(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE11

ASHGO_3.PE11         Location/Qualifiers
FT   CDS_pept        complement(19203..19532)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18931661"
FT                   /locus_tag="ACL195C"
FT                   /orf_name="AGOS_ACL195C"
FT                   /product="ACL195Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51033.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058320"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000025270B"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CW1"
FT                   /transl_table=1
FT                   /translation="MADSGSDSHGDKRAAGYVHSTWKMKKPLRSCVRCRKNKIKCDSAT
FT                   RRPKPCSSCLKKGVGCELEYVIPPQRSKELRSLYENVAYVRLKLNELMESCDQLLDYCH
FT                   ASVDA"
     atggcagact cgggttcgga ttctcatggt gataagcgcg ctgcgggcta cgtgcacagc        60
     acgtggaaga tgaagaagcc tctacgatcc tgcgtgcgct gccgcaagaa taaaataaag       120
     tgtgactcgg ccacgcggcg gccgaagccg tgctcgtcgt gcttaaaaaa gggcgtgggc       180
     tgcgagctgg agtacgtgat tcccccgcag cgctcgaaag agctgcgctc gctctatgaa       240
     aacgtcgcgt acgtgcgcct gaagctgaac gagttgatgg aatcatgcga tcagctgctg       300
     gactactgcc atgcgagcgt ggacgcgtaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page