(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE110

ASHGO_3.PE110        Location/Qualifiers
FT   CDS_pept        169501..172005
FT                   /codon_start=1
FT                   /gene_family="HOG000248496" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15747796"
FT                   /locus_tag="AGOS_ACL096W"
FT                   /product="ACL096Wp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51132.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058321"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB2763"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CL5"
FT                   /transl_table=1
FT                   /translation="MAADGQTGPMESYQAVVQSGEVQELEYGQAAGYPEVMEVCGTLAG
FT                   REERNKRPAKRAPLACLRCRRRHVRCPGGTPCAKCAVANIACEYLEPSKKLIVSMKYLQ
FT                   RLQEDLARARKENAALNAALREERGEVEMQARTLAAEAEEGIQFHRNTVDEEDEVVPDF
FT                   AERRGRLVESRKGQRYFVGSSSMTLFGMEVQSLVPEALQRDRGELESPILGAARLAAPS
FT                   AVDQQAERVTLVHQDDNSTYKLVLNGSYGGTEELELHLRLPPFAYAMLLVDTFVTYNDG
FT                   CFYFFNEGIVKHSLRRSYAGHVAYQDYTLQAMWLCKVFLIFAIGEMYLGTANCDLNEHP
FT                   SSRRRSTLPGSGFFAHAAQLFSILFSSEGIENATAEGGIEIMLLYAFYLQVADRTVPSY
FT                   FYFGEALRACLILGWHVDAQRDVLTRFELEHHRRLWWTVYMFERMLSSKAGLPLSLSDN
FT                   TIATELPDDFDMSNPPPGCEHYIFAEAEYITHCVRITQVNAQILIKLYQKQPDSNILPI
FT                   IKDIVMQLLEWRANMSAFLQVDFTQKELKISRLCTNMFTEYFQGLNLAIRPLLFHFVSK
FT                   QLASFQETNTYINLSKYSKTISSLLNCSLQASINSIRSLWVLMGENMVALFGYMDREYL
FT                   FTSACTLIFFNAAFGIHEQTYHHLDHALRIFTKMRDLGNHPAGLRMAQLLRLMIDLDFH
FT                   DVMKDLIAKHSDSSRCASSSFDQPQAEIDTLMQPRPQSPTASTTSSSALSTDSVAPDMT
FT                   ELSKHETLTIEKNVSRLDLQTLDMHEDLQELLDNLDEVGKSDDQLWKEVTDQAMWLGSS
FT                   MDPTSALGNEADFYRSNSTQFK"
     atggcagcgg acgggcagac gggaccaatg gaaagttatc aggcggtggt ccagtctggc        60
     gaggtacagg agctcgagta cgggcaagcg gctgggtacc cggaggtgat ggaggtttgc       120
     gggacactcg cggggcgcga ggagcgcaac aaacggccgg caaagcgggc accgctggcg       180
     tgcttgcgct gccggcggcg gcacgtgcgg tgccccgggg ggacgccgtg cgcgaagtgc       240
     gcggtggcga atatcgcttg cgagtacctg gagcccagca agaagctgat agtgtcgatg       300
     aaatacctgc agcggctaca ggaggacttg gcgcgggccc ggaaggaaaa cgcggcgctg       360
     aacgcagcac tgcgcgagga gcggggcgag gtggagatgc aggcacggac gctggcggct       420
     gaggcggagg aggggatcca gttccaccgc aacacggtgg acgaggagga cgaggtggtg       480
     ccggactttg ctgagcggcg ggggcggctg gtggagtcgc ggaaggggca gcggtacttc       540
     gtgggctcgt cgtcgatgac gctcttcgga atggaggtgc agtcgctggt gccggaggcg       600
     ctgcagcgcg accggggcga gttggagagc cctattctag gcgccgcgag gctggccgcg       660
     ccgtctgcgg tggatcagca ggcggagcgg gtcacgctcg tccatcagga tgacaactcc       720
     acctacaagc tggtgctgaa cggtagctat ggtggcacag aggagctcga actgcacctg       780
     cgtctgccgc cctttgccta cgcgatgctt cttgtcgata ccttcgtgac ctacaatgat       840
     ggctgcttct acttcttcaa cgagggcatc gtgaagcaca gcctgcggcg cagctacgct       900
     ggccacgtgg cttaccagga ctacacgcta caggcaatgt ggctatgtaa agtctttctt       960
     atctttgcaa taggcgagat gtatctgggg accgcgaact gcgatctaaa tgaacatccg      1020
     tcgtcgcggc gaaggtcaac gctcccgggg tccggcttct ttgcgcatgc cgcgcagctc      1080
     tttagcattc tcttctcaag cgaaggcatt gagaacgcca ctgccgaggg cggcatcgag      1140
     atcatgctac tctatgcctt ttacctgcag gtagcggatc gcactgtacc ttcttacttt      1200
     tatttcggcg aggcgctgcg tgcctgccta attctggggt ggcatgtgga tgcacaacgt      1260
     gatgtgctga ctcgtttcga gctggagcac catcgaaggc tgtggtggac tgtgtacatg      1320
     tttgagcgca tgctgagcag caaagcgggt cttcccctca gtttgtcaga taacaccata      1380
     gcgactgaac tcccggatga ctttgacatg tcaaaccctc cgccaggctg cgagcactac      1440
     atatttgcgg aagccgagta cattacccat tgtgtgcgaa tcactcaggt gaatgcgcag      1500
     atcttgatca agctttatca gaaacagccg gattcgaata ttcttcctat cattaaggat      1560
     atcgtcatgc agctcttgga atggcgggca aatatgtcgg cattcctcca ggttgacttc      1620
     acacagaagg aactcaagat ttcgagactc tgcacgaata tgttcacaga atacttccaa      1680
     gggttgaacc tcgctatcag accgttgcta ttccattttg tttcaaagca actggccagt      1740
     tttcaggaaa caaatacgta cattaaccta tcgaagtatt caaaaactat ctcctcctta      1800
     ttaaattgct cgttgcaggc ctccatcaac tcaattcgct ctttatgggt tcttatgggg      1860
     gaaaatatgg ttgccctgtt tggatacatg gacagggagt atttatttac atcagcatgc      1920
     actttgatat tttttaatgc tgcctttggt atccacgaac agacatatca ccatctagac      1980
     catgctctga ggatatttac caagatgagg gacctaggta accatcctgc aggccttaga      2040
     atggcacagt tactacgcct aatgatcgat ttagattttc acgatgttat gaaggatttg      2100
     atcgccaagc attctgacag ctcccgctgt gcctcgagct cttttgacca gccacaggct      2160
     gaaatagaca cgcttatgca gccaagacca cagtcaccaa cagcgagtac aacaagcagc      2220
     tccgcattat caacggattc cgttgcgcct gatatgactg aattgtcaaa gcatgaaacg      2280
     ctgaccatag agaaaaatgt cagtagatta gatttgcaaa ccctagatat gcatgaagat      2340
     ttgcaagagc ttttggataa cttagacgaa gtaggcaaat cagatgatca gctgtggaag      2400
     gaagtgacgg atcaggcgat gtggctaggc agctctatgg accccacttc tgcattaggc      2460
     aatgaagcgg acttctatag gtccaactct acccaattca agtga                      2505
//

If you have problems or comments...

PBIL Back to PBIL home page