(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE113

ASHGO_3.PE113        Location/Qualifiers
FT   CDS_pept        complement(178229..181261)
FT                   /codon_start=1
FT                   /gene_family="HOG000094358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20621898"
FT                   /locus_tag="AGOS_ACL093C"
FT                   /product="ACL093Cp"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS51135.2"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058323"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001DB2764"
FT                   /db_xref="UniProtKB/TrEMBL:Q75CL2"
FT                   /transl_table=1
FT                   /translation="MRQPDGSVQQWDGAEGGDTPTMHTNNSMLSFNDDYTSLLNNLTNA
FT                   GVAAERATQPSERNAHRGGDGRQSLDQLLQQYHAVEEKVGNGGSEGRLQFASGEQPDTR
FT                   KAAAGGDGAVPGNQCDHCRRRQVKCVTVAEHSNCLQCETKGIKCVFSEMPSARMKKTLQ
FT                   QGMQNKRSRSEENGAWIQELLKRTKGSVPSSSESISQFYADLLQNLNSTLANTPPPPIF
FT                   SKKNHEAGIPIHSASSPSGPGHYSYASNPPTADAVGRNDSHLNSALAKYPRSSFYVGPT
FT                   SMFDVNLVNHMKLDKIDQVQLSNTLALRKVAPGVQFVLRADFNHQLYLKNERDVDLVEK
FT                   LVHPHGKILVDIFFKLIHPYFPILHERVFLEKYSKSYRELTAPILASIYSLALQWWDFH
FT                   PQAVGFQRPDVIDQLNEIALRTFFDVLERPKLSIVQTGLLILQCRSECPNNWILCSEVV
FT                   ALAEDLGLGIDCKDWRLPSWERGLRRRLAWAVWYQDKWISMLEARYSHLILGRNWLVKM
FT                   LSDQDFPANSPVISNSQEKSNANIGTGKTAPSNISVLDLSPTDEDFNNGKLLFRQMVSL
FT                   SIILGEILDTFYTLGAISTTTKIEQVLKLAKPLQLKLREWYHSLPSKLSMNNFQPRKFN
FT                   SNASLTLAYFAAEITLHRKIITTLQPDSPGDLVQVCRTAAKTRLIAAIEFVRDLKTEHI
FT                   SAFWYSCTTGNLTLISTFAGLLYVTAPTKEDAQVFRDCLRNYVWILRMASKSYEKAANA
FT                   LDRIQMLLSQIPGLLTDEVAPQQFAPPRSQSPYSQQYSTAGSHSGFEAQSGQNTAGMLD
FT                   GDPNLSTGTFQQLRSLPQDVLLTLKSIQHNLPGVPHDIRGHRPTAAKSDDELELSPGYT
FT                   GASAQVQGTGPYKGGQQEHTNSKPSATSSSSATMPSATNGKSGSESSASFGGDTDSSGK
FT                   RNSSNSNAGAAFKPNSALESGQDTQVGSTSPTPSSSVDNPQSKRVEDNTSLVKSPRNSP
FT                   NMPGSTGGSSSVESASVEHSE"
     atgcggcagc cggacggtag tgtgcaacaa tgggatgggg cagagggcgg cgacacgccg        60
     acgatgcaca cgaacaactc aatgctgagc ttcaatgatg actacacgag cttactgaat       120
     aatctgacga atgccggcgt tgcggcagag cgggcgacac agccgtcgga gcgaaacgcg       180
     catcgcggcg gagatggccg gcagagcctg gaccagctgc tgcagcagta ccatgcggtc       240
     gaagagaagg tgggcaacgg cgggagcgag gggcggctgc agttcgcgtc gggagagcag       300
     ccagacacgc gcaaagcggc agcagggggc gatggggctg tgccgggcaa ccagtgcgac       360
     cactgcagga ggcgacaggt gaaatgcgtg accgtggcgg agcactcaaa ctgtctccag       420
     tgcgagacca aaggcatcaa gtgcgtgttt tcggagatgc catctgcgcg catgaaaaag       480
     acgctgcagc aagggatgca gaacaagcga tcgcgctctg aggagaatgg cgcctggata       540
     caggagctcc tgaagcggac caagggcagc gttccatcca gcagcgaaag catttcgcag       600
     ttctatgcag acctgctcca gaatctaaat tctaccctgg cgaatacgcc gccaccgccg       660
     atattttcca agaagaacca cgaggcgggc attccgatcc atagtgcatc ttcacctagt       720
     ggccccggac actactcata tgcctccaat ccgccgacgg ccgacgccgt tggccgcaac       780
