(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_3.PE120

ASHGO_3.PE120        Location/Qualifiers
FT   CDS_pept        complement(192725..196348)
FT                   /codon_start=1
FT                   /gene_family="HOG000113866" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774440"
FT                   /gene_name="NST1"
FT                   /locus_tag="ACL086C"
FT                   /product="Stress response protein NST1 "
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS51142.2"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG058328"
FT                   /db_xref="UniParc:UPI0001DB2767"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q75CK5"
FT                   /transl_table=1
FT                   /translation="MGLDNPTVVTGQNVQFSYDMASSSKKSRNKKKKSKPSIKEPQSAP
FT                   LLAVETESVEETHPQAELYDSEADYPSSRVIRRAANGDVIVESLNEAGSGVQAQQAQQQ
FT                   KHSAISSKLVAHWESLSPEEKRKILSISKEEVFSVTKSYQTLHNCNCTVCGRRHVPMEQ
FT                   ELESIYNQLYEMARQDNPNSDFVLFHLNLIKELQRGTSSGAEQRTASLQSRGASFLDNM
FT                   RDEAVKYCISNEGVDRLKEEVLQFKHNKQRQYSEQQRKQQLPPVHTHNSPSDSPSIDEL
FT                   PEREQESLLHTLPDELGPDSSEVNEQLREKYLKFAKTFVSSHPKIAQEYVNRMMMYPDM
FT                   RALTEDLIKNNGQDFVKAMEAFVSSQQDGPLPGSPEHTKLTAEQFQELQKQLVEKAGLD
FT                   MSQSPVPTNDDPPQDCTDTDEIDTDLRGRVLLKQFMAGESIINQAFKSLQGSNKNQLKK
FT                   SVSHSSQGLPEDSEYDEDLNYSDSYDDEDSPYDDDVYDDNDAESYDEDDDSHHKHHHQQ
FT                   HLHHHHREQDAEADDYDSDIDQQERLEEGRGLIQIAITKLLQRKLIVSYQEKQAERNRE
FT                   RLLLELEAEEQQKKEKEEKKLKKKEKEKEKKRQMQLAKEEEKRKQVEEEARLKQEAEAR
FT                   EMQRRENQRKKVEEAKRKKDLEMRKRLEEQRRREEEQERQRRMKEEIKRKRDQERKQRE
FT                   EEQRKRKQEKELKKLQSLEVKKKREEDDKPTEESSQEDNLHKENISHDLLNQLAHPAGG
FT                   VPYGIVPVKQEMSEEKTVNDDIFNMINEATSKSISTSKSISTSPSHFNALLQKGIPRKS
FT                   IDTSSIGLNYASAQAALPQPLSFPVDLTEALGFAQKTQVQTSISGPPGLSKNTAASSWD
FT                   NVPGYVQLSPKSVTQNHSNVQVQTTPHGSVPGQHRASYSTFGASVDPNDTFSGDLTNLT
FT                   NFLVQTKLEDVSTSAPLHSVSSSTTALPRGETSIYGNNLWNNEQPHIGSLISSHASGPS
FT                   TQAPLHPRRSIWDNNASVNNYAADLWGNTSSNSTPIAPSTAVASSMVSAHQASATDVII
FT                   QAYTLLSTSGGFVPIDVLYQNCLSYLTDKGSFTFGQFVGQLLALRNANECEVLSNDVGM
FT                   MTHCRFTTPQLQSTLYAPAAAPGGSDLPPRQPSKGLFSDPVSTSTVGLTTIPVLSTSTG
FT                   STSSATPTGSIALGQPSSGQSNFFDFNQQLAQPSRANNIWG"
     atggggcttg ataatccgac agtggtcaca ggtcagaacg ttcaattcag ctacgatatg        60
     gcatcgtcaa gcaaaaagag tcggaataaa aagaagaaga gcaagccgtc gataaaggag       120
     ccccagagcg cacctctgtt ggctgtggag acagagagcg tcgaggagac gcatccacag       180
     gcagagctgt atgatagcga ggcagattac ccgagctcgc gcgtgattcg ccgggctgca       240
     aacggcgatg tgatcgtgga atcactgaat gaggccggta gtggcgtgca ggcacaacag       300
     gcgcagcaac agaagcacag tgcaatctcc agcaagctag ttgctcactg ggagtcactg       360
     tctccggaag agaagcgcaa aattctgagt atcagcaagg aggaggtgtt cagcgtgacg       420
     aagagctacc agacgttaca caactgcaat tgcacggtgt gcggaaggcg gcacgtaccg       480
     atggagcagg aactggagtc gatatacaac caactatacg agatggctag acaggacaac       540
     cccaactctg attttgttct gtttcacctg aatctgataa aggaactaca gcgtggcacg       600
     tctagcggag cagagcaacg cacagcctcg ctgcagtctc gaggagctag ttttctggat       660
     aatatgcgag atgaggcggt caagtattgt atatctaacg agggcgttga cagattaaaa       720
     gaggaggtat tacagttcaa acacaacaaa cagcggcagt attccgaaca gcagaggaag       780
     cagcaacttc caccagtcca tacccataac agcccgtcag actctcctag tattgacgaa       840
     cttcccgagc gagaacagga atctttactc catacgttac ctgatgagtt aggcccagat       900
     agttctgagg tcaacgaaca actgcgggaa aagtacctta agttcgccaa aacgtttgtt       960
