLNLVMIKYDWLPRMWNLGV
FT                   AVGQRMPAMLVPVSTISQSLYFLIVYLQLNWWQGLFGSYYYNFVLEEKFGFNKSTVKLW
FT                   LTDQLKVFMISSMITTPAAYALLKVIEKFSTGFVSYVSILMLFFYLVLTALQPVFTALF
FT                   NKLTPLEDGELKTSIVEISKRVNFPLDKIYLSDGSRRSAHSNAYFTGLPFFSKRIVLFD
FT                   TLVNDSTVEEVVAVMGHEIGHWKLNHISYRLLLLWATSGFTVSLFSAIYMNTSLYEAYG
FT                   FFIGNNASSDPARVVVSTVPVMIGFMLFNDLFQPAGAALQFITNWYTQYQELQADQFAK
FT                   ELGYQDALGSSLIMLARGNLHTPEGDPLYTAYHDSHPSTIRRLRALQYKPAKKQ"
FT   CDS_pept        710257..711762
FT                   /codon_start=1
FT                   /gene_family="HOG000193909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764727"
FT                   /locus_tag="ABR164W"
FT                   /orf_name="AGOS_ABR164W"
FT                   /product="ABR164Wp"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="AAS50936.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG028503"
FT                   /db_xref="HOGENOM:HBG523170"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="UniParc:UPI00002526AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D59"
FT                   /transl_table=1
FT                   /translation="MTSDLMEVDSAHTPDVYSASKDNVDKFVDLLRQVSKTTITLDSRY
FT                   VWKSLRELMSLRKELQQQTLTILITLLYPDDSAFKVPLLRVVNQNLKSSVEDAEAFRAK
FT                   YPADFYQLTADGKIDLSAELNSFMHLLVQLYLLDSGQVEALESFNLKTVIPGVLHYYNN
FT                   RSLDLINAKLWFYIARAHEILGNKFDHTIRMDMMKFLRTATLKYDNETKAMLITLILRN
FT                   FLQSGDVEIASDFISKVEFPCDQGVSSPLEARYYFYLSKINAIQLDYSSANEYVIAAIK
FT                   KAPNSPSSLGFLQQANKLHCVIQLLMGDIPELSFFHQKGMEATLTPYFHLSKAVKLGDL
FT                   KKFTATISKYKVQLLEDGNYQLCVRLRSNVIKTGIRIISLTYKKISLKDICLRLHLDSE
FT                   QTVEYMVSRAIRDGVIEAKINHEGGYIETSELLNVYATMQPQQAFDDRINFVNQLHDEC
FT                   VMAMRYPGSREKKKNVKTDDHEGEIDPDIMDLSDYGSDIEDLI"
FT   CDS_pept        711983..713902
FT                   /codon_start=1
FT                   /gene_family="HOG000113527" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778679"
FT                   /gene_name="SRB4"
FT                   /gene_synonym="MED17"
FT                   /locus_tag="ABR165W"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 17"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50937.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG189999"
FT                   /db_xref="HOGENOM:HBG203745"
FT                   /db_xref="InterPro:IPR019313"
FT                   /db_xref="UniParc:UPI00002526AD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D58"
FT                   /transl_table=1
FT                   /translation="MEPDDGHNSLNQDNGIPIVLDPNLINLRSRAASATVTTNGTTADS
FT                   SEDSGSQQSVSSAPIQQNSEEHSLVSNPYETYGRMPLQKLIPLILQMRNASSFSELTEE
FT                   DLLRDIEREEKGILTTGLDVEGDIEMGDADEESDLKPQEITDDDSNARLKPNNDSAIPQ
FT                   EEFNQMKREVLEHINLALNESSLSLEFISLLLSSVRPSVGVGSMSPFLKRSVPTASLNA
FT                   DKVELPPKNKTETLTLAVINRGWKLRSLEDSKALLKENYAKLQKSLEVEHAHWAMISQH
FT                   ISSTDVVFKMRDRQTGKRSLAVKYGYEDSGSLYKQDRGVAVLRHNMDLNKLELVPISNS
FT                   KEEVHITANSVERFMRVHIYTKIEEEDDYILSGESSIDDQSLLQPCHDDISRQIARLKF
FT                   FIFERELMYQLKKEAVSLMPYGVNFENENKVVLESPGERIEFEMVPLDDSALLSTHEPR
FT                   RVNDKRANIILILLRMLLVVIHKKQLRRGLKPATSKHKYRADGDLLLLRPVLGRIRHRN
FT                   YLQVVKRVVTECVLNIVPGSSIELLPQRSEPDTLHAREANIASLNKQIGLFDKILRMPR
FT                   SELRTSLGAKGVIDLTLKSSNYCNAIIQVIYADSAGKTVFDTVFTELKELEEFLHFIVS
FT                   EYVL"
FT   CDS_pept        complement(713950..714483)
FT                   /codon_start=1
FT                   /gene_family="HOG000247922" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764728"
FT                   /locus_tag="AGOS_ABR166C"
FT                   /product="ABR166Cp"
FT                   /protein_id="AAS50938.2"
FT                   /db_xref="HOGENOM:HBG058246"
FT                   /db_xref="InterPro:IPR018815"
FT                   /db_xref="UniParc:UPI0001DB2854"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D57"
FT                   /transl_table=1
FT                   /translation="MAVFSHVTVIYARIGFLLTLAFFSVKDVELILNHNFIIILARAMY
FT                   LPELHIPRHSAQLGMVSVLFFLLAVSDLLPLLENNLAYFDSVVPFRLLAFFVLAGVSYL
FT                   RESNLYFHNNAVFVYCFCEIIMHFMIYTAIKDDQSVVNTHRLADTTNAEDEASEDELEE
FT                   LVSSTAHSGDATSE"
FT   CDS_pept        complement(714647..716977)
FT                   /codon_start=1
FT                   /gene_family="HOG000113131" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764729"
FT                   /locus_tag="ABR167C"
FT                   /orf_name="AGOS_ABR167C"
FT                   /product="ABR167Cp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50939.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058247"
FT                   /db_xref="HOGENOM:HBG202263"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00002526AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D56"
FT                   /transl_table=1
FT                   /translation="MGKRMLQNVPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLVP
FT                   PRGFQPPMTVNDDIFRFHVRLQTLSELGLLNRSRLFFMRQLNNFMMKEGQLQRPLQRLP
FT                   YAEADGQRVYLYDLFIEVLKFYSGEPAGPGAGIRKRRRGHSETVGVPQLTMRPLDMVLS
FT                   DTGLWRALGRLFRVQTSSVLSIFTTKISKYYRFLQRQSCSDASSSFIKKLIYQDELPKS
FT                   LIHDDSSDESESDSDVEDDCVICQKRTTPTRRVVCKTCRNFFHRACVQAPQQDQNEGIW
FT                   ICNNCIVGNGYYGFKEEEHLYNRVEFKSQCAEYDAKHFPEGKPLDNIGLLEDMFWDLVH
FT                   DVENRATVKYGADIHNEGPGVVTAFPTLEWVPPHITKGTPEYDAFLQYVEHPMNLLNLP
FT                   MARGSLLPVFGRSISGMTVPWLYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPE
FT                   QSATAFNKLMKNIAPDLFEKQPDLMHQLVTLISPYDEKFEAANIACYKAVQYPGEYIIT
FT                   YPKCYHAGFNTGYNFNEAVNFTLDLWVPYGLSASEDYRLTGKRCVFDMWELMLNVLLQY
FT                   LERPQTHQEALIRRCHLELQNIFHSEMKYIQLLKGITHREDVLVGSRKLACTSASGQEH
FT                   ILKHEPTKSQPPSVRPDSSVYDDDPEQNECEIFCTKCNTICPFAFVVHYHRGYSRKRRR
FT                   HHEMSPSKWNRLASKGSVSILCLVDYVSLLESIDSEDGSLGSSTSEESTCHKFEDDELF
FT                   YIRRPNDINRILQITEKKLDSCL"
FT   CDS_pept        717291..718142
FT                   /codon_start=1
FT                   /gene_family="HOG000230247" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083018"
FT                   /locus_tag="ABR168W"
FT                   /orf_name="AGOS_ABR168W"
FT                   /product="ABR168Wp"
FT                   /function="binding"
FT                   /function="pyrroline-5-carboxylate reductase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline biosynthetic process "
FT                   /protein_id="AAS50940.1"
FT                   /db_xref="GO:0004735"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006561"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG342910"
FT                   /db_xref="HOGENOM:HBG726602"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR004455"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002526B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D55"
FT                   /transl_table=1
FT                   /translation="MGYTLTILGCGVMGQAVLSAIYNAPKADDESRAMYPSRIITCNNN
FT                   AQSAKQVTELVRGFGTSPNGIEVESTSGDNAKAVAEARVVVLGTKPYLVEEVLQDVRTQ
FT                   VADKLLISLAAGWTLDQLVDYTARVARVMTNTPAKYGYGAAAVSHSPDVTADERALVSR
FT                   LVGHLGLCVELPEKNMDAATALIGSGPAFALLMLESMMEAGVKLGIPLDVSRRCAAKVL
FT                   EGTARMAEETGSHPAALKHQVCTPGGTTIAGLCVMEDSGVRSGIVKGIEEAANVAARLG
FT                   RK"
FT   CDS_pept        719559..721076
FT                   /codon_start=1
FT                   /gene_family="HOG000009605" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764730"
FT                   /locus_tag="AGOS_ABR169W"
FT                   /product="ABR169Wp"
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="hydrogen-exporting ATPase activity,
FT                   phosphorylative mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS50941.2"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008553"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI0001DB2855"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D54"
FT                   /transl_table=1
FT                   /translation="MVLPRVYAASSRAALQAARRAAPFHGARCLATAAASEGKVRAVIG
FT                   AVVDVQFEQGNLPAILNALEINTADGKLVLEVAQHLGENTVRTIAMDGTEGLVRGERVV
FT                   DTGAPISIPVGRETLGRILNVVGDPIDERGPINSKTRMPIHADPPAYVEQSTEAEVLET
FT                   GIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGN
FT                   DLYREMRETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLF
FT                   IDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVP
FT                   ADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASVVGQEHYDVAT
FT                   KVQQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGRL
FT                   VRLKDTIASFKAVLEGKYDHLPENAFYMVGGIEDVVAKAEKLAAEAN"
FT   CDS_pept        721523..722911
FT                   /codon_start=1
FT                   /gene_family="HOG000000825" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764731"
FT                   /gene_name="CAF17"
FT                   /locus_tag="ABR170W"
FT                   /product="Putative transferase CAF17, mitochondrial "
FT                   /EC_number="2.1.-.-"
FT                   /function="transferase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS50942.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG124827"
FT                   /db_xref="HOGENOM:HBG202265"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniParc:UPI00002526B2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D53"
FT                   /transl_table=1
FT                   /translation="MRFNSSIIVRRLTKVTTSNSAHEAPQFLSCRLPGKAFISVRGPDA
FT                   VKFLNGLITAKLAPEVVKKSLTTVNPDVREVERHPSISGFDLRRGNWGIYKEGTRARGP
FT                   YISRFGTYSAFLNSKGKVLTDTVVYPAPLGLPDGAAAKYPEYLLQCDAIFVEPLEHLLQ
FT                   RHKLLQRVKIARRDDLSVWHVAIDMDAYPEWEQSFSWRSEFWKPMVSLHNQDDALRFAR
FT                   WFIAQFFAGAEGRLVGAYYDTRNVDPTKKSNIFYMVTTGDVDDIATLFSPQMVSSKTTA
FT                   VSVPYTEVRRARLRRGVLEGVSELRSEAVLPLEVNFDLYEDAVSFDKGCYVGQELTART
FT                   HATGVLRKRCAPVIVSNSASLDTLATSSRLDLYTDYVIPAASTSPSPTNSPFASQNPRP
FT                   RKKQPIGKLLCVDGTDGVALVKLIYIERSRSCGSIECYVTHPETGERVPIYIDLQNRPI
FT                   HLPE"
FT   transit_peptide 721523..721555
FT                   /gene_name="CAF17"
FT                   /locus_tag="ABR170W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D53 "
FT   mat_peptide     721556..722908
FT                   /gene_name="CAF17"
FT                   /locus_tag="ABR170W"
FT                   /product="Putative transferase CAF17, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D53 "
FT   CDS_pept        723331..724008
FT                   /codon_start=1
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778680"
FT                   /locus_tag="ABR171W"
FT                   /orf_name="AGOS_ABR171W"
FT                   /product="ABR171Wp"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS50943.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG297325"
FT                   /db_xref="HOGENOM:HBG378671"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="UniParc:UPI00002526B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D52"
FT                   /transl_table=1
FT                   /translation="MSDHEAPVEVQEDFEVVQEFVPTKLATAIPEEVQLAQQEIKLFNK
FT                   WSFEEIEVKDPSLVDYIQVRQPIFVSHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNN
FT                   GKKLKAVRIIKHTLEIINVLTDQNPLQVVVDAIINSGPREDTTRVGGGGAARRQAVDVS
FT                   PLRRVNQAIALLTIGAREASFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELERVAK
FT                   SNR"
FT   CDS_pept        724609..727143
FT                   /codon_start=1
FT                   /gene_family="HOG000141908" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764732"
FT                   /locus_tag="AGOS_ABR172W"
FT                   /product="ABR172Wp"
FT                   /function="acyltransferase activity"
FT                   /protein_id="AAS50944.2"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG266464"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniParc:UPI0001DB2856"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D51"
FT                   /transl_table=1
FT                   /translation="MVEDDSAPAMELTFAHETRLRKLPLPGLRSTASLLTAALEPFHSG
FT                   GTHDGGGADVELASYLGSLADSSGALKLQAKLEEFDKHSACYLDRLHLNIHNHVAGKEI
FT                   SQDILPRNPFLVLAEDAEIDISQEDRAGVLCYSALRFVSAVRRQQLPPDHSRGQALSMK
FT                   PYLNLFGTTRCPIFEPGEVESFDLNKPYSESDVEAETRSDLMEPATKVTSPDDRPRSEG
FT                   SDEPFNHHGISMKQYPASKHILILSKGQYYTLDVLDDDHRILYTDKDMAKVFASVLEDS
FT                   RKSYSVDRSTALGSLTSYSFRNWKYARKRLQKRFPVELEMIDSALFVIVMDESDRSDED
FT                   QSYAKRLFYGTSVIDEVTGLQVGSCTTRWYDKLQLVVTADAKACIIWDSFTCEGSAVLR
FT                   FTSEVYAESVMRLARDVNENSSAFSLWPSIETRRILDVGDNADKFLRKIEWSFLNEMNT
FT                   HIHLSETKLSDIISKHDIINYTLPFGRHIARRLNIRPDSMIQVGLQIAHYALYGKIIFA
FT                   LEPVSVRSFQNSMSAFIPIQSTKLAELCRQFISNSLDTSLKYMQFIEACRAHSELIEQA
FT                   KQGHAAEKHFNALRHLFKFRRHFGIDLDVDEIEQLSGLFDSPQLVPFFTPEMIASNCGN
FT                   AAMTMFGVTPAMRQGFGIGYILKNEQCDLTVISQYRQGKRLMFMLEWVLTEICEYWKST
FT                   RKHSEDIKISPTVDLLYGIDNALKSEKVERSERRPSAFYNGGYGLFDLKGHVESRSSVC
FT                   STPVSRSGSHLKLTELITSLSFNNVNALTTEEDKQVTGYEIAKIDQPKSSSPDTDELAT
FT                   DDKPSRKSNVINSKFVINFDRSSVGRKVNTSD"
FT   CDS_pept        complement(727263..728573)
FT                   /codon_start=1
FT                   /gene_family="HOG000178084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626150"
FT                   /locus_tag="AGOS_ABR173C"
FT                   /product="ABR173Cp"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="AAS50945.2"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG032383"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001DB2857"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D50"
FT                   /transl_table=1
FT                   /translation="MQVRKVWRSAGPDVRLLWLSVFVRLMSYGLSNQVLTLFLHEVGCS
FT                   EAQMGWFMSLTLVGDVGLSYVLTWYADRWGRRKVLVVGGVLMAASGAVFSTMRNFYVLL
FT                   AFAVAGVISPSSDEVGPFKSIEESMMAHMTPHHKRPEVYSMHALVGTLGGALGSVASGW
FT                   LVDALRGYGLATDLACYRVVFAVYTALALAKVVLMLLLSDTAERNLTEEESAGVLSRLA
FT                   ADDDSAPLLPRNTGRLAPGTVAVLLKLLVVFMLDSLGSGFMTSSWTVYYYSKVFGMSAF
FT                   ALGVLFFACRLIMAVSNIPSAKIARLFGPVKATLLVQIPSGIFSILIPFAEPHLGSSVA
FT                   LLLLFNFTTAMDVTPRQILLTNIIHPNDLTRVMGIVNIGKTSVRCVGPIFTGMLASSGR
FT                   LWVCYVISGALVILADIILGAFFYGIDGKILSKMNIY"
FT   CDS_pept        728790..731384
FT                   /codon_start=1
FT                   /gene_family="HOG000074528" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083019"
FT                   /locus_tag="AGOS_ABR174W"
FT                   /product="ABR174Wp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50946.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058249"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB2858"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D49"
FT                   /transl_table=1
FT                   /translation="MSEGMKSSSVSQDEDAGANGTEDEELSRACSPYMRRQNRKKFACV
FT                   ECRQQKSKCNAHDRAPEPCSRCAKKNVPCVLQRDFRRTYKRVRNEVIERRFRELTSSLS
FT                   NLGAEEILQRLEEEQRVISNNGNFTKEKIKRLRELGDLGLEAARAPEPPAAQTELEESG
FT                   PLTAEQLKCAAKSLGDVHLAPEEIAHVFQEYAERYHRFLPVVEISKGPEKIYALSPCLF
FT                   WVIVLIGLRREFGTIETMRKLSKLVKVVLAEISVSPIIRNSQLETSEPALNVASVYSVQ
FT                   ALLLYTYWPPLTSSLSADTSWNTIGLTMFQAIQLGLNTVQYSEGFTHANAELVREHTKT
FT                   WLYCNVVSQTIASAFGFPAFVCFDHTVMSTFNHSISTARTARMPSRLKQMAQVAHFENQ
FT                   LASTMHSNPLSPSGLLNKNEMLPLLRILDRQLDVLEMELNDSNADEFRRFSFLVSKVHL
FT                   YSYYFILAGEGSTSQIDGHSATLREAEIDSVTKHGLLKAYNAAVALLQHTNSMWERNPS
FT                   MVKYFPGVFVLSIWQSACIVAKLAQSSLCEVLDIALGEKVYQNAVSLCFNASVLKHDMA
FT                   YRSSGIMKSMWLMFSDMHDNWNHQGQPSDPLSPSSFNLAINVKSRMAVSVFFDCLYILR
FT                   RKCGMAKLRRQARRRPDDTDIATTQSAGNDRSVSMAIDSSQNPVESARRIIQTIPLDPE
FT                   PINASTATDASSCDSGSDEALLLRKILHHTSSIADGHSLRTAASGGTPIPAESTRPFSD
FT                   SRGASVQPSTHATTLHHSVFDRPGGAYRSVSSVDTTVSGILLDTSARLPEHSTDRSVPE
FT                   PYNAISDLQSSDLQPSDPATRSWGSWDEWESDLIFKDVGILMNEFAFNPEVL"
FT   CDS_pept        731729..733282
FT                   /codon_start=1
FT                   /gene_family="HOG000229292" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931650"
FT                   /locus_tag="AGOS_ABR175W"
FT                   /product="ABR175Wp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAS50947.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="UniParc:UPI0001DB2859"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D48"
FT                   /transl_table=1
FT                   /translation="MSKLSNQEPSAVIEGDMTEEYPAEVGQDDFNDDVKPKKTVTFSGV
FT                   EDLESEEERRHREFMDGGGLPEQPTNPDFTKLNPLSPEIINRQATINIGTIGHVAHGKS
FT                   TVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCEEPTCPEPDCYRSFKSDKEVSPR
FT                   CERPGCTGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEH
FT                   LAAIEIMKLKHVIILQNKVDLMREESAMEHQKSILKFIRGTIADGAPIVPISAQLKYNI
FT                   DAVNEFIVKTIPVPPRDFLASPRLIVIRSFDVNKPGAEIDDLKGGVAGGSILNGVFKLD
FT                   DEIEIRPGIVTKDEQGKIQCRPIFSSIVSLFAEHNDLKFAVPGGLIGVGTKVDPTLCRA
FT                   DRLVGQVVGAKGHLPSIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLEPNEVLMVNIGS
FT                   TATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLEPIA
FT                   "
FT   CDS_pept        complement(733446..735551)
FT                   /codon_start=1
FT                   /gene_family="HOG000248349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083020"
FT                   /locus_tag="AGOS_ABR176C"
FT                   /product="ABR176Cp"
FT                   /function="signal transducer activity"
FT                   /protein_id="AAS50948.2"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG124814"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="UniParc:UPI0001DB285A"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D47"
FT                   /transl_table=1
FT                   /translation="MLEKGSSKLHEVVSASFNRSPNNLIFTHDLKQVYSLLLICLDLKE
FT                   RPRDSSKNIFNALSKSFPYSFSVQDAVEKMKDLQLHVDLTTTSVHIKYAIKPDLAYNLL
FT                   TLFMDAKLLHTPADRTRDAPKENVLLQPTPKGTAILQHYVSRMGLKIIPPVLKSSFNSM
FT                   QLFTFERSSTSDAILHSDSFIQLLFVNAMGPEPNVWQPTNQVDKIPPLSAHLGHENIFS
FT                   FESTVVDFCRRADYSVSCYNGNKADNKYERKELREKPRESPFAHRFFTNPDSDAHIQYY
FT                   ISEKGVRLFESKMFGKKVLIDYSFTTKALWQWLMDCTDIMYPKEAISIAALFLKKGLIT
FT                   PILLPPSLNIPGKFAVSKNAYYTLSNSGWQIVRWMQGLRCSRDYYPLFGIKRKYVYELR
FT                   IDTTVISCDSSKERPKKSDGSDEVFGTKQTMRCSRHILDLRTILKDPGMRYLFRRHLER
FT                   EFCTENFDVYLEIKKFSKRMTILKKLLDFRTRKQECAVTSDSFHFSQKTCDSIDSRIIT
FT                   NIDECLAVGCHIFLTYIASGAPFQVNIDHELRTSIISLMTDPGSSLKQVFENPFSDEAE
FT                   IAQPFCISPNDYISSMEAFMTPITRQRKIIINSLKTNLDPETPSSLTNYVTGDLNDKGC
FT                   SQIPLSSSPTAFIVSNLKILKELYVLLDRVAKHIYRLMNIDSIPKFLNSDLYKEAINFI
FT                   DTRKIDC"
FT   CDS_pept        complement(736049..738310)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764733"
FT                   /gene_name="BUR1"
FT                   /locus_tag="ABR177C"
FT                   /product="Serine/threonine-protein kinase BUR1 "
FT                   /EC_number="2.7.11.22"
FT                   /EC_number="2.7.11.23"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II carboxy-terminal domain kinase
FT                   activity"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50949.1"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008353"
FT                   /db_xref="HOGENOM:HBG124977"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00002526B9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D46"
FT                   /transl_table=1
FT                   /translation="MSQEGSAKRADFKYKIGKIKHTPPVLKDVRSGLEFIELEKRDDEK
FT                   VYGVTKFLGNYKEEKKLGQGTFGEVYRGVHLATQRQVAMKKILVKTENDLFPITAQREI
FT                   TILKRLNHRNVVQLIEMVYDYPPAQNGAAYGQDSSQASASADTMKSFYMILPYMVADLS
FT                   GILHNPRVTLEMADIKNMMLQILEGINYIHCKKFMHRDIKTANILLDHKGILKIADFGL
FT                   ARNYYGAPPNLKYPGGAGTDAKYTSVVVTRWYRAPELVLGDKNYTTAVDIWGIGCVFAE
FT                   FFEKRPILQGKTDIDQGHVIFKLMGTPSDSDWQLARYLPGAELTRTSYEPTYKERFGKY
FT                   LTEKGLDLLSTLLSLDPYKRLTAMAAMQHPFFSEDPLPKLQLTLPCEESHETDIARYGQ
FT                   EMQKTVSNLPPAAPSGHAVEQSQTQQQSSRHHQSQPYQSLPPQKSSQPHPQQIPEAAPV
FT                   QQPSQQPPQEPSAHQQQYSSRGPQQHRTTPAPTSLPPKPKPAPPGARYNREAPPQNKPV
FT                   KPLTRHLGAQYQHNNYGNYYNHWQGGERYYETYNDGYPHADRYSDDTHYNGYGYRSRGY
FT                   QRYDMRREGESRYNQRPYAPQQGAAYRPNRRDTYKLVDRTGQPYPPERVPNPELHPSPA
FT                   PRPKRTLTNTTQLSSHSSAATGSTAASGSAVSNSSEPVRRSSTASLDNSESGNILQQKP
FT                   PPPVANPLEARIYGRDEVQSNHPGGRLYPRSTPDSKNSEGAAPSEASTDPTKRNIVDYY
FT                   "
FT   CDS_pept        complement(738566..740251)
FT                   /codon_start=1
FT                   /gene_family="HOG000001008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083021"
FT                   /locus_tag="ABR178C"
FT                   /orf_name="AGOS_ABR178C"
FT                   /product="ABR178Cp"
FT                   /function="DNA binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="AAS50950.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG058251"
FT                   /db_xref="HOGENOM:HBG204010"
FT                   /db_xref="InterPro:IPR016527"
FT                   /db_xref="UniParc:UPI00002526BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D45"
FT                   /transl_table=1
FT                   /translation="MGAFDNDFGPIKRCTTSAHPSNIIKSGLEEQDQNHKLKKIKLITK
FT                   EMHASQQEEDELTSAQKSILHRLPLQVAPNSSGQSSTVCGATAADPQAFEELKTMLLRK
FT                   LNNRLPPEESGLPEFVRSASNEVERILVQSVIQKESHSAILVSPRSWYKTSIINHHLAR
FT                   LRRQHDQQFVTVRLNGLIHTENAAINSIATQLENELRRVRKDVPATDFQLSQGSLTEVF
FT                   ENILKLLNTVAVQMGRSSSVLPRSAKLTVIFIFDEIDQFAGPIRQTLLYNLFDMVEHAR
FT                   VPVCIVGCTTKLNILEFLEKRVKSRFSQRLIFVPQITSYQSFCKEVIRILSIGRPGPYT
FT                   HAWDKKVKSELEDEQTELSCLVKGNYETFRDLALLKNAFVSMVGAADSFDSLLCSLVNC
FT                   NTLKLYNKLQLSNSLVNRVRALGELELVILLSAARVALKNEENVNFNLMYEEYSKLVKG
FT                   LNSRIPASSSLSDTGISIEHAVRIWNKKDIKSIWETLIELELLVERGIIAIRQSAQAAF
FT                   QATNHYSANSVMPYDLKMFQVPITLHELRRVVSKSSMFYSWTQL"
FT   CDS_pept        complement(740584..741789)
FT                   /codon_start=1
FT                   /gene_family="HOG000248309" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626151"
FT                   /locus_tag="AGOS_ABR179C"
FT                   /product="ABR179Cp"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="AAS50951.2"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058252"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001DB285B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D44"
FT                   /transl_table=1
FT                   /translation="MAPPKKNAIKMDLTSFLNDDSFGDSWADDQVDLNNINLPIQNVAA
FT                   SNTIPLEQLGSAAMGKGGHLDSALGSKRERVEYPVPNAPPYRARISNLPWDVSEEGVHA
FT                   WTEDMLERPGCVEKVIAPKDQDSDRLKGWAFVTFRERDDLVKSLTLNATKLNDRTVYVA
FT                   VAAPKDGVFDESNWNGARGANFQASGEDPVDLDWGAVRGSNYHPSERKPRREDPDLDWT
FT                   TSRGSNFRPSEHKPAQQESDVPWSVAKGYNFQSSERKVRHEEPDIDWTVARGSNYQSRE
FT                   RKPRSDEPDLDWGAAKGSHYQAAKSRPKRNGHELNLGAARSAKAAPQVARKSTTPALKE
FT                   DTPRIQKSSYDILNVESDSEHDAETSGQNSQPDDDVAHLEKAAQNLTLEEDGEWEVVGK
FT                   KQ"
FT   CDS_pept        742677..750467
FT                   /codon_start=1
FT                   /gene_family="HOG000112620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764734"
FT                   /locus_tag="AGOS_ABR180W"
FT                   /product="ABR180Wp"
FT                   /protein_id="AAS50952.2"
FT                   /db_xref="HOGENOM:HBG058253"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019439"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniParc:UPI0001DB285C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D43"
FT                   /transl_table=1
FT                   /translation="MLEYTELYSFLPYVLLTVSLIIVLDLALWYKAGIWIGGFNPFLLK
FT                   LSGITVRDRLYVGQVRYHLLRRAVFVGDLKFTSGERVRRGIQRDGSQKIQLRVPESGLL
FT                   WLEGVLRFFRTLSVTIENSEIEDISVRWMSLDVKYMGDRLAFSVSLQNIKHNKVCLLKS
FT                   GALEVLGCFTKDSPFGLTCVELSVKFLQLTVPVSNLLALFTLGKEEDEDVEGFARNIFD
FT                   GMTEDPQLNAQNCVEMMRSRVTTLHSYFSHLTKVDFFVDKVNLADIPPSLLPELSSACE
FT                   PLKYEVALSSFTFQVTRFSTEQPGYSILFKKSDRPVRVRITLSSLQCALKLNAPKNPSE
FT                   KASEYIRFFDVPSIILYGDTNIFSERFLTGSTAVSDTIVKLVGHVSSPTIDIEIEKLSI
FT                   LKSLYANIMVLTSMFNKMRSASGKELPTATSRLNALEKKTILSYLTQIIPSVESKITVE
FT                   DPVIIINDGEDFIFQKCSILSFQTITHKCNLARRRSNAQLGYNFDVNFEILDFDTSHHS
FT                   KNIGYVNQILKLDSINMKLVSQLIPTLLMSLHFTVDLLKCDLSDLKTLVFLNRIIRKLN
FT                   SQMLNVEEEYFLQIYQQFASQLEELGKREENTNVIPIDRKLFQHLPSYLDSINLEITDF
FT                   SLLVGSRSVFLPEDKYVSMLQQSTYDFVNGELRKLHCTFGSAQLVLNNTGRRAMEKGDR
FT                   TNAGNFESTNGEGFSYDDSGLEAHTTDFGTSDPELWSLSFQCKQVLGTVFSETKRNSDC
FT                   LVSKTVFKLPTASALFHPQLEAEKLVLELKIDKSEVLVSLMTLFLVFSALQTFKQVFSK
FT                   EITAHRRFTYAEKYQEYVASTRRKFRPKFDKARLLKLLEFHLEFKHLDMVTVLPNGVKC
FT                   RFEICTSQSSFADANDISIYGHYFRMCVESPLMNQKWFRMLAIVDFNARLDIRSWKIRR
FT                   NWDEFKAMEPAVIIENQSCHWQIPHRFEMHRIFDNISTMFKTIKQMVYSLKTCKHSVVV
FT                   FPTVTAAPELPKITMRSKRLIFSVEDDPFETDLAMIFQIGMQEQRSRLEKYHVFDEWLN
FT                   TKLQANGNRNARDSDFNERPITPSSATFAQQFASKGIHHPTNDVLEHSTIESVLSQHEY
FT                   DICLDRYNKLQENISASWIRRVQMCHRKEKKVFKDGFTFLWGKTDSLKLPSTIDKGVID
FT                   FVPSPNLMTIIAEGVNIDIFRPSCGLDNTADFIYSVGKGVPKDTRYTLMLPFYIDAKLD
FT                   ELRWHLKDYPLPLVHMPKLLPSQQGSFPAIHLYGDLFITEDMIQSTKELRTIFVPLVPS
FT                   VTSSEIDLYYSLRFRRSLTPIKIYSQVTMDIHSKDITMVTWGGSYEAAIQQAMNCLDNF
FT                   SKPPVDPSKKIGFWDKIRNMFHAKINIRWPSEGLFEVSLKGLKDPYAIGGKSAGFVIGL
FT                   RGNAELKINADNDPKKFLACSADDIYFAIPNYFAKPLLVWCNSSENAVFIPSQNDTNLQ
FT                   RSAAYYYFIDLMPVPNAKMEREIMYRRYIEKSAIKLSGGIIFNIGIVFERLLPGSKDRT
FT                   FTSLAHYKVRLCDPEHVADPGHDSYRGFRSEFIHLSFTLQSNNSNAYNTMQLTPGVFSV
FT                   FFSWWSSFSANLPVRRGSLFGVLTKSPKFGDHIHSISYRADIAPFFICHTYQNTDTETY
FT                   TSEAFDGTLEFVGLKAKMDKFVMDLHQRKEVLHERNKGLDVIKRVMRSKFKEGDVSTFN
FT                   IDIRTMDAVFKPMAYDGGLNTPEYNIFDGDMTWYDPLDFKEFKYHALDNYVPIVTIGPL
FT                   LYAPKFVYRKKASYGDKYQVDFNTCERVKPFDNSISHTCCLKPQIEVPLETVEERKDFL
FT                   LKKRREAQRLLEVATTTNERQHILSELDKLDAVLSKVVELIEAIKNIQNDERADSHNEK
FT                   TTDEGFKYSIRDFVDRSTGSVSPFENKFFVFCMQLKWDEDARDVIFKYLHLLELSSQAV
FT                   TLTRSKTLQVIERLCHRKLAYTKSDESIFSSISDIPIDGHDLSTAETSSEEQPKSQSLF
FT                   ELFEEKIYSLNTDAPYMTHDDHFIQFVAPQIQLSTKESPGTCVLVTAPSMKLKIIDFDS
FT                   NTSDNEYNENVFMTRYTAALIQANVFIFQESDYKVFENSLFNPKGYGAKSTESWQPWLG
FT                   LELCFEPEPLQTNTVIKEFSSVFKYDRVSSFANVSDLLSDAISMDSVICYLPRFVLASD
FT                   SKQYIALYNIIANVFVYVEPNSARLKKQVNQLLLGYDPSNLTEYIKIVEKIQRMLVALD
FT                   VIEEELSFKKYLLDDVGEADLHAIRKSKVESFAKLSIFMKVLTSSNVDEVTEDKKMMFI
FT                   MKAEEVILHMLKENGEPFLDAALANSYFHRIQSSAGSNSNKIVINMLQVFNLEQDVKFH
FT                   NLLGPLDKRATVNEKPLIYLEWDMDRPVGGIKVVKNVWTELQGLEFRAEQDTIDNLIRW
FT                   TMPEMLQELLNNNDDIYGDNDSHASSNSTSSAAVVRDNMFSWALSPIKNPLKLKNSNEL
FT                   HEMVQRSSDYMIIENMVLNSFPLVISYRGHGARRIINVTDFMFTFPKLQFINQTITVGE
FT                   VLNAIRRVVIKSLLKHTGQFITNKLRKRPHQKQLYIDTTTSSQDDDQKSGQVHTPLKQI
FT                   QRYKSYTDVNELRQ"
FT   CDS_pept        750835..754347
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764735"
FT                   /locus_tag="ABR181W"
FT                   /orf_name="AGOS_ABR181W"
FT                   /product="ABR181Wp"
FT                   /protein_id="AAS50953.1"
FT                   /db_xref="HOGENOM:HBG058254"
FT                   /db_xref="InterPro:IPR018846"
FT                   /db_xref="UniParc:UPI00002526BD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D42"
FT                   /transl_table=1
FT                   /translation="MDEYELFNVNRAGSTASVFSTTSSVTYEFKLGNALEAAAQRCIVP
FT                   MRINKTAGKLEVLDELADRSVINKTFAPRERVMPHNPDTLDDPDIEQLLLTGGAQPTYK
FT                   EVPVNGEIINTTLVVLKSSISIAGSANYFRLHGQVTDCKTIRHDKPEFIDDTLLITTAD
FT                   NILYSVVFNDNLEPQIVHWWALAKPTKALTWKIIIHPEKDRFMLYEKETSAVKFFKLQN
FT                   SCPYYVELVRNMHMLNTKILACSYLFSKSEVIVFISGLKASRIYYYLVTWPIDSVGIPE
FT                   VHQFVVPDGKVLEDIIPLNNNYCLAISKKTVDLFSVHQLLTSESHGIPLILEKSFGTIT
FT                   HFEYDVQILSRLQQLDPGKYLPLTRAVIFSTSIYLLGLILADDRGTINFYGLTRFKGLK
FT                   GFTLVPSQPQSAKAYKLQIISFGKVFEITLDLSGIAILDDRAYVESMSNILRRHTKDTS
FT                   FAYAEELISFRDKTPAISGTIQEELWSCSSSVLSNISTNGHVAHFKNILYLREFLRFNS
FT                   IWTIGLDAVAEEVYTRLCGDDRRYKGYLVIGSDGATITRAFVLYFSSEEDMECDEVDGI
FT                   LSDLAGATIYYFVTNNYLVQVTKRQLLLSSVIDERDRWNHDLPFVANGALSLGPTVVFW
FT                   AGTQISYIENVELMGRSHAIATFDIGNSLRSQEALSHLDLNGLLADELFHIEKVLLDEP
FT                   SAEWTIKINCLFLVYKFMASDSEPTLVRLHLESASAIISDTLLIDRHTILCSDATVITP
FT                   SHNYENAPRAVNTHKIKGYYSFEPFGERGILCYSASEIFLYDLEHKQEIKLPGWKKNNS
FT                   IIQVCANQRHVLVLFSDGLGVYENSYQSYTGSNIVLSSTHCAKRFIYISSINRLLIVTC
FT                   KKKSVECMKLESRKQCRLETHAIFADVDEILDVKQLGQVTADASPSSPDITLAFSCRLR
FT                   CSRTSYIVKVVLLIPAPGRLTLRLLTATEFPELACAGEIRTGTGNTFWVATETGLVQYS
FT                   LQDMPDSPQLVLLRMFPMPLLRQFDTAATFAAALTTDGRLHLLLPDGSVCAQDPRNTAR
FT                   HDTLRMRTDGSVLAYTEPLAHGAGAAAAALVLYYRDSTDPTRLCPTTRLALSKTVTSIH
FT                   LISDVRAYLLHSDGTVAPVDIEPSSSGPCVASPSPASPLHLASAPPPPTNNIGIWDIEY
FT                   RPVL"
FT   CDS_pept        754738..755367
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083022"
FT                   /locus_tag="ABR182W"
FT                   /orf_name="AGOS_ABR182W"
FT                   /product="ABR182Wp"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS50954.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:1A2B"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00002526BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D41"
FT                   /transl_table=1
FT                   /translation="MAYQTGGNIRKKLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFE
FT                   NYVADVDIDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKW
FT                   VSEVLHFCQGVPILLVGCKVDLRNDPQVLQQLQAEGQRPVTAAEGSAVAGKIGAVAYLE
FT                   CSARTGQGVKEVFDTATRAALSGKPAASAGKKKVHGDKKKKKCLVL"
FT   CDS_pept        756135..756758
FT                   /codon_start=1
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764736"
FT                   /gene_name="RHO1"
FT                   /locus_tag="ABR183W"
FT                   /product="GTP-binding protein RHO1 "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS50955.1"
FT                   /db_xref="EMBL:AAG41249.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI000006AED8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF54"
FT                   /transl_table=1
FT                   /translation="MSQQMHNPSIRRKLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVF
FT                   DNYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEK
FT                   WISEVLYFCQGVPIILVGCKADLRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYI
FT                   ECSAKTGFGVREVFEAATRASLMGKQGKSKAKSDKKKKKKCVVL"
FT   mat_peptide     756135..756746
FT                   /gene_name="RHO1"
FT                   /locus_tag="ABR183W"
FT                   /product="GTP-binding protein RHO1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF54 "
FT   pro_peptide     756747..756755
FT                   /gene_name="RHO1"
FT                   /locus_tag="ABR183W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF54 "
FT   CDS_pept        complement(757250..757594)
FT                   /codon_start=1
FT                   /gene_family="HOG000039864" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764737"
FT                   /gene_name="MRP2"
FT                   /locus_tag="ABR184C"
FT                   /product="40S ribosomal protein MRP2, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrion"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS50956.1"
FT                   /db_xref="EMBL:AAG41250.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG393379"
FT                   /db_xref="HOGENOM:HBG742589"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI000013522D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HF53"
FT                   /transl_table=1
FT                   /translation="MGFRFPVKTKLPPGFINARVLKDSFKRQQAADHEVTVTALKYIAR
FT                   NTALPTRARMEAQLQLAVMPNYTRMTQVRNRCIATGHARSVITDFRLCRTQFREKAKNG
FT                   ELPGVKKGVW"
FT   tRNA            757926..757997
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        760204..761130
FT                   /codon_start=1
FT                   /gene_family="HOG000078427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778681"
FT                   /locus_tag="ABR186W"
FT                   /orf_name="AGOS_ABR186W"
FT                   /product="ABR186Wp"
FT                   /function="3-methyl-2-oxobutanoate hydroxymethyltransferase
FT                   activity"
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50958.1"
FT                   /db_xref="GO:0003864"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="HOGENOM:HBG287245"
FT                   /db_xref="HOGENOM:HBG299908"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI00002526C0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D37"
FT                   /transl_table=1
FT                   /translation="MLASRPIKAMALRRMYSIHSSSKQKTIPDIFKKYHAKEPISMITA
FT                   YDYITATWAHAAHTDMILVGDSLAMSTLGHVSTVDLDLQEFQYHVRSVCRAPGSSFIIA
FT                   DMPYGSFERSIEQGVETAISLMKTSSRVGAVKLEVGAEENDYCLELAAELCRRGIPVMG
FT                   HVGLTPQRMHALGGYKVQGAKDLGQALAAYHRAKDLQAAGCFSIVIECIPTKLAGIITE
FT                   KLSIPTIGIGAGPQTSGQVLVQSDLLGMLPGKAPKFVQKYADFHGDAIGSLCSYVEDVR
FT                   QGVFPKVGQHTFTVSEELLEEFSKQVD"
FT   CDS_pept        complement(761183..762544)
FT                   /codon_start=1
FT                   /gene_family="HOG000246526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083023"
FT                   /locus_tag="ABR187C"
FT                   /orf_name="AGOS_ABR187C"
FT                   /product="ABR187Cp"
FT                   /protein_id="AAS50959.1"
FT                   /db_xref="HOGENOM:HBG058256"
FT                   /db_xref="HOGENOM:HBG395518"
FT                   /db_xref="UniParc:UPI00002526C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D36"
FT                   /transl_table=1
FT                   /translation="MRKLFRHIQNVHFCGNPFGRFCSSIRGASTPRQEKCRNRRMGIPV
FT                   AKALLGLATPYTAYALYISLQSNREITARENKLQDKESMDFADTLIKYSQLEILGRFEN
FT                   PFTEYRIQTVYEFFFNRLVEVFERNRGGIPVQQSAMDDLMPVHKPSWTNGENMECEVKF
FT                   SYEVLGPDQAPAQRQAQQLPPLHVTWLGQSCSYIVYRSVKILTDPLMSDYLLHNKLGPK
FT                   RITKMPAQPEEVPVPDVILVSHNHPDHLDEVSMKKWGSGSSAALWIVPKGLGEYVERHG
FT                   VERYVELSWWETCRLKFQGTGELPSSLDVVCTPAMHWSGRTLFDANRSLWASFLIRDKD
FT                   MPVLFHAGDTGYVADLFLRIKERFGAGVKLALLPCGQYCPEWHQKPRHISPSEVLMIMK
FT                   DMEAKSVLGVHWGTFVLSGEYFREPKEKLEILAEFEGVRDNCYCPELGKTITIY"
FT   CDS_pept        762763..764163
FT                   /codon_start=1
FT                   /gene_family="HOG000175573" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083024"
FT                   /locus_tag="AGOS_ABR188W"
FT                   /product="ABR188Wp"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="Elongator holoenzyme complex "
FT                   /protein_id="AAS50960.2"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0033588"
FT                   /db_xref="HOGENOM:HBG058259"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniParc:UPI0001DB2869"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D35"
FT                   /transl_table=1
FT                   /translation="MSFRKRSEIISGSRTVPNRGFTPIRGAPVRSDEVTGLRAVTSRGR
FT                   DMGTARAGQIDTSNVSRLSRGVEKLGIHSEVAGQSHPGLRPSPATSHPTTSTGCADMDR
FT                   LLGHMGLPMGQMLLVEEQGGTDFASVLGKLFAAQGAAHNRAESRGAQRGGNTHVVVITL
FT                   NTQYAKELPGIFQGTRKEVKKSRISQEESKVTVQNLAGGGAKPVARSQDLRIAWRYGLG
FT                   DNCGASQRSEPEIDPHPHYRHQFDITSRMLPAPTATEVSTLSPQQPIATLLRQLELKLE
FT                   AQPSQLFRIVIPAFLHPAMYAPSAVQLHEAITLLHGVRSLVKKHREHCVLLATISRDLF
FT                   SQRGSLFMSQIEAVFDAAICLEPFNQEMQQFLERAYKSQPNKVQHGLVHVLKLPVISDR
FT                   GEMHVIRSEWAFKNGRKNFAIEEWGIPVEETEQEKDDNQLVGTASSTRDIGSSSCAGGK
FT                   VAISSHDF"
FT   CDS_pept        764358..765587
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20626152"
FT                   /gene_name="ATG21"
FT                   /locus_tag="ABR189W"
FT                   /product="Autophagy-related protein 21 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="AAS50961.2"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058622"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0001DB286A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D34"
FT                   /transl_table=1
FT                   /translation="MKVLRFNQDASCFSAVSRPHSMTIYNCDPFGKCFELENSVVTSES
FT                   CDTECLTKAQGDQCSNFVTEMLFATSLIAVVNRDQGLQKARKLRIVNTKRKTTICELTF
FT                   PHEVVDIVMNRKRMCVLLSSDQIFIYDISCMKLLQTISVLEDKLKMAVSDQGHVSTSVV
FT                   GRQLQGETSMVRIALCSDDKSILCYTAYCRTNKNSYILNDLVVYDALNMTPLNYLNTVH
FT                   KGNVACLCISNDGKMVATASDKGTIVRIFSTGDENTLQSGNTLLHEFRRGTRPCSIYEM
FT                   KIDPTRRYLACVGHTDTIHIFDLERQGQQNKSLSDSQSTALLREGKLSKESTLQFASFL
FT                   SKKVISKIPNQNMERHFAHIKVDDSVRHCLGFPDEFSDRVYVASNNGEFQVWNIPQSGG
FT                   ECILVKKSKF"
FT   CDS_pept        complement(765679..766158)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083025"
FT                   /gene_name="AIM43"
FT                   /gene_synonym="FMP14"
FT                   /locus_tag="ABR190C"
FT                   /product="Altered inheritance of mitochondria protein 43,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS50962.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG058260"
FT                   /db_xref="UniParc:UPI0001DB286B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D33"
FT                   /transl_table=1
FT                   /translation="MIRYALLRSGRRTLQTRPSPQTLEELARLKSLEDVDSSVIRKLIN
FT                   QRTEEVNAQNEAQMLKKLSAEGRDLQNVPGSRYARPLWLLLIGCASVYLVRDWLRMKAE
FT                   YDARETTLETRVEGLEAELKYLLEPKPGVLEVEVVQTEVASSAPWYKRWLWSGSR"
FT   mat_peptide     complement(765682..766104)
FT                   /gene_name="AIM43"
FT                   /locus_tag="ABR190C"
FT                   /product="Altered inheritance of mitochondria protein 43,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D33 "
FT   transit_peptide complement(766105..766158)
FT                   /gene_name="AIM43"
FT                   /locus_tag="ABR190C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D33 "
FT   CDS_pept        complement(766283..766621)
FT                   /codon_start=1
FT                   /gene_family="HOG000184556" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778682"
FT                   /locus_tag="ABR191C"
FT                   /orf_name="AGOS_ABR191C"
FT                   /product="ABR191Cp"
FT                   /protein_id="AAS50963.1"
FT                   /db_xref="HOGENOM:HBG113405"
FT                   /db_xref="HOGENOM:HBG395519"
FT                   /db_xref="InterPro:IPR018450"
FT                   /db_xref="UniParc:UPI00002526C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D32"
FT                   /transl_table=1
FT                   /translation="MPPVPASSYAHQQPSNWEKFKMGLMMGTTVGICTGILFGGFSILT
FT                   QGPGPNGVIRSLGQYIAVSSATFGLFMSIGSVIRSDSQLLHPASQLQQEARMHAWKLRA
FT                   QYGLYRRD"
FT   CDS_pept        766801..768186
FT                   /codon_start=1
FT                   /gene_family="HOG000242790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18083026"
FT                   /locus_tag="AGOS_ABR192W"
FT                   /product="ABR192Wp"
FT                   /function="ATP binding"
FT                   /function="tyrosine-tRNA ligase activity"
FT                   /biological_process="tyrosyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS50964.2"
FT                   /db_xref="GO:0004831"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006437"
FT                   /db_xref="HOGENOM:HBG249606"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0001DB286C"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D31"
FT                   /transl_table=1
FT                   /translation="MSCFMRTMRPWLHGGTRQRWFSTGSGTVLDELRARGLVQQISEPV
FT                   DALVQQLREGKRPRLYCGADPTASSLHLGNLMPLMVLLHCYVRGHDVVALIGGATGMVG
FT                   DPSGRSTERTALADATRLENVRRISGQFKRFFENGREYHGSRVAPAQSGHAVVVNNVEW
FT                   WKDMGLLDFLARYGRHIRVQNMLGRDSVSARLSSGSGMGFNEFSYQILQAYDFYHLHTH
FT                   HGVAIQVGGGDQWGNITAGIDLIGRLSPGAAANPAFGVTVPLLLTASGAKFGKSAGNAV
FT                   FVDPVITPSYQLYQFFVNTSDADVARFLRLFTMLPLSAIDEAVAAHTVAPQRRLAQRLL
FT                   AREVVDLLHGLGHGKDAETVSDVLFGGARVDLPAGELLRLFTDAGILREAPRSASLVDL
FT                   MCLATGSSRAEARRKLVQGAVYLGPDRSRPAQDIADLSPHMIEDRVLLLRIGKQQCYVF
FT                   HIQ"
FT   CDS_pept        complement(768226..768441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764739"
FT                   /gene_name="ERI1"
FT                   /locus_tag="ABR192C-A"
FT                   /product="Phosphatidylinositol N-
FT                   acetylglucosaminyltransferase ERI1 subunit "
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50965.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058261"
FT                   /db_xref="UniParc:UPI00002526C7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D30"
FT                   /transl_table=1
FT                   /translation="MNDKVAATLVLVVTYSIVGASLWCLTYAWHDETKLYYWCIVQLLP
FT                   VMLWVWCVISWCGAQLFGYAKRGKAD"
FT   CDS_pept        768570..769622
FT                   /codon_start=1
FT                   /gene_family="HOG000183313" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778683"
FT                   /gene_name="PNG1"
FT                   /locus_tag="ABR193W"
FT                   /product="Peptide-N(4)-(N-acetyl-beta-
FT                   glucosaminyl)asparagine amidase "
FT                   /EC_number="3.5.1.52"
FT                   /function="damaged DNA binding"
FT                   /function="metal ion binding"
FT                   /function="peptide-N4-(N-acetyl-beta-
FT                   glucosaminyl)asparagine amidase activity"
FT                   /biological_process="nucleotide-excision repair "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50966.1"
FT                   /db_xref="GO:0000224"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG191057"
FT                   /db_xref="HOGENOM:HBG396333"
FT                   /db_xref="HSSP:1X3Z"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="UniParc:UPI00002526C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D29"
FT                   /transl_table=1
FT                   /translation="MRVSEDTSTKEVFERVAADFLQLYKRCVLAQTREVRSSDRERCEE
FT                   LVRRNALARELCKLHQTLCFVYENDALYGIVLDALDLEGIYGRVEEGPGADDYQDRLVQ
FT                   ELLRYFKDEFFTWCDKPLCARCGTAKKQAAVGHGKPTVEEARYRCTVVELFRCEDCGDV
FT                   ARFPRYNDPLKLLETRTGRCGEWCNLFMLILRSFGIEARYTWNREDHVWCEVYSNALKR
FT                   WVHVDSCEKSFDEPHIYSVNWNKAMSYVIAFSNRSVKDVSRRYIVRNRLPRDQIDEDDL
FT                   QFLTKYLTKLLRLQLPDEERYLLHCRDELEAIDLLGSKTAPMEIPPAAGAAGRQSGSAD
FT                   WKRQRGEDGR"
FT   CDS_pept        complement(769690..771042)
FT                   /codon_start=1
FT                   /gene_family="HOG000248589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931651"
FT                   /locus_tag="ABR194C"
FT                   /orf_name="AGOS_ABR194C"
FT                   /product="ABR194Cp"
FT                   /function="carboxylesterase activity"
FT                   /protein_id="AAS50967.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG058437"
FT                   /db_xref="HOGENOM:HBG395376"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="UniParc:UPI00002526C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D28"
FT                   /transl_table=1
FT                   /translation="MGLPTFAPRSWGYRGTITHRPHEEGLVKLPLKDKEKEPVTLSDLL
FT                   NEHVPELKDGARFYLHPYLYNGILQTMYLYGADFSQQYKPFYGREIVSYSDGGVSTADW
FT                   AMREWDDLYAAPEGYNKEKFDADAAKTHPENWPRLQPNTRFLDEEELAKIPKDTRPLIV
FT                   VAHGLAGGSHENIIRALVTELLSVGNGQFNVVVLNSRGCARSKIANKKLFSAFHTMDIR
FT                   EFINREHARQPERKIYGLGFSFGSVIFGNYLGEEGDKSPLSGAVCCAGPWDMFASSKML
FT                   NDDFWISRLFGKNLVKHLSRLLHVNRKELEYDGSKGDDVEDASPTNPASHIFTKENLAR
FT                   ASTMACTRDFDNFFTAPALGFKNANDYYKAASPVNIVGKIRVPTLLINALDDPMVGAEG
FT                   FLPIEKLRSNKHILLCTTDIGGHLAYLDKNYTPWMAGRVAEFLSKMDTLVA"
FT   CDS_pept        complement(771315..773741)
FT                   /codon_start=1
FT                   /gene_family="HOG000177197" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764740"
FT                   /locus_tag="AGOS_ABR195C"
FT                   /product="ABR195Cp"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="AAS50968.2"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG055750"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="UniParc:UPI0001DB286D"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D27"
FT                   /transl_table=1
FT                   /translation="MSEDKRNGKDAPWELSYGRDGAGFNGDDLDKFLEHGSKAARRASN
FT                   EQLVSSHLSQWNYNQNRGALMQGIEEASELVSDLVRENDERPMHVPDNDLQILQVSLRL
FT                   DGNWKDDLTLDKEALAQIFKTRATSALEHLAKLLVRVQDTSSKVFITGDLNAGKSTLCN
FT                   ALLRKRLLPEDQLPCTNVFCEILEARENENVEQVHAIPVSIAATVKEAYDAYNILDQTT
FT                   YQVFPLEKLNSLVHKNTEYSLLKIYIRDDQRPAESSLLRNGTADIALIDSPGLNMDSVQ
FT                   TTEVMSRQEEIDLVIFVVNAENQLTLSGKEFISTASKEKKLMFFVVNKFDHIKDKQRCK
FT                   KLILDQIKEISPETYKQSTEFVHFISSEGVFIDDSNGNPDGSDPDDNDNDNENRHEPDP
FT                   DFDGLENSLRNFVLKKRSLSKLLPAKTYLMKLLYDIEKISLWNVHVYKEEENQLTSELE
FT                   ELAPVINGTRTHCSKLTEAVDRKTDELVNDVYDFTKRRILSSLEVTHSDFPRYDGLSNI
FT                   HDYIFRARQYIIDQIKSSVVSSELYARNSTQQVVNEINELAKNELGNDFMSDRVFQSDL
FT                   MFSRKKHSLGKKLSVPFNVQDLWAPSWDGFLSYVTCGFQVWNSGVSTEPVKSHELTDRL
FT                   GLSTYSINKYWTSPSLLLTSRIPALAVYSYGGVKLVTNLLLYGTRFFSWQSLRKISTSL
FT                   LLVGSALGAAYIISDLPRALPINLSNNYRKKLHDLDYIHANADRISKEVREVLKIPTRE
FT                   VVKSCELVLDKKQEQKRKLEVKMQNNALSVDFFHRLAQRASVHRGMVEEINLEVD"
FT   CDS_pept        complement(774011..774745)
FT                   /codon_start=1
FT                   /gene_family="HOG000248588" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931652"
FT                   /gene_name="SEC62"
FT                   /locus_tag="ABR196C"
FT                   /product="Translocation protein SEC62 "
FT                   /function="protein transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="AAS50969.2"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0030176"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058262"
FT                   /db_xref="HOGENOM:HBG395377"
FT                   /db_xref="InterPro:IPR004728"
FT                   /db_xref="InterPro:IPR011553"
FT                   /db_xref="UniParc:UPI000042B797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D26"
FT                   /transl_table=1
FT                   /translation="MSDPESPLWVATLLRHHKELKQRQGMFQSRHMEFFRFKRFVRALN
FT                   SDEYRAKSEREPEKYPPVRSEEDARDVFVSLIKAQLVLPCTKLHTAQCREHGLAPSKDY
FT                   PHLLLSTKATLDADEYYVWTHNPKTLTDYLTVVGVIVGILAFVCYPLWPHSMKRVVYYL
FT                   SLGLLGLLAVFSALALVRFVIYVLSLAFCSERGGFWIFPNLFEDCGVIASFKPLYGFGE
FT                   TECYGYIKKQKRRKRKLEKKKQ"
FT   CDS_pept        775206..776612
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764741"
FT                   /locus_tag="AGOS_ABR197W"
FT                   /product="ABR197Wp"
FT                   /protein_id="AAS50970.2"
FT                   /db_xref="HOGENOM:HBG058264"
FT                   /db_xref="UniParc:UPI0001DB286E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D25"
FT                   /transl_table=1
FT                   /translation="MGSPTRYAPHLSEFYSIVNQDAQDGRQAALPQDDTGHEQALGLNK
FT                   QANRSDVRRSMSLAESADSFAQLRRPSSIRSTTTSITDLQTLITKKDMVQTHDAMTQLV
FT                   REMSEYALSLVSNATKASSVAFALENMAHLKGCNDGSADKFLNASGVFHLLSNHDRIIA
FT                   NLVTETLAPSLRDRIGAFGASFKTSELSFKKRLKEETFKLKLQEGYNIKLSKRKNRNLF
FT                   SYRENLMNMQQQLDSIEALKHDYYQESYDLVEAFCQEVLKDIATLTRAQVEISENLARK
FT                   GWSGGGLDDLIVSADDPFSKNRSEEEESYQETQDSLEGYTGGVDSPEPHRSATPVTGGT
FT                   GAGSNKNEDTIRSASMGTNDRISDRHASPVPSTGTITVAHSSPTDINYVGFHRNHSDAS
FT                   VMVDYSFSLPLAGSKNHIHEIKSSSGTQQNYTSEADSPRSPVPDNTSEDILEAVSAASN
FT                   LNIRHVGNDD"
FT   CDS_pept        complement(776840..777886)
FT                   /codon_start=1
FT                   /gene_family="HOG000236849" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764742"
FT                   /locus_tag="ABR198C"
FT                   /orf_name="AGOS_ABR198C"
FT                   /product="ABR198Cp"
FT                   /function="ferrous iron binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /protein_id="AAS50971.1"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0008198"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG058265"
FT                   /db_xref="HOGENOM:HBG397651"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniParc:UPI00002526CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D24"
FT                   /transl_table=1
FT                   /translation="MAYRGWVPGSDSMRSDSLHSLFSTVKPRMPVFFISHGAPTFMYPD
FT                   EKFCADPGAYRATQNLGKYIREVIKPNFILVVSAHWQSNKPGTVKIAIPTALRLWQQQG
FT                   SVPFQDGESDVTKGHPLENELIYDFYGFSTRMYEEEFHSKSSMALATDIADTINHVRSP
FT                   LCAVLTERGIDHGVWVPLKVAFSASKCVDDDWDVPVPLVQISLAAGNDLRDQYALGRLL
FT                   SRYRDLGGLIITSGMAVHNLRDLFCGSAIAKSHSRSSAFHWALSNVLLTTPPNACKFGR
FT                   LLRLFSSAEGRELLQAAHPTLEHFLPIIVGLGAGEGLDGPDKYTIRELYQNDAPSLGWS
FT                   IYQYGTYS"
FT   CDS_pept        complement(778197..778781)
FT                   /codon_start=1
FT                   /gene_family="HOG000248470" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764743"
FT                   /gene_name="COX20"
FT                   /locus_tag="ABR199C"
FT                   /product="Cytochrome c oxidase protein 20, mitochondrial "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS50972.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG191640"
FT                   /db_xref="HOGENOM:HBG203219"
FT                   /db_xref="InterPro:IPR016529"
FT                   /db_xref="InterPro:IPR022533"
FT                   /db_xref="UniParc:UPI00002526CE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D23"
FT                   /transl_table=1
FT                   /translation="MAWWPFSRNNKPGVPEQDQVAAAPVQQRPAEPLPTNYTPGQRLLL
FT                   EDTRPRFDTQSSASQQAVQRERATLADAWKTVRWEDFSLERMAGIPCFRDAGMAGFSAM
FT                   VVAGSVTFLFHKNPVRAANWGVGGLLLGSIVGWEQCRMQRRRSFQVAEMARQTVAAKEA
FT                   PMLRKPDNAQKAGAVSQASELPPKKPWYRFW"
FT   CDS_pept        779297..780910
FT                   /codon_start=1
FT                   /gene_family="HOG000033781" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626153"
FT                   /locus_tag="ABR200W"
FT                   /orf_name="AGOS_ABR200W"
FT                   /product="ABR200Wp"
FT                   /function="binding"
FT                   /protein_id="AAS50973.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123672"
FT                   /db_xref="HOGENOM:HBG203205"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00002526CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D22"
FT                   /transl_table=1
FT                   /translation="MAMGREQLYDGHINMYPHTEQQSKRKSVVFNGKGEVVNDGGYAPY
FT                   PVEEMPVRMGTGFLPPQRPALESRTGSMDSGVLKPSIYLQPGQHKSSPGLPTENRPTTW
FT                   YASPTKSSLDGGSPSSTASRERAHKARNRPLPEFSKDALYFYKIFEKTISDSGTFTPSV
FT                   QMKWCETLLEYAFKPDFIAHYSINAEKLKRELTPEEQQKNKTTLLEHALKVLSKLMRMK
FT                   YAPALYLMGTLYSQQPYLRVDHDGIVSKNDQKALEYYKSAAKLKNADGCYRAGVSYEYN
FT                   RGMPANISRRDRLLTAVSFYEKGAACADASSGQSSSMYKLGMFQLNGLVDDDTGEIIVE
FT                   QDVISAIRWFERAAAHDKTVSPQALYELAKIYEFDCLHPQLQQAVKLQHVPQDTLKALD
FT                   LYIRCAIKFNYPLAQWKLGHCYEYAELHLPYSPEKSIVWYLKAANAAPKGNAMAMLALS
FT                   GWYLTGVKGVLEPNASESYKWAYKASIASEGRLPKAEYALGFYTEHAVGCHPDMHRAMD
FT                   HYRRAAELGHQKAVERLSNI"
FT   CDS_pept        join(781235..781493,781534..781724,781775..781861)
FT                   /codon_start=1
FT                   /gene_family="HOG000272647" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764744"
FT                   /gene_name="CGI121"
FT                   /locus_tag="ABR201W"
FT                   /product="Protein CGI121"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50974.2"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191460"
FT                   /db_xref="HOGENOM:HBG283673"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="UniParc:UPI0001DB286F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D21"
FT                   /transl_table=1
FT                   /translation="MLTTTIPQFPDTKLYISLFRNVSNAPEIVDSLAELPYSIIDARTL
FT                   LSREQLLSAVYRAMLEKHCNKLRTRNLHTEVLLCLSPTSNVMSQIGDAMKRFGIKKDST
FT                   SVVLVKAVTGDETFDPKGFSEVIRGEELEFSDTALRESADIDTIRENYKLKCFECERLE
FT                   ELSAALVHAIQLRGL"
FT   CDS_pept        complement(781847..782803)
FT                   /codon_start=1
FT                   /gene_family="HOG000189680" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764745"
FT                   /gene_name="TFB3"
FT                   /locus_tag="ABR202C"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   3"
FT                   /function="zinc ion binding"
FT                   /biological_process="cell cycle"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS50975.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058266"
FT                   /db_xref="HOGENOM:HBG397495"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="InterPro:IPR016390"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI00002526D1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D20"
FT                   /transl_table=1
FT                   /translation="MDDDEKKDMCPICKTDRYLSPDMKFLVNPECYHKICESCVDRIFS
FT                   LGPAQCPYEGCDKILRKNKFKTQIFADVDVEREVDIRKRVFNVFNKTIEDFDGDTAAYD
FT                   QYLEEVEDIVYGLDNGIDVAKNEEKLRTYEELNKQLILANMERNKQTLENFEQRQKFEK
FT                   EIKLKKRQLEKQIEDEERANREWVKWEIVNQLTTSEDAEQVIENVKKTVKLKKSSARRK
FT                   LEELNKVLRNNPYMTISNGRMKKQEHVPFTPFNGDRDRHKRYVIDEESYHDPVVKELQT
FT                   KKEYIASGFRAEYVYNRVLTEAFMGLGCIIQDELQPS"
FT   CDS_pept        782954..784033
FT                   /codon_start=1
FT                   /gene_family="HOG000001066" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764746"
FT                   /gene_name="PFA5"
FT                   /locus_tag="ABR203W"
FT                   /product="Palmitoyltransferase PFA5 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50976.2"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058267"
FT                   /db_xref="HOGENOM:HBG203305"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI0001DB2870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D19"
FT                   /transl_table=1
FT                   /translation="MWQCKNKSRWWYSLVPILCICIMCYGAIAYSYSFCYVEVWTHLGM
FT                   KAAAIGMTCLHLIIVILLWIIWAQIIMMGPGRQPRVAPFMILPEMADAGERAKEGAATS
FT                   VLPPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYR
FT                   LFNQFLMCFLMHALIIFVSVVSLQRRIASSARMRGEREDPNVLVVLSLSCLVLLMVGAL
FT                   FISFLNYMANNQTTIEKLYTPKRQPRTMCFCVYNPADQYRYVVKSLPHENWNMWDKGSA
FT                   YANYKDFLGSSIWRWFIPIGSNIPEFQTSAWEDDYNAILGPYKEELGSHYRDILMQRIE
FT                   QGKYVTRLRVYGDKFREGL"
FT   CDS_pept        complement(784184..786499)
FT                   /codon_start=1
FT                   /gene_family="HOG000092200" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764747"
FT                   /locus_tag="ABR204C"
FT                   /orf_name="AGOS_ABR204C"
FT                   /product="ABR204Cp"
FT                   /function="AMP deaminase activity"
FT                   /biological_process="purine base metabolic process "
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="AAS50977.1"
FT                   /db_xref="GO:0003876"
FT                   /db_xref="GO:0006144"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="HOGENOM:HBG176050"
FT                   /db_xref="HOGENOM:HBG713563"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006329"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR016297"
FT                   /db_xref="UniParc:UPI00002526D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D18"
FT                   /transl_table=1
FT                   /translation="MMEGQGYEKECLAPHLESPVDGNPRDMHKHSAGSTEDEDISRRSS
FT                   PEYDGVEVHSVNTNFSYHEEKLMLEHSTKMNALEQGLAPHITQSPQPSRFQAEGGAAER
FT                   RLSASAQASLPEPPSMKFLGKSHAPEDDQTSYKMGQVAGDLPQYFGAPSQELVELYTKV
FT                   QECRNLRARYQGLSMQRHGQNPKNRQEWEIYPPPPKPSYNSETKTVLKVTNQPDCEVFD
FT                   FTQCEIPGEDTEWEFTANSDDVFAVHRATEDGEPQLIADVPSLRDYYVDLEKLVAISSD
FT                   GPAKSFAFRRLQYLEARWNLYSLLNEYQETAISKKNPHRDFYNVRKVDTHVHHSACMNQ
FT                   KHLLRFIKYKLRTAANEEVIFRDGKVLTLSEVFQSLKLTGYDLSIDTLDMHAHKDTFHR
FT                   FDKFNLKYNPIGESRLREIFLKTDNYIKGSYLAAITKQVISDLENSKYQNCEYRISIYG
FT                   RSIDEWDKLAAWVIDNKILSHNVRWLIQVPRLYDIYKKTGTVKTFNDILVNLFQPLFEV
FT                   TKNPQSHPKLHIFLQRVIGFDSVDDESKIDRRFHRKFPKSSLWESSQNPPYSYYLYYLY
FT                   SNMSYLNQWRSRRGFNTLVLRPHCGEAGDPEHLISAYLLSQGISHGILLRKLPFVQYLY
FT                   YLDQIGIAMSPLSNNALFLTYDKNPFPYYFRRGLNVSLSTDDPLQFSYTREPLIEEYSV
FT                   AAQIYKLSNVDMCELARNSVLQSGWEAQIKRHWIGKDFEKAGIDGNDVEKTNVPNIRIN
FT                   YRYETLSTELELVEHYAK"
FT   CDS_pept        complement(786648..787451)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764748"
FT                   /locus_tag="AGOS_ABR205C"
FT                   /product="ABR205Cp"
FT                   /protein_id="AAS50978.2"
FT                   /db_xref="HOGENOM:HBG058268"
FT                   /db_xref="InterPro:IPR018557"
FT                   /db_xref="UniParc:UPI0001DB2871"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D17"
FT                   /transl_table=1
FT                   /translation="MTTRYMDLLSEQQGQLDENYRNAMGVLDALETLAAPEQHKEEQVA
FT                   ALHALKAQSEPLLRSLVMLRVNNVNCVEAYATRAKIGPASDVAKSKLHASAGDNSAGNV
FT                   LGLVARVRELQMTWLQHLQLVNQLSVELAYPLGRRGSEHVTVNREGPPPELVAALAAYD
FT                   AGPDAPAAAELRAELLRYLDDIKATRARYLLENKYLLADSLRQLTRDVSSWSQKWESLE
FT                   GTLFGDAPSSLRSLLRSVDTTKATITQKVAAPDPAAPSSSTIQPT"
FT   CDS_pept        787639..789483
FT                   /codon_start=1
FT                   /gene_family="HOG000115852" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764749"
FT                   /locus_tag="AGOS_ABR206W"
FT                   /product="ABR206Wp"
FT                   /function="binding"
FT                   /biological_process="regulation of mitotic
FT                   metaphase/anaphase transition"
FT                   /cellular_component="anaphase-promoting complex "
FT                   /protein_id="AAS50979.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005680"
FT                   /db_xref="GO:0030071"
FT                   /db_xref="HOGENOM:HBG176189"
FT                   /db_xref="HOGENOM:HBG323794"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0000EA236E"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D16"
FT                   /transl_table=1
FT                   /translation="MEPLIEIRSRLRKSSQDLLQLKLYQSARWSSEALIGMCEGGVEDT
FT                   TADEGSPLRNRRGKGDTGIQVSMDSEPFGERQYDLFLLASSLFDCKEYDRCAYFLRNEK
FT                   HPRLKFLRLYSRFMSWDKKTQESSSDVLTKPADIAQKDPGVGTNVVDWIDERNVDTRKE
FT                   ANIQSQMVVDLGTGEKISITLILRELELYLVEQLANSKEPADVGYALLYYLRGILEKKQ
FT                   GLASEAIKSFVRSLELYPYNWTCWCELATCITRTDESLLLVKHLRDLFPANGERGDNAV
FT                   MLRFFKISIFKDFGGDFDHFMDELDYLMGLFPNFSFLKSELALLNYHYMDYVNAELIFD
FT                   EIVKLDPYRLDDLDIYSNILYVIQKPHKLAYLSQFAADLDAYRPETCCIIANYFSAKQQ
FT                   HEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDINPCDFKAWYGL
FT                   GQAYEVLDRHLYALYYLQKACSLKPLDKRMWQALANCYDKLDRPNQAIKCFQRASQLSN
FT                   DQDITILYYLATLYERVQDAISCKNYMLKCIEVESANQGIILDECAKARLWLARHEVKH
FT                   RNFPAAYNYASGVTHGTSQEIEAARVIARECRKRMEYQ"
FT   CDS_pept        789754..796962
FT                   /codon_start=1
FT                   /gene_family="HOG000184103" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764750"
FT                   /locus_tag="AGOS_ABR207W"
FT                   /product="ABR207Wp"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS50980.2"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="HOGENOM:HBG023411"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="UniParc:UPI0001DB2872"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D15"
FT                   /transl_table=1
FT                   /translation="MSGLPPPPPPPPGFRRNNKSGASSGDAPPPPPPPPPGMHRTYSGY
FT                   PSVPPPPPPPPPPPMSLEEGPPQKKNKVEPMHQIFAELPSRELLTRKKEWLALQKQRFS
FT                   GQRRKGKEKKKRGGVSHAQKVDLPPEHLRQIISDHSDMSSRRFNYDKRAFLGALKYLPH
FT                   AVLKLLENMPQPWEQTKEVKVLYHNTGAITFVNEIPRVIEPVYIAQWSTMWIAMRREKR
FT                   DRKHFKRMRFPPFDDEEPPLSYPDHVEEIEPLDAIALDLDEDEDKYVKDWLYRTRPLEN
FT                   SVGMVNGPSYKSWRLNNKVMSNLHRLSAPLLTDVTDNNYYYLFDKKAFFTAKALNNAIP
FT                   GGPKFEPLYPHEEEEDYNEFNSIDRIIFRIPIRTEYRIAFPHLYNPRPRSVEISWYHDP
FT                   VSCLLPEDDDDAMPAFHFSSQFSPIINQGFKHAKTDYEMSASKHEFSLPADFAPLLDSE
FT                   ELEPEGTKDSISLYHAPYPFNRRSGRMVRAQDVALIKKWYLQHPDSEYPIKVRVSYQKL
FT                   LKNYVLNELHTQRPSKQKKVKLLKSLKNTKYFQQTTIDWVEAGLQICRQGFNMLNLLIH
FT                   RKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGNSFHLMREILKVVKLLVDAHVQYRLGN
FT                   VDSFQLADGIYYILNHLGQLTGIYRYKYRVMHQIRACKDLKHVVYYRFNKIIGKGPGCG
FT                   FWQPAWRVWIFFMRGIIPLLERWLGNLLSRQFEGRSTEIVKTTTKQRVDAYYDLELRAS
FT                   VMNDILDMIPEGMKKSKAHTILQHLSEAWRCWKANIPWDVPGMPLPIKNIIERYVKAKA
FT                   DGWVSSAHFNRERIKSGVHVEKVVVKKNLGRLTRLWIKNEQERQQQIEKNGPEVTPAEA
FT                   TAVFSCMVDWLESRNFTPIPFPPLTYKNDTKILVLALENLKDAYTAKVRLNASEREELA
FT                   LIEEAYDNPHDTLNRIKKYLLTQRIFNSVELSMLDHYQYITPVYTVDPLEKITDAYLDQ
FT                   YLWYEADKRQLFPNWVKPSDSEIAPLLVYKWCQGINNLKEVWDVSRSQSTVMLQTSLEN
FT                   LAEKMDFTLVNRLLRLVMDPNLADYITAKNNVSITFKDMSHVNKYGLIRGLQFASFVYQ
FT                   YYGLMMDLLILGPERAHELAGPPDAPNEFLQFKNLQTETKNPIRLYSRYLDKVHILFHF
FT                   EENEAEELIEDYLSENPDPNFESAVGYNNKKCWPRDSRMRLIRQDVNLGRAVFWEIENR
FT                   VPPSFADILWENTLSSVYSKNNPNLLFTMCGFEVRILPRFRMEEVMSSSEGVWDLVDVV
FT                   TKERTAKAYLKVSDTEISNFESNIRGIMLSSGSTTFTKIASKWNTALIGLFTYFREAIV
FT                   STDRLLDILVKCETRVQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPAS
FT                   DLSWSKQTDTGITHFRAGLTHEDEKLIPTIFRYITTWENEFLDSQRVWADYLAKRKEAM
FT                   QENRRLAFEELEGSWERGIPRISTLFQKDRHTLAYDKGHRIRKEFKQYSLERFNSFWWT
FT                   NGRHDGKLWNLNAYRADVIQALGGIETILEHTLFKGTGFSSWEGLFWEKASGFEDSLQF
FT                   KKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLI
FT                   QIFRAHLWQKIHESIVFDICQILDGEMDVLQIESVNKEAIHPRKSYKMNSSAADVTLSS
FT                   VYKWELSKPTLLHQTNDTFDFTSSSKMWIDVQLRYGDYDSHDISRYVRAKFLDYTTDNV
FT                   SMYPSPTGIMVGIDLAYNMYDAYGYWFDGMKPLLQNSMKTIMKANPSLYVLRERIRKGL
FT                   QIYQSQTQEPFLNSSNYAELFSDETKFFVDDTNVYRVTVHRTYEGNVATKPINGCVFIL
FT                   NPKTGQLYLKIIHTSVWAGQKRLSQLAKWKTAEEMTALVKSLPKEEQPKQIIVTRKAMM
FT                   DPLEVHMLDFPNISIRPTELRLPFSAVLSIEKLNDVVMKATEPQMVLFNIFDDWLERVS
FT                   PFTAFSRLILLLRALKANEEKAQMIIKADPTIPFKSHHLWPSFTDQQWIEVELKMRDLI
FT                   LSEYAKKYNVDISVLTQSEIKDIILGQNIRAPSVKRQQMAEIEGSAATGANAETPSVAN
FT                   AMKVTSVNAQGEEITVVTSANYETQAFSSKNEWRKRAVASSLLYLRLKNIYVSSEDFIE
FT                   EKSIIVLPRNLLKKFVGIADVKIQIAGFLYGQSPPEHPNIKEIRKIVLCPQLGSNQTVQ
FT                   LSNLPGQSEYLEDLELLGWINTFAQDKKYMLPADITTHVRTFGRANTEVINLTVGLIPG
FT                   AISLSAFTVTKEGLDWGMENKDIFDPSPEGFDPSFSEHAQLLLSERIMGNFLVPKSGIW
FT                   NYAFMGAGFNRELRYELSLDIPLGFYDEQHRATHFLQFNEVAADDTLEAEQEDLFS"
FT   CDS_pept        797119..798474
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764751"
FT                   /locus_tag="ABR208W"
FT                   /orf_name="AGOS_ABR208W"
FT                   /product="ABR208Wp"
FT                   /protein_id="AAS50981.1"
FT                   /db_xref="HOGENOM:HBG058270"
FT                   /db_xref="UniParc:UPI00002526D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D14"
FT                   /transl_table=1
FT                   /translation="MILFIGDDFSLYNAHYRRPSMQHQAEADGNVEPRQAGLNSSTYGT
FT                   SQDMCFEHQSDVSAKIAVKMEALMRSVEEKKRIIDARQEKLLQAHDYVLDLLRLGYTFT
FT                   QIKNEGAIHEEFLTELFELLNIPITEKYTPDPHAVPENAAVRPCMARTFSNCDLSVADG
FT                   TFATDHREVPVKDDLKNPDQNDTGTASTQQLQDNEDYASLSSDVSKSSQSLCTSMRSQS
FT                   ASDSMMNSLTNQFREPQNSPVSSDRAAFELHRVLTKFQIDLRCVKILASGETSMPSAEL
FT                   RQRIGMRYQDILLQLDGILDQLGILASPGGKAGTRAQVTPAANILLKDVEKVNPAPAVP
FT                   ARSIVGKSKKTLHGAISHQGTANRSPQSHIRLPDKEEPRQDLIEDSFVRIKKHKPQMFT
FT                   PYQSLLSSYTQFIPVPFATGTEDMLCPVETLNGGCEDPKCPYTHFQGLTAKD"
FT   CDS_pept        798762..800267
FT                   /codon_start=1
FT                   /gene_family="HOG000025142" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764752"
FT                   /locus_tag="ABR209W"
FT                   /orf_name="AGOS_ABR209W"
FT                   /product="ABR209Wp"
FT                   /function="anthranilate synthase activity"
FT                   /biological_process="tryptophan biosynthetic process "
FT                   /protein_id="AAS50982.1"
FT                   /db_xref="GO:0000162"
FT                   /db_xref="GO:0004049"
FT                   /db_xref="HOGENOM:HBG448785"
FT                   /db_xref="HOGENOM:HBG507440"
FT                   /db_xref="HSSP:1K0E"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniParc:UPI00002526D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D13"
FT                   /transl_table=1
FT                   /translation="MTVTIEPGLEALERCIADNGPDVTLYPLYTYVSAEETTPHAAYLK
FT                   LARLDQNDHVPSFLLESAKTMDAMARFSYMGVAPRRVLRTNAGAGDPLKLLAAEFARLR
FT                   PARNTPQLPGLSGGAVGYVSYDCVRYFEPRTARELADPLELPEAALMLFDTVVAYDHVF
FT                   HRFQVVHNMQLEPGIDLNAAYEDATRAIRDVVDRLTASTPVPQPPQPPIRRGQEFSSNV
FT                   GQQGYEEYVRRLKEHIYAGDIIQAVPSQRVARPTSLHPFNIYRQLRMVNPSPYMFYLDY
FT                   GDFQVVGASPELLCKVDEERQVVTHPIAGTIRRGVTQQEDDALAAELRNSVKDRAEHVM
FT                   LVDLARNDINRVCDPLTTRVDKLMTVQRFSHVQHLVSEVTGTLRPDKDRFDAFRSVFPA
FT                   GTVSGAPKVRAMELIGELEGERRGVYAGAVGHWSYDGVSMDTCIALRTMVYKGGVAYLQ
FT                   AGGGIVHDSDPYDEYVETMNKMLANHNTILQAEELWAEKIGSE"
FT   CDS_pept        800416..801042
FT                   /codon_start=1
FT                   /gene_family="HOG000227349" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764753"
FT                   /locus_tag="ABR210W"
FT                   /orf_name="AGOS_ABR210W"
FT                   /product="ABR210Wp"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="AAS50983.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG496327"
FT                   /db_xref="HOGENOM:HBG526257"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="UniParc:UPI00002526D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D12"
FT                   /transl_table=1
FT                   /translation="MAGINLPFILSVTMASLATGYYLGQIYGGATHACLSELNAQAVLK
FT                   QVKDRAESASRDAEELDSTYEDDSDEEVVEVSSLPLNDIPGEVRMALVIRQDLGMTKGK
FT                   IAAQCCHAALACYRLMAEDVTRVSYNRDMVMRWLQRGQAKITLKCPDKETMDELFAKAM
FT                   ALGVNCHVVHDAGRTQIAAGSATVLGLGPAPKAVLDEITGELKLY"
FT   CDS_pept        complement(801108..802277)
FT                   /codon_start=1
FT                   /gene_family="HOG000159961" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764754"
FT                   /locus_tag="ABR211C"
FT                   /orf_name="AGOS_ABR211C"
FT                   /product="ABR211Cp"
FT                   /protein_id="AAS50984.1"
FT                   /db_xref="HOGENOM:HBG055918"
FT                   /db_xref="HOGENOM:HBG717153"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR012989"
FT                   /db_xref="UniParc:UPI00002526DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D11"
FT                   /transl_table=1
FT                   /translation="MSDEQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQRP
FT                   GSVEGQRNSYSDPNSSQEPRSSSPQLPSQASAKSGGSSGRSKKEKPWFRTFSQIMKESQ
FT                   EEDDDDEARHTFAGGETSGLEVTDPNDSNSLIRDLLEKARKGGERGDNGQGRSVAAHNF
FT                   FKGRGYRLGSSAEAEPEVVTQPEEPERPRKVTREITFWKEGFQVGEDGPLYRYDDPANS
FT                   YYLNELNQGRAPLRLLNVEFGQEVDVNVYKKLDESYKPPKKKHGGFGGSGRRLGSPIPG
FT                   DIARAEEAVEQESSATSPAPEAKQESPKPAEQQGNTSVQIRYANGKREVLRCNSFDKVG
FT                   FLYDHVKQNTSEARPFTLNQVCPVQPLEDFECTIGEQNLCNSVVVQRWV"
FT   CDS_pept        complement(802640..804946)
FT                   /codon_start=1
FT                   /gene_family="HOG000246221" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764755"
FT                   /locus_tag="AGOS_ABR212C"
FT                   /product="ABR212Cp"
FT                   /function="5-methyltetrahydropteroyltriglutamate-
FT                   homocysteine S-methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="methionine biosynthetic process "
FT                   /protein_id="AAS50985.2"
FT                   /db_xref="GO:0003871"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="HOGENOM:HBG515813"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="UniParc:UPI0001DB26CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D10"
FT                   /transl_table=1
FT                   /translation="MVLSSVLGFPRIGANRELKKVTESYWAGKATEEELLKVGRELRAS
FT                   NWKLQKEAGVDVIASNDFSYYDQVLDLSLLFNVVPDRYRKHDLSAVDTMFAMGRGLQRL
FT                   AKDGAPAVDVTALEMVKWFDSNYHYVRPTFSHSTDFKLNGNKPVEEYLEAKQLGIETRP
FT                   VVLGPVSFLYLGKSDKDSLDLEPLSLLPKVLPLYAELLKQLSDAGAKSVQLDEPVLVLD
FT                   LAEDVQSAFKTAYEHLGAEKSLDIVLTTYFGTVVPNLKALVDLPVAGLHFDLVRNPEQL
FT                   DDVLAIVGENQSLSVGVVDGRNIWKNDFAKSAATISKAIEKLGGDRVIVATSSSLLHTP
FT                   VDLENESALEPEIKDWFSFATQKLHEVVVLAKNASGEDFSSELKANADSIAARAASAIT
FT                   NDPAVQERVAGLNEKLSTRAAPFGERLKEQQPIFKLPLFPTTTIGSFPQTKDIRINRNK
FT                   HAKGAISTEEYTNFINSQIEEVIRFQEEVGLDVLVHGEPERNDMVQYFGEKIKGYVFTV
FT                   NGWVQSYGSRYVRPPIIVGDLSRPLPMSVRESVYAQSITTKPVKGMLTGPVTCLRWSFP
FT                   RDDIDQRTQALQLAFALRDEVNDLEAAGIKVIQVDEPAIREGLPLRAGEERSAYLNWAA
FT                   QAFRVATSGVSNKTQIHSHFCYSDLDPKHIKALDADVVSIEFSKKDDPNYIAEFQDYPN
FT                   HIGLGLFDIHSPRVPSKEEFIQKIDAILKSYPADKFWVNPDCGLKTRGWEETKASLTNM
FT                   VEAAKHFRNIHTKKD"
FT   CDS_pept        805915..806253
FT                   /codon_start=1
FT                   /gene_family="HOG000000842" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931653"
FT                   /locus_tag="ABR213W"
FT                   /orf_name="AGOS_ABR213W"
FT                   /product="ABR213Wp"
FT                   /protein_id="AAS50986.1"
FT                   /db_xref="HOGENOM:HBG058271"
FT                   /db_xref="HOGENOM:HBG203679"
FT                   /db_xref="InterPro:IPR020366"
FT                   /db_xref="UniParc:UPI00002526DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D09"
FT                   /transl_table=1
FT                   /translation="MTLDQEYTKLVSRRDELQKQEVTLRREFTTLVRKIASITAVLETI
FT                   ESPQVIERNLPSDEVLQKAPGLQPLIEMLVTLDETPLAEIEIPEKLMHSYELFRNTPLL
FT                   YKDNPGHL"
FT   CDS_pept        complement(806271..810317)
FT                   /codon_start=1
FT                   /gene_family="HOG000141815" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764756"
FT                   /locus_tag="AGOS_ABR214C"
FT                   /product="ABR214Cp"
FT                   /function="binding"
FT                   /protein_id="AAS50987.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058272"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB26CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D08"
FT                   /transl_table=1
FT                   /translation="MYGSALQMKSRSSGSRKRQNVVLSTSFVSTRRMQADEGAVTVPSS
FT                   PLHTRQRNNTLGSLRQEVRTLESELERLQSQRQEVEKAREATSTEIYQGTYTRDHLQRH
FT                   SQRLQANTQLRDIGKNIKRLEEQLSQVKAKIDAILSLVNKLPEEPAEGEKADERTTGIG
FT                   VPLGASVSASNSSSAGRLSTPVAYHDAENVYYTDFADDYIQYSYFTDDEGDRTVDNTFQ
FT                   DFGSELEGDSDTRSDQHNSLQPDKKAKEIATATWLFSDYLQSLQDSNASREFILTKANS
FT                   LVALLSKNPEIKHDMVFSAFSNTINSLLMSPDKLVTSAGYRICRYLITDNKFIENLMLL
FT                   RIDVFLVISLTKDNRHDMEREQAIKLVREFITYDAGINQAIVQVIISCVEKTDDKLRMV
FT                   CIETLLELALVKPAIVKKCGGFRVLESLLTDSRLQVSLLVLETFLSMMDLQATRCYVVE
FT                   YCNVSSILSALSDWQSKSSLNVERLQNSMCMMARLFKNYNGLIILSRNEFRPLKELISF
FT                   LQAPVVARYVLDLLLDVLLIKPLPYNEKKGTSSRLITSQFPNSPAANQYVALVVRMLGE
FT                   ANLVDALVSILLNTRYNDNLNHPKRNVLFSKTRHALAEYLSLAVNINSWNPDYVSKIHQ
FT                   SLSSIKFTEAFLIERINSKLNKHRTTLGIPNLNMQKTIINFSKAVTRATLLTDVDELVF
FT                   KKMVFDTRVLQTKDFSQWNWDVLSDLCEGPLCNPRRLEELSRTTKFIRRLLVFYRPFRY
FT                   RFSTVYSKANNAKQYVKVGCQFFNTLLQHYEGIKVLLDDSKIIPQLASTLYKAMEGHIL
FT                   PSKLFSSWALQNTLCGSYFKFLGLLMKSKEGINILEKWNMFTVIYKMFQPSPLAEEYLL
FT                   LMLPELDLSHSIHCRIIFSKALVDSREVIRINATRVLGEMISSVKLSDPTLEEFMLNLL
FT                   VAQLYDLSSEVVAVADQILYHYCLSQSITLALKPAIAASLNQLVFIGSPILFELMASSA
FT                   GFKLLNNISYIEKERLLWLERKNREYVHIVEEFLEKELRNGASSDNSIHTNLPLHFYHS
FT                   LARSEEGINMIQKNGDFLAFTSSIKRALQEMPKTLDEYSILKSNIWCCGYIGSTELGIK
FT                   LLDKHNVIGDLVELAMTDENPTARFTAFYALGLISKTEEGCELLDELGWDCCIDVRRQP
FT                   VGICVPNNITTFLSYPQESVEKTTVSEGIDQFDHGISEEDFPPLEVSQYKLIQYSEKVE
FT                   RDVLTDNQELKSILEHRARQVNAQRRIDSTPLQFQDDPVSAKIFRLVGKLGNHILTNSA
FT                   IKELTELESRHGASKFETQEMFNAVFNLMAQYRFKPSVRKFLCDVFINKRALENIARRE
FT                   RRRRK"
FT   CDS_pept        join(complement(810816..811059),complement(810464..810759))
FT                   /codon_start=1
FT                   /gene_family="HOG000066101" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778684"
FT                   /locus_tag="AGOS_ABR215C"
FT                   /product="ABR215Cp"
FT                   /protein_id="AAS50988.2"
FT                   /db_xref="HOGENOM:HBG189726"
FT                   /db_xref="UniParc:UPI0001DB26CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D07"
FT                   /transl_table=1
FT                   /translation="MSLAIIPFITIGWLRCTRKSRDTMSSSPEPQAPMHVTQRQISVFS
FT                   DEFRQRRRQQMLRFFGATAFTLLSARLAFRGTINRKYVPNMFQLNHRVPLASSQGEALH
FT                   AFAYGSGLATGGFAMLILGTCWLADVSTVPEFSLRIKALLGESDTQSGRLESAHQDKET
FT                   RELAAMLDSLLQEKKD"
FT   CDS_pept        join(811170..811203,811256..811539)
FT                   /codon_start=1
FT                   /gene_family="HOG000212591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764757"
FT                   /locus_tag="ABR216W"
FT                   /orf_name="AGOS_ABR216W"
FT                   /product="ABR216Wp"
FT                   /protein_id="AAS50989.1"
FT                   /db_xref="HOGENOM:HBG124215"
FT                   /db_xref="HOGENOM:HBG397763"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniParc:UPI00002526DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D06"
FT                   /transl_table=1
FT                   /translation="MHPQLEAQRFHSCLDLVQALEKCHQADFYKQAFGLCNPEKEALTQ
FT                   CLHNARLEGEKYHILANREKRKEMDAKWKQMQEEEYGEDALLKILLQRQLERKQSGKTA
FT                   E"
FT   CDS_pept        join(complement(812358..812382),complement(811607..812199))
FT                   /codon_start=1
FT                   /gene_family="HOG000090523" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931654"
FT                   /locus_tag="AGOS_ABR217C"
FT                   /product="ABR217Cp"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="AAS50990.2"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG434372"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniParc:UPI0001DB26D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D05"
FT                   /transl_table=1
FT                   /translation="MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNRFEKIFN
FT                   FGHVFLGLTGLATDVTTLYETFRYKTNMYKMQEDRPIEPNTFSQLVSSTLYERRFGPYF
FT                   VGPVVAGIHSKTKKPYIAGFDLIGCIEESKDFIVSGTASDQLFGMCESLYEPNLESEDL
FT                   FETISQALLNAADRDALSGWGAVVYLIEKDRVVKRYLKTRQD"
FT   CDS_pept        complement(812627..814750)
FT                   /codon_start=1
FT                   /gene_family="HOG000144423" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931655"
FT                   /gene_name="YEL1"
FT                   /locus_tag="ABR218C"
FT                   /product="Guanine-nucleotide exchange factor YEL1 "
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="cellular bud neck"
FT                   /cellular_component="cellular bud tip"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="AAS50991.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0005934"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG058273"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI00002526E1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D04"
FT                   /transl_table=1
FT                   /translation="MRSNHLFFRKVMTRLEVHPLNNSRLFCISDSSSTSLYSEPSKGST
FT                   IFAQQALDRFDWDLSIGETAFENMTDDAKMRNDPGMLVGPDGMLITPELLIASPGKIDV
FT                   FDCASLDDTAGALEGMSLASGEGSNCMQAMRPRSETRSTNTTTSRSVAKQILRNTYGPV
FT                   RYKDYANYLGSPENREVLREFIALLQPLPVSLLFSLRKLSKSIYFIAEAGAIDAMLEEM
FT                   SIQWVERHKPLHYQDNYKLVHIVLFSLLILNSDLYNDMAQMKFTSAQFVDNTVYALLRE
FT                   SPTIDKQSFEAELRVYYDLLAMDQLPLHKPPITASHSRDSANPTKKSSVFYSRGHRMER
FT                   TYSNSSTYSMSTISLQRTTTAIAAKQTAAVASWRFHNFSDLPLIYCKEPFDDEMNNTND
FT                   SSWLMDHIIQFQEPLGSVSRAAAASMVSPTAQPRRKLFNWLKKGQPDSIFKSHHEFGSA
FT                   EGKWYNARVRISEGRLYIFNFKNQPALDPKTADLELCRRRAASYTVQNLFGAMATFVQD
FT                   NIVYKSNSQTTWNFAITFPKTIDCETERTYQFQTSNMTMAQRFVQAATFWSARITPLPS
FT                   AQFEMVSNQEYGWGEKLLSRQVAATDVRLTDWMPLIGIDSIYDEIEDSGDLTVDSQLQN
FT                   LRVFTEHLTQLLDQHNSYKPKMVEIWTQNPSTQQFEMAMENWNRRYLYLNSMYEKHYTY
FT                   LRALETAFETVTG"
FT   CDS_pept        816320..817138
FT                   /codon_start=1
FT                   /gene_family="HOG000001110" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20626154"
FT                   /locus_tag="ABR219W"
FT                   /orf_name="AGOS_ABR219W"
FT                   /product="ABR219Wp"
FT                   /protein_id="AAS50992.1"
FT                   /db_xref="HOGENOM:HBG058274"
FT                   /db_xref="HOGENOM:HBG202431"
FT                   /db_xref="UniParc:UPI00002526E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D03"
FT                   /transl_table=1
FT                   /translation="MQKCSSTMHSRAKNTDAVEPPSALLWSKIKQPQFYWFLGHFLTLY
FT                   HYGCYTLSFRQAAIRYQYGSVLFYVAVTYGIVLYQFYKSGQLKPSTLKVQMRTLDNLQY
FT                   FVLTLVLWSCRHAKIISTATMSPVIFALFHSINYFKESLLPLLPLQAATKSALAGRISF
FT                   FITNYNERFLMIAQNSEFVTLVQVLLLLPVDCTALLLHLTVTNLLKVLAVVTYAWFFKL
FT                   RYLQSPQMKAMVHTYDVRADQLVRQSTPQLLPYWLRVKHLVLRFFKAIPC"
FT   CDS_pept        817544..818158
FT                   /codon_start=1
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19778685"
FT                   /locus_tag="ABR220W"
FT                   /orf_name="AGOS_ABR220W"
FT                   /product="ABR220Wp"
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="AAS50993.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="HSSP:121P"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00002526E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D02"
FT                   /transl_table=1
FT                   /translation="MNSEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDF
FT                   KIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQ
FT                   EIDRYGTAGVVKLLVGNKNDLKDKKVVDFEVAREFADSLNIPVLETSALDSSNVEEAFL
FT                   TMARQIKETMSHQQKESGKKDDKSGVNLKGQSLANSGGGCC"
FT   CDS_pept        complement(818270..818680)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764758"
FT                   /locus_tag="ABR221C"
FT                   /orf_name="AGOS_ABR221C"
FT                   /product="ABR221Cp"
FT                   /protein_id="AAS50994.1"
FT                   /db_xref="HOGENOM:HBG058275"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniParc:UPI00002526E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75D01"
FT                   /transl_table=1
FT                   /translation="MAGKADKKQAAANTAALRRLYTYVVPAVILSALRQLVFGDASVAR
FT                   YVLWHVPLAGALYTLERSGRPHYDGGRLARVGVALDASSGLTGALFDVVYTSVACDAVA
FT                   AALGTAAQWWLLFAWPVYWAYGGWRMLRPART"
FT   CDS_pept        join(818971..818980,819284..820404)
FT                   /codon_start=1
FT                   /gene_family="HOG000233339" [ FAMILY / ALN / TREE ]
FT                   /evidence="2: Evidence at transcript level "
FT                   /gene_id="IGI15764759"
FT                   /gene_name="ACT1"
FT                   /locus_tag="ABR222W"
FT                   /product="Actin"
FT                   /function="ATP binding"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="AAS50995.1"
FT                   /db_xref="EMBL:AAT12516.1"
FT                   /db_xref="EMBL:CAB38636.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00002526E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75D00"
FT                   /transl_table=1
FT                   /translation="MDSGEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIM
FT                   VGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV
FT                   LLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHV
FT                   VPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVAL
FT                   DFEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYN
FT                   SIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV
FT                   WIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF"
FT   CDS_pept        complement(820886..822760)
FT                   /codon_start=1
FT                   /gene_family="HOG000141933" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931656"
FT                   /locus_tag="AGOS_ABR223C"
FT                   /product="ABR223Cp"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS50996.2"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG058276"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001DB26D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CZ9"
FT                   /transl_table=1
FT                   /translation="MGKVYDLPRISGFLVIVGLVLGIDISAMAVFISSDYFNRYFHYPN
FT                   AFEQGMVSGAHPMGGLTGCLLFGYVGERVSRLGCFRYFTFIWIIGCIVSVLVMDIYMVA
FT                   IGRFIKGVAVGSLSVVASVYLVEIFPSNRKGIATALVQLTLTFGIFLMYMLCWTFSRFN
FT                   NHMAFRISWGLEIIPAVALISGTLFVPESPRWFVMQGQYKKAQEILTLLNCRSKNEFNK
FT                   QTLLNMYGDTAKASFKDLIKLPYIKQLIMGMTIQALVQFTGINVVMYYVVYICEMAGLE
FT                   GREKMNVASIPYLLNILFTFIPLHLLDRVQRKVLIVYGSFALAAIMNLIGLTMWIHGHD
FT                   VSPINGNPALVWKLSPLGGQITISLCFAFIAIFASTLSCAGWLYTNEVLADKIRSRGLS
FT                   ICMSVSWICNAVLTFLSPLMMSTMKWGTFFLFGMVTTMLTIIVWLAFPETLDISSSAPK
FT                   TESYEGGNTKPIAETKEHAEILENELKVASSASMQGQSTDTEELVEISYRSAAPPPESI
FT                   NEDITLQPPPPAIQKETLAPKRKTVQTQIESLFAAKAAGQRLSPEDEDIMITLTAISSD
FT                   FSGVSVRDLHNKFRSSRLGTERDVFSAAPGLDLNGLGTSDGKLSDRKS"
FT   CDS_pept        823072..823689
FT                   /codon_start=1
FT                   /gene_family="HOG000246793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764760"
FT                   /locus_tag="AGOS_ABR224W"
FT                   /product="ABR224Wp"
FT                   /function="peptidase activity"
FT                   /biological_process="signal peptide processing "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="signal peptidase complex"
FT                   /protein_id="AAS50997.2"
FT                   /db_xref="GO:0005787"
FT                   /db_xref="GO:0006465"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG175022"
FT                   /db_xref="InterPro:IPR007653"
FT                   /db_xref="UniParc:UPI0001DB26D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CZ8"
FT                   /transl_table=1
FT                   /translation="MFSLAQRFQVVSNKAMSWSLVTMAFVIVTSWIQLLHDNVFSLDSS
FT                   IANIMPTVRVRSSRYFGSSNGKPKENVRLEFDLDADLAPLFNWNTKQVFVYLTAEYNEP
FT                   DGLGGNVVTFWDHIIQDKAKSKVTLRAAKSKYSVWDATDRLSEKELSFKLHWNIQPWVG
FT                   PLAYGETAGEHVITIQRPEEGHAKSNKTKKARRHANQRAKNA"
FT   CDS_pept        complement(823810..826641)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778686"
FT                   /locus_tag="ABR225C"
FT                   /orf_name="AGOS_ABR225C"
FT                   /product="ABR225Cp"
FT                   /protein_id="AAS50998.1"
FT                   /db_xref="HOGENOM:HBG124653"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI00002526E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CZ7"
FT                   /transl_table=1
FT                   /translation="MKCLSALRHVQCVRFMQVAAQVSKRISPVQNAQAAYQSLPPGTQS
FT                   AMQNAREKADLGEEDLTLISQCNIRNSTVLRGAVLQYFKTFEQYGAVKKVAARLLMEPN
FT                   GDFRGDLTLAETKLYLESLVELRQFADAVQAVEKMIRQSALRSPWQAHKLVCVLFTRLW
FT                   AHIPPQEVLAYLASMLRALHGTCSFGPPWVNTDIVKLFFHFFRAFPEIESYQHQALSLI
FT                   ESQLDACAAAEFSSTLLQIHLVHRRFQLCEQVWKYKVQKKFPTTSADLTAIMEAYSHKG
FT                   DWQGVVDLYESHSSVRNLSNHFELKLYAHARLHDWRNLKDSFNCLFGLGKLPSLEHYSV
FT                   VMLALAHNGNTDLVEQLYLQLLRRGLTPTNAILRSMVLAGYKAGDLSRAVNNFELFKHN
FT                   GIKPTSGDYLLLLRVYRRLGDLELSFKALRRLTQESYTLYDKHFACIIDTCAKTCSHGV
FT                   ASELFKLMEEHYGVTATGHSVSSLMRVYLSSMLPQKAVNLFKIYSNKPLDSKFLLYPVL
FT                   LEAYLQLRNYKRFEETLKEFTSIEQSSYLNVCEVTIRYLAEHKHDTKAAEAVLDQFIKK
FT                   NPSSIRANLFEPILKEYDRTQDTDASLALFKNMAELKVAMSTKTLLYLLKSTFKRSLKT
FT                   HQDLNDYVEWSINILKRVRDKNIIMENSFLYPAVVAYPVKMLAKHHHPNTAVRLLTEYY
FT                   EIFGKKIPRSDESIVVTKALMVVAGEAQNWQEFEEHYSNLMEKISKMKGPENKVQDNKR
FT                   ISNVLFGVLGYKMESMQATGKIQEIPSVLQEYEQMGLILTNSMWNKIIKTLVSDDKTIK
FT                   LGIGFANENFIQGYSLRNANKLIQTSDEQFLSPFQKHIKERQKVNPKAFKPKKYLNYST
FT                   YCEIAKSLDEYLNRRCDQLDEEVAQLTNTYPRFMKRYLRRSRNVRNWRDFERRHNNFFE
FT                   HLHMQNELLLQAL"
FT   CDS_pept        827027..827449
FT                   /codon_start=1
FT                   /gene_family="HOG000247888" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18083027"
FT                   /gene_name="FYV7"
FT                   /locus_tag="ABR226W"
FT                   /product="rRNA-processing protein FYV7 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS50999.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG355491"
FT                   /db_xref="HOGENOM:HBG397273"
FT                   /db_xref="InterPro:IPR013730"
FT                   /db_xref="InterPro:IPR017265"
FT                   /db_xref="UniParc:UPI00002526E9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CZ6"
FT                   /transl_table=1
FT                   /translation="MVGVGKKFTKESKVREIQKNLHKRAKLKRQYLKTLEQEGYEVPEE
FT                   QKRQKPSFEQRKGEKKQKVDEKKEHARRRKREQKEEMEAKRQRELDELERAKVRQVERE
FT                   RRNKRIQQKTRSGQPKMGPRINDLLDKIQKDTTYTS"
FT   CDS_pept        complement(827537..829810)
FT                   /codon_start=1
FT                   /gene_family="HOG000231585" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20626155"
FT                   /gene_name="MEF1"
FT                   /locus_tag="ABR227C"
FT                   /product="Elongation factor G, mitochondrial "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="AAS51000.2"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="HSSP:1FNM"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB26D3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CZ5"
FT                   /transl_table=1
FT                   /translation="MLERAALLHRLRLPAHSLPFIYNGALFGGAKRSFSATSKRCTYEE
FT                   EKAVLDELKPQLTADDLKHSKLLRNIGVSAHIDSGKTTFTERVLYYTGRIKAIHEVRGR
FT                   DSVGAKMDHMDLEREKGITIQSAATYCSWDKDQESYHFNLIDTPGHIDFTIEVERALRV
FT                   LDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGADPFKAIQQINTKLRI
FT                   PAAAVHVPIGSESDLCGVVDIINRVAIYNEGENGEVLRKGPVPEELQDLVEEKRLLLVE
FT                   TLADVDDEMAEIFLDEQEPTVQQIKDAIRRATIARKFTPVLMGSALANTGIQNVLDAIV
FT                   DYLPEPSEVLNTALDVSNNETKVNLIPSSHHPFVGLAFKLEEGNYGQLTYIRVYQGKLK
FT                   KGGYITNVRTGKKVKVSRLVRMHSNEMEDVNEIGAGEICATFGIDCSSGDTFTDGKLKY
FT                   SMSSMYVPDAVISLSISPNSKDSATNFSKALNRFQKEDPTFRVRFDPESKQTIISGMGE
FT                   LHLEIYVERMRREYNVACTTGKPQVSYRESIQIPATFDYTHKKQSGGAGQYARVMGNLT
FT                   PVANSSENTFTTAVVGGRIPDKYLAACAKGFEEVCEKGPLIGHKVLGINMLINDGAIHA
FT                   VDSNELAFKTATTAAFVQSFMQAQPVVLEPIMTVTVTAPNEFQGNVITLLNKLQAVIQD
FT                   TENGHDEFTMTSECSLNTMFGFATSLRASTQGKGEFSLEFKQYSPASPQLQKQLIEEYR
FT                   KSKK"
FT   CDS_pept        complement(830015..831853)
FT                   /codon_start=1
FT                   /gene_family="HOG000159793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764761"
FT                   /locus_tag="AGOS_ABR228C"
FT                   /product="ABR228Cp"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51001.2"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052425"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI0001DB26D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CZ4"
FT                   /transl_table=1
FT                   /translation="MAQRVFFHMVALVLCQLLNLGLVAAKVHRFNFTTGWVTARPDGVA
FT                   KQVIGFNGQWPLPDIHVDKGDRVELYLTNGFADVGTTLHFHGLFHNSSEGNLAAMDGPD
FT                   MVTQCGIPPGQTYLYNFSVPTQVGTYWYHSHTGAQYADGMRGAFVVHDPDAPFEYDEEM
FT                   TLMVGDIYHKPYTQLVHEFLSRYNPTGAEPVPQNLLFNNTVDGSLYFKPNKTYLLRIIN
FT                   GAFFVSQYLYLEGHEFTIVETDGVYVQPNATNLLYLASGQRVSVLVHTKETTDRNFAFM
FT                   QLFDEDMLDDIPSSLQLNRTNHVIYDDSKPRANPYFLPDYNNPAEEFYLTPLHGKPLYE
FT                   HYDRQVVLDLHMDNLADGVNYAFFNNITYTTPKVPTLTTALTAGEFASNPLIYGNVNPF
FT                   VLRYGEIVEIVINNYDDGKHPFHLHGHNFQLVQKSPASISEDGETVRYNESAPVMPYPE
FT                   FPATRDTVVLEPNGHIVLRFRADNPGVWIFHCHVNWHMEQGLAAVFIEAPHELQAGDPL
FT                   SDNYRQVCAASNIPNAGNAGGNSANWLDLSDAPRQQDPLPAGFTAKGYFAFALTTLAGL
FT                   LGLYTITNFGLQKSVIDDAEMYNKLSVLLKENNVLD"
FT   CDS_pept        complement(832147..833208)
FT                   /codon_start=1
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764762"
FT                   /locus_tag="ABR229C"
FT                   /orf_name="AGOS_ABR229C"
FT                   /product="ABR229Cp"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="AAS51002.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002526EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CZ3"
FT                   /transl_table=1
FT                   /translation="MSSSMQQAVVLREKGAIVYEHRPVPVIEDPHYVKVKIEKTGICGS
FT                   DVHYYLHGSIGPFVVRSPMVLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEET
FT                   KSGHYNLCREMRFAATPPYDGTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAVHAN
FT                   RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVDS
FT                   SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTHVQVGSSRDYVSF
FT                   PLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYKFNAT
FT                   ADEHIIKTIIEGP"
FT   CDS_pept        complement(833468..836371)
FT                   /codon_start=1
FT                   /gene_family="HOG000113520" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18931657"
FT                   /gene_name="RGR1"
FT                   /gene_synonym="MED14"
FT                   /locus_tag="ABR230C"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 14"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="AAS51003.2"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG058278"
FT                   /db_xref="HOGENOM:HBG202434"
FT                   /db_xref="InterPro:IPR013947"
FT                   /db_xref="UniParc:UPI0001DB26D5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CZ2"
FT                   /transl_table=1
FT                   /translation="MTIAVKESKILYGNFDKAKSGIMKGSGGIVEQGPGLQQRIITPAK
FT                   EMPPEIPHVEFNQLPLSVLIRNLTVYAAKELSQYMKTNVRSTQDASTRKMEFLRLIIFL
FT                   RNQFLRLYVLVKWCKTIRQNNFHTMIDLLNWFRGTNIIVNNCLLALKDMSTSMAGAKLP
FT                   NPDLITALEVLMLGRPDLPTHGFLLTGDENGQQANKIPAKLILKRFRDLNTCLSVKISL
FT                   MDLPAEMHTYSIKDGRITFTVFPEFEISLSTIDRESPLFFVDVKFLFNENKFPLNTTKI
FT                   ALLVNDILYKSPTPLLSLYQFLHRYVLTLQLYMIHVELQDIETNGKYSGGNLAHHYDPK
FT                   KNIISLRYWLQSKMNSKCKALIGVEKTSQSIILQWHLPDTKEEGKTTKYNNLLGNIEAI
FT                   LDEITFNHARIIMSELLDTGLFEGDDNKNDTSDTLFFHVPVICVATAPVQLKINTISGI
FT                   FYFKNPSALLLSYAKQLNQTSDLDDVVNILERLRMDKIVHILRNMFEKTGWICEDVVKL
FT                   NKPILYDKHKDKKRILTRDLFIRIKDWPANWFFILNLVASGATCIVEKLIGKVQSVKGT
FT                   WEVKYLDQGNLQVSKLESITYQNVMHMQKTIIQKILNHMIIDSLNELKISKVICQGEAS
FT                   QKLPAYVQTNTAGASNVSIIAIGLESFLQGSKALSDTLESTIFLKMDYEQNEVKLFGKF
FT                   KKDTQMIRYQCDDLLINFIDKRGLAFHMTEDFTSLNHVVQYLTKFRQKLMQLVVLTDVT
FT                   EKLHNNFRSEHFQIVKLRPNEISFRYLKNSKDDQDCTIQIVTNETKIEKLQVQLSPLNP
FT                   QNIIQKYLECDKYDPHFIFNYLHFTSKLFSAVKSIESITNTNTMTITLHLHTLAAYQLS
FT                   YHDRLTGGQIALCIDLRNSPSRAGSMYHLYFAQEDYSASKNPMYPAILQVINNVFMLNN
FT                   NTKRKVPSVIRLGTGVACPLGDIEPLLEEIHSILIRS"
FT   CDS_pept        837016..839661
FT                   /codon_start=1
FT                   /gene_family="HOG000141932" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19778687"
FT                   /locus_tag="ABR231W"
FT                   /orf_name="AGOS_ABR231W"
FT                   /product="ABR231Wp"
FT                   /protein_id="AAS51004.1"
FT                   /db_xref="HOGENOM:HBG058279"
FT                   /db_xref="HOGENOM:HBG103836"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI00002526EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CZ1"
FT                   /transl_table=1
FT                   /translation="MDSRRTTSDLDLYGKTGSVNEVDECAMAEEEAGREESEGVQGGPP
FT                   LGAPVPEVFIIPSITPLRTSARPVASVGSLDFAHTPTKTGMYHVRGHRDSTTSIDSVAL
FT                   KSTPASPHVTPLNGVTSVEYVGQHSSALASVTGIIEQDAGIESVENHMNADQATHEPEI
FT                   NKAQKFFSNMISSLSFRTVGTSPSPASNKGSQSPCESAEPSKYTTVTSNSLGSKVTASD
FT                   ENKSLAESGLEPNSDALRGQSSTQTVDTSDTKKGYNKKLYTDKMLPGTKYRFATWKRNS
FT                   DFHKLFGSVDADDRLLDDFSCALSREFLYQGRLYVSESYICFNSNILGWVTNLVVPIRD
FT                   ILSFEKTTTAGLFPNGIALTMDSTKHYFASFLSRDSTFDFLEAVRTAYHTNSKAVIKSN
FT                   AYLDVPLNISGEEFFLKPIAELMQITAPPSRASAAADENSDIQDAIMSVDYVTPSGTVD
FT                   GSEQFRNDAYEDTSDSDILSPSDDSGKVMSEVFHLKEGCRYTYDGPYYHHETSFRYIPE
FT                   EHAEYTLAELTLNAPPGVVFQLIFSETNSSFIEEFLTAHNSTNLSEISPFTEVNPEGQH
FT                   FRNYTYTKALAYPVGPRSTKCIVQETVLHRDYEDYINVVNTTKTPDVPSGNSFSVKTRY
FT                   MFKWESPTTSLLKVSFWVEWVGSSWIRSMVNNSCKSGQIEATKSLVSQLYHYIDTYVEQ
FT                   RIISVELNTNEKSSLRTAAEQDYIEVASHPQQKQLLSASSELSSSASSILGNSAVSATS
FT                   TAVSNSAPARGSSWKFYTLYAMLTAIALLLIANLILQARIASRLNHRINLGDRMEWSTT
FT                   SLDELADKISAVIAVRSDRLAVVPSQAFRPDPTTGGQYVALTPEYSAFMEKLERLLAYL
FT                   DAHAVQRPAD"
FT   CDS_pept        complement(839750..840331)
FT                   /codon_start=1
FT                   /gene_family="HOG000154103" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15764763"
FT                   /gene_name="RFU1"
FT                   /locus_tag="ABR232C"
FT                   /product="Regulator of free ubiquitin chains 1 "
FT                   /function="cysteine-type endopeptidase inhibitor activity "
FT                   /cellular_component="endosome"
FT                   /protein_id="AAS51005.2"
FT                   /db_xref="GO:0004869"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="HOGENOM:HBG124007"
FT                   /db_xref="HOGENOM:HBG202436"
FT                   /db_xref="UniParc:UPI0001DB26D6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CZ0"
FT                   /transl_table=1
FT                   /translation="MKSSAQLCMEARNYNFNAAAPLRLYLATCVRLVEEAQAAAQADDV
FT                   ARAYMLYVRYLDLCMHQLSGHREVQQPVTDAERLSRDEYEQLLRLEVPAVLRLTEELKS
FT                   AVDLRHERGRASLARSVVPEAGRGEHSRQEVQLPPSFDEERFNRTVQWFLAAGRSMSLP
FT                   VSAEEPAVREVFSYPELPKLSMAAESWAPS"
FT   CDS_pept        840635..841576
FT                   /codon_start=1
FT                   /gene_family="HOG000193461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15764764"
FT                   /locus_tag="AGOS_ABR233W"
FT                   /product="ABR233Wp"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS51006.2"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG508874"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="UniParc:UPI0001DB26D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CY9"
FT                   /transl_table=1
FT                   /translation="MKIKVTVSSFGEQVLEVGADASLNELLTLVKEAYGGEVPLKSMRF
FT                   GYPPQQVELCGHDGKEELGELGISGGERIVFACESGGLDARESRIPPNLDGALSPPNKI
FT                   TMQPGMTLEIHEVPDDNSCLFHAISYALYKDTATSQQLREVVAREVEADPVAYSDSIVG
FT                   RPNREYAAWIRKRDSWGGAIEIAILSKYLATAMFVLDIDAGRYEKFNEDKYNEFIVLVF
FT                   SGIHYDTLQLSIAGAAVPQTVFDSSEPDSDVLLVRASEVASKMKKAGLSFNTYRERIRC
FT                   NQCGTVLLGDREVSQHAKQTGHIDFGQVSAYQ"
FT   CDS_