     gactcgcatc tcaactctgc tctggccaag tacccacgtt cctctttcta cgtgggcccc       840
     acgtccatgt ttgacgtgaa cttggtgaat cacatgaagc tggacaaaat agatcaggtg       900
     cagctatcca acacactggc gctgcgtaaa gttgcgccag gtgtccagtt tgttcttcgc       960
     gctgatttta accaccaatt gtacttgaag aatgaacgtg atgtcgatct agttgaaaaa      1020
     cttgttcacc ctcacgggaa gattctagta gatatcttct tcaagctcat acacccgtat      1080
     ttcccgattc tgcacgagcg ggtgtttctg gaaaagtatt ccaagtcata tcgcgaattg      1140
     acagccccca ttctcgcgtc tatttattct ctagctctcc aatggtggga ctttcacccg      1200
     caggcggttg gcttccaaag accagacgtt attgaccaac ttaatgagat agcactgcgt      1260
     actttttttg atgttttgga acgcccaaaa ctcagtatcg tacagactgg cctgttgatc      1320
     ctgcaatgtc gaagcgagtg tcccaataat tggattctct gctctgaggt tgtggcgctt      1380
     gcggaggatc ttggcctggg tatagattgc aaggattggc ggcttccaag ctgggaaaga      1440
     gggttgagga ggaggctggc ttgggctgtg tggtatcaag acaaatggat atctatgcta      1500
     gaggcaagat attctcatct gatattgggc aggaactggc ttgtgaaaat gctctctgac      1560
     caagattttc cagcaaactc tcctgtcata agtaacagcc aagagaagag taatgccaat      1620
     atcggcacgg gtaaaacagc tcctagtaac atatcagtgc tcgacctttc cccaactgat      1680
     gaggatttta ataatggaaa acttttattc cggcagatgg tttcactgag cattattttg      1740
     ggtgagatat tggatacatt ttacaccctc ggtgcaataa gcacaacaac aaaaattgag      1800
     caagttttga agctggcaaa gccattacag ttaaaacttc gtgagtggta tcattcgttg      1860
     ccttcaaaac tttccatgaa caattttcaa ccaagaaagt tcaatagtaa tgcatcttta      1920
     acgcttgcat acttcgcagc tgaaataacc cttcacagga aaattattac caccttacag      1980
     cctgactcgc cgggcgattt agttcaggtt tgtcgcaccg ctgccaaaac taggcttatt      2040
     gctgcgatag agttcgttag agatctcaaa acggagcata taagcgcgtt ctggtactcg      2100
     tgcacaactg gaaatctaac attgataagt acctttgccg gtttattata tgttacagcg      2160
     ccaacgaagg aggacgcaca ggttttccgt gattgcttgc gcaattacgt gtggatattg      2220
     agaatggcat caaaatctta tgaaaaggct gcgaacgctt tggatagaat acaaatgttg      2280
     ttatcacaga tcccgggtct tttgaccgac gaagtggcgc cacagcagtt tgctccaccg      2340
     cgttcgcaat ctccttattc ccaacaatat tccacagctg gctcacattc aggcttcgaa      2400
     gcacagagtg gacagaacac cgcgggcatg ctggatggtg atccaaatct ctcaacagga      2460
     accttccagc agctccgatc tttgcctcaa gacgttttat tgacattgaa aagcatccag      2520
     cataatcttc ctggagtccc tcacgatatt agaggccatc gcccaactgc agcaaaatct      2580
     gatgatgagc tagagctatc gccaggatat acgggagcat ccgcccaagt gcaagggaca      2640
     ggcccataca agggcggtca acaagaacac actaatagca agccttctgc cacatcttct      2700
     tcatcggcca ctatgcccag cgccacgaat gggaaatccg gatccgaaag tagtgcgtcc      2760
     tttggaggag acactgacag tagcggtaaa agaaactcct caaacagcaa cgcaggggcc      2820
     gcttttaagc cgaactctgc gctggagtca ggccaggata ctcaggtagg ctctacttcg      2880
     cccacccctt cctcctcagt ggataaccct caatcaaaaa gggtcgaaga taacacttcg      2940
     ttagtgaaga gccccagaaa ttctccaaat atgcccggaa gcactggcgg ctcaagcagt      3000
     gtagagtccg cctcggtaga acacagcgag tag                                   3033
//

If you have problems or comments...

PBIL Back to PBIL home page