     tcctcccacc ccaagatagc gcaggagtat gtgaaccgaa tgatgatgta ccctgacatg      1020
     cgcgctttaa cagaagattt gataaaaaat aatggccagg attttgtaaa ggctatggag      1080
     gcatttgtct cttctcaaca ggatggcccc ttacctggct cccctgaaca taccaagctt      1140
     accgcagaac agtttcagga gctgcaaaaa cagctggttg agaaagctgg tttagatatg      1200
     tcccaaagtc cagtgcccac taatgatgac ccacctcaag actgtactga tacggatgaa      1260
     attgacaccg acttacgggg gcgtgttcta ttgaagcagt ttatggcggg tgaaagtata      1320
     atcaatcagg cctttaagag tttgcaaggt agcaataaga accagttgaa gaaatcagta      1380
     tcacattctt cccaaggact tcctgaagat tcggaatatg atgaagatct gaactattca      1440
     gatagctatg atgacgaaga ttcaccatat gatgacgatg tatacgatga taatgatgct      1500
     gaatcctacg acgaagatga cgatagccat cataagcacc atcatcaaca acatcttcat      1560
     caccaccatc gtgagcagga tgccgaagca gatgactatg atagcgatat agatcagcaa      1620
     gaaaggctag aggagggtag aggattgatc cagatagcca tcacgaagtt actgcaaagg      1680
     aaactaattg tctcatatca ggaaaaacag gcggaaagga acagggaaag actattattg      1740
     gagttggaag cagaagaaca acagaagaag gaaaaggagg aaaagaagct gaagaagaag      1800
     gaaaaggaga aagaaaagaa gagacagatg caattggcta aagaggagga gaaacggaag      1860
     caagtggaag aagaggctcg cttaaagcag gaagcggagg cccgcgagat gcagaggaga      1920
     gaaaaccaaa ggaaaaaggt ggaagaggca aagagaaaga aagatttgga aatgaggaaa      1980
     cggttagagg aacaaagacg ccgggaagaa gagcaggagc gtcaaaggag aatgaaagaa      2040
     gaaataaagc gcaagcgtga tcaggaaaga aaacagcgag aagaggaaca gaggaaaagg      2100
     aaacaggaga aagaattgaa gaagctacag agcttggaag tgaagaagaa acgagaagaa      2160
     gacgacaagc ctacagaaga atcaagccaa gaggataacc tgcataaaga aaatatttcc      2220
     catgatctat tgaaccagtt ggcccaccca gcaggtggtg taccgtacgg tatagtgccg      2280
     gtcaagcagg agatgtcgga agaaaaaacg gttaacgatg acatatttaa tatgatcaac      2340
     gaggcgacat ccaagtccat ctctacctca aagtccatct ctacctctcc atcacacttt      2400
     aacgctcttc tgcagaaagg tatacctcgg aagtcgatag atacctcgtc catcggtctt      2460
     aattatgctt ctgcacaagc ggctctgccg cagccactga gttttcctgt tgacttaacg      2520
     gaggctttag gttttgctca gaaaacgcaa gtacagacat ctatttctgg tccgccaggg      2580
     ctatctaaga acacagcagc cagttcgtgg gataatgttc cgggttacgt tcaattgtct      2640
     cccaagtctg taactcaaaa ccattcaaac gtccaagtcc agacaacacc gcacggtagt      2700
     gtgcctggac aacacagagc cagttattcg actttcggcg catctgtgga tcctaatgac      2760
     acgtttagtg gcgaccttac aaacctgact aatttcttgg tgcagacaaa actcgaagat      2820
     gtgtccacta gcgccccctt acactctgtt tcctcctcta ctacggcact gccccgtgga      2880
     gagacttcta tatatggcaa caatttgtgg aataatgaac aaccgcacat aggcagcctc      2940
     atctcaagcc acgctagtgg gccttctaca caggcccctc ttcatccccg gcggtcgata      3000
     tgggataaca acgcctcggt gaacaactac gcagccgacc tttggggtaa tacttcctcg      3060
     aattccacgc cgatcgctcc atccactgcc gtggcctcgt caatggtctc agcccaccag      3120
     gcttccgcga cagacgtgat aatacaggcc tacacgcttc tgtccaccag tggtggcttt      3180
     gttccgatcg atgtactgta tcagaactgt ctgtcgtatc tcacggacaa gggcagcttc      3240
     acgttcggcc agtttgtcgg ccagctactg gccctgcgga atgccaatga gtgcgaagtg      3300
     ctcagcaacg acgtgggcat gatgacacac tgccggttca ccactcccca gctacagtcg      3360
     acactgtacg ccccggcggc agcgcccggc ggctcggact tgccgcctcg gcagccatcg      3420
     aagggccttt tcagcgaccc cgtgagcacc agtaccgtgg gtctcaccac gatccctgtg      3480
     ctgagcacca gtaccggctc cacgtcgtcg gccacgccca ccggctcaat tgccctgggc      3540
     cagccgtcca gcggccagtc caatttcttc gacttcaacc aacaactcgc ccaaccctcc      3600
     agggcaaaca atatctgggg ctga                                             3624
//

If you have problems or comments...

PBIL Back to PBIL